"Fossies" - the Fresh Open Source Software Archive

Contents of php_manual_en.tar.gz (4 Dec 06:08, 11668470 Bytes)

About: PHP is a server-side html-embedded scripting language. Documentation (multiple HTML-files; English language).



Fossies path:  /linux/www/php_manual_en.tar.gz   [Download | CLOC analysis]
Alternative downloads:  tar.bz2 | tar.xz | zip
Member paths+URLs:  Shortened | full
Member sort order:  docs related | original | size (top100) | date | path | name | ext | top-path files

drwxr-xr-x         0 2016-12-04 06:08 
-rw-r--r--      2741 2016-12-04 06:07 function.ncurses-halfdelay.html
-rw-r--r--      7336 2016-12-04 06:07 function.mb-convert-encoding.html
-rw-r--r--      4900 2016-12-04 06:07 maxdb.constants.html
-rw-r--r--      4400 2016-12-04 06:08 function.ps-set-border-dash.html
-rw-r--r--      2540 2016-12-04 06:07 constants.newt.reasons.html
-rw-r--r--      1342 2016-12-04 06:07 hash.configuration.html
-rw-r--r--      2270 2016-12-04 06:08 function.pdf-stringwidth.html
-rw-r--r--      4169 2016-12-04 06:07 gmagick.frameimage.html
-rw-r--r--      3119 2016-12-04 06:08 internals2.opcodes.assign-ref.html
-rw-r--r--      4961 2016-12-04 06:07 book.enchant.html
-rw-r--r--      8120 2016-12-04 06:07 function.grapheme-stripos.html
-rw-r--r--      3016 2016-12-04 06:07 imagickdraw.pathlinetohorizontalabsolute.html
-rw-r--r--      3220 2016-12-04 06:08 internals2.counter.counter-class.bumpvalue.html
-rw-r--r--      3805 2016-12-04 06:07 function.dcngettext.html
-rw-r--r--      3209 2016-12-04 06:07 function.imap-num-recent.html
-rw-r--r--      3406 2016-12-04 06:08 function.svn-client-version.html
-rw-r--r--      2398 2016-12-04 06:07 book.password.html
-rw-r--r--      3946 2016-12-04 06:08 internals2.opcodes.declare-class.html
-rw-r--r--      4297 2016-12-04 06:07 refs.compression.html
-rw-r--r--      6699 2016-12-04 06:07 function.ibase-fetch-object.html
-rw-r--r--      8737 2016-12-04 06:08 ds-map.get.html
-rw-r--r--      5330 2016-12-04 06:08 memcached.replacebykey.html
-rw-r--r--     13004 2016-12-04 06:07 mysqli-stmt.error.html
-rw-r--r--      4683 2016-12-04 06:07 function.error-get-last.html
-rw-r--r--     22019 2016-12-04 06:07 imap.constants.html
-rw-r--r--      3768 2016-12-04 06:08 sdo-das-xml.loadstring.html
-rw-r--r--      5254 2016-12-04 06:08 ds-deque.rotate.html
-rw-r--r--      9855 2016-12-04 06:07 tokyotyrantquery.next.html
-rw-r--r--      9139 2016-12-04 06:07 function.mt-rand.html
-rw-r--r--      2695 2016-12-04 06:07 function.trader-rocr.html
-rw-r--r--      5606 2016-12-04 06:08 function.md5-file.html
-rw-r--r--      6288 2016-12-04 06:07 function.rewind.html
-rw-r--r--      1342 2016-12-04 06:08 intro.yar.html
-rw-r--r--      2621 2016-12-04 06:07 function.mysqli-bind-result.html
-rw-r--r--      9222 2016-12-04 06:07 function.imageellipse.html
-rw-r--r--      2430 2016-12-04 06:08 yaf-config-simple.toarray.html
-rw-r--r--      7606 2016-12-04 06:08 splobjectstorage.setinfo.html
-rw-r--r--      2237 2016-12-04 06:07 imagick.installation.html
-rw-r--r--      2668 2016-12-04 06:08 internals2.counter.html
-rw-r--r--     11901 2016-12-04 06:08 function.array-replace-recursive.html
-rw-r--r--      7812 2016-12-04 06:07 function.pg-escape-literal.html
-rw-r--r--      3135 2016-12-04 06:08 xsl.examples-collection.html
-rw-r--r--      2614 2016-12-04 06:08 stream.contexts.html
-rw-r--r--      2922 2016-12-04 06:08 class.yaf-exception-routerfailed.html
-rw-r--r--      4243 2016-12-04 06:07 function.sqlite-next.html
-rw-r--r--      5270 2016-12-04 06:07 class.typeerror.html
-rw-r--r--      3159 2016-12-04 06:08 book.exec.html
-rw-r--r--      2548 2016-12-04 06:07 function.newt-entry-get-value.html
-rw-r--r--      2660 2016-12-04 06:08 intro.session-pgsql.html
-rw-r--r--      1238 2016-12-04 06:08 ssdeep.constants.html
-rw-r--r--      3207 2016-12-04 06:07 function.gzrewind.html
-rw-r--r--      4209 2016-12-04 06:08 ds-set.toarray.html
-rw-r--r--      3484 2016-12-04 06:07 function.dio-read.html
-rw-r--r--      3380 2016-12-04 06:07 function.apd-dump-regular-resources.html
-rw-r--r--      6974 2016-12-04 06:08 appenditerator.getinneriterator.html
-rw-r--r--      2851 2016-12-04 06:08 reflectionclass.gettraitaliases.html
-rw-r--r--      3262 2016-12-04 06:07 function.trader-cdltristar.html
-rw-r--r--      3190 2016-12-04 06:08 streamwrapper.stream-close.html
-rw-r--r--      6264 2016-12-04 06:07 function.mysql-info.html
-rw-r--r--      6222 2016-12-04 06:07 mongocursor.doquery.html
-rw-r--r--      3357 2016-12-04 06:08 function.session-abort.html
-rw-r--r--      9274 2016-12-04 06:07 function.pg-send-query.html
-rw-r--r--      3352 2016-12-04 06:08 refs.basic.text.html
-rw-r--r--     13520 2016-12-04 06:08 index.html
-rw-r--r--      1745 2016-12-04 06:08 function.strchr.html
-rw-r--r--      3799 2016-12-04 06:08 sphinxclient.addquery.html
-rw-r--r--      6233 2016-12-04 06:07 function.wincache-ucache-exists.html
-rw-r--r--      5446 2016-12-04 06:08 memcached.incrementbykey.html
-rw-r--r--      1616 2016-12-04 06:07 dbx.resources.html
-rw-r--r--      2166 2016-12-04 06:08 ui-point.gety.html
-rw-r--r--      5743 2016-12-04 06:07 function.sqlsrv-close.html
-rw-r--r--      2255 2016-12-04 06:07 mysqlnd-memcache.installation.html
-rw-r--r--      6399 2016-12-04 06:07 imagick.unsharpmaskimage.html
-rw-r--r--      1554 2016-12-04 06:08 libevent.setup.html
-rw-r--r--      1575 2016-12-04 06:08 event.requirements.html
-rw-r--r--      2772 2016-12-04 06:07 function.ncurses-insstr.html
-rw-r--r--      3494 2016-12-04 06:08 internals2.opcodes.add-var.html
-rw-r--r--      8925 2016-12-04 06:07 language.namespaces.dynamic.html
-rw-r--r--      1505 2016-12-04 06:07 ifx.setup.html
-rw-r--r--      3076 2016-12-04 06:08 harupage.setwidth.html
-rw-r--r--      1988 2016-12-04 06:08 solrquery.getexpandsortfields.html
-rw-r--r--      1942 2016-12-04 06:08 function.pdf-set-text-rendering.html
-rw-r--r--      2364 2016-12-04 06:07 imagickdraw.getclipunits.html
-rw-r--r--      3451 2016-12-04 06:08 function.hebrevc.html
-rw-r--r--      2138 2016-12-04 06:08 function.pdf-setlinewidth.html
-rw-r--r--      5310 2016-12-04 06:08 function.strpbrk.html
-rw-r--r--      3430 2016-12-04 06:08 ui-draw-pen.fill.html
-rw-r--r--      5186 2016-12-04 06:08 function.ps-setcolor.html
-rw-r--r--      9922 2016-12-04 06:07 language.namespaces.nsconstants.html
-rw-r--r--      1287 2016-12-04 06:07 dir.requirements.html
-rw-r--r--      3360 2016-12-04 06:08 ds-map.capacity.html
-rw-r--r--      6110 2016-12-04 06:08 function.chr.html
-rw-r--r--      3074 2016-12-04 06:07 class.mongodb-driver-cursorid.html
-rw-r--r--     21890 2016-12-04 06:08 class.domelement.html
-rw-r--r--      2752 2016-12-04 06:08 v8js.getpendingexception.html
-rw-r--r--      2938 2016-12-04 06:08 eventbufferevent.sslgetcipherversion.html
-rw-r--r--      6349 2016-12-04 06:07 intlchar.isjavaidstart.html
-rw-r--r--     11968 2016-12-04 06:07 function.fgetcsv.html
-rw-r--r--     17590 2016-12-04 06:08 function.extract.html
-rw-r--r--      5722 2016-12-04 06:07 mongocollection.setwriteconcern.html
-rw-r--r--     26939 2016-12-04 06:07 language.oop5.overloading.html
-rw-r--r--     10834 2016-12-04 06:07 mysqli.poll.html
-rw-r--r--      3353 2016-12-04 06:08 class.yaf-route-interface.html
-rw-r--r--      2049 2016-12-04 06:08 function.pdf-stroke.html
-rw-r--r--      2536 2016-12-04 06:08 yaf-session.isset.html
-rw-r--r--     11533 2016-12-04 06:08 stomp.examples.html
-rw-r--r--      2717 2016-12-04 06:07 gmagick.getimageprofile.html
-rw-r--r--      9051 2016-12-04 06:07 pharfileinfo.iscompressed.html
-rw-r--r--      3054 2016-12-04 06:08 function.event-base-loop.html
-rw-r--r--      3060 2016-12-04 06:08 reflectionparameter.isarray.html
-rw-r--r--      2558 2016-12-04 06:08 curl.configuration.html
-rw-r--r--     12008 2016-12-04 06:08 class.splstack.html
-rw-r--r--      6823 2016-12-04 06:08 filesystemiterator.setflags.html
-rw-r--r--      2778 2016-12-04 06:07 hrtime-performancecounter.getelapsedticks.html
-rw-r--r--     12832 2016-12-04 06:07 imagick.setprogressmonitor.html
-rw-r--r--      1657 2016-12-04 06:07 mongo.setup.html
-rw-r--r--      4855 2016-12-04 06:08 internals2.opcodes.init-static-method-call.html
-rw-r--r--      3740 2016-12-04 06:08 limititerator.current.html
-rw-r--r--      3102 2016-12-04 06:07 function.fdf-close.html
-rw-r--r--      2726 2016-12-04 06:08 recursivetreeiterator.endchildren.html
-rw-r--r--      7459 2016-12-04 06:08 yaf.tutorials.html
-rw-r--r--      5959 2016-12-04 06:08 swftext.construct.html
-rw-r--r--      2813 2016-12-04 06:08 sdo-dataobject.clear.html
-rw-r--r--      8312 2016-12-04 06:07 mysqlnd.plugin.api.html
-rw-r--r--      3096 2016-12-04 06:08 function.event-buffer-base-set.html
-rw-r--r--     22300 2016-12-04 06:08 function.preg-replace.html
-rw-r--r--      5261 2016-12-04 06:07 intlchar.isisocontrol.html
-rw-r--r--     16439 2016-12-04 06:08 regexp.reference.escape.html
-rw-r--r--      3496 2016-12-04 06:08 about.phpversions.html
-rw-r--r--      4633 2016-12-04 06:08 function.stream-get-line.html
-rw-r--r--      2862 2016-12-04 06:08 function.rrd-tune.html
-rw-r--r--      3054 2016-12-04 06:08 function.event-buffer-enable.html
-rw-r--r--      7536 2016-12-04 06:07 class.mongodb-driver-exception-bulkwriteexception.html
-rw-r--r--      7104 2016-12-04 06:07 ziparchive.setexternalattributesname.html
-rw-r--r--      1301 2016-12-04 06:08 svm.resources.html
-rw-r--r--      3627 2016-12-04 06:08 splpriorityqueue.setextractflags.html
-rw-r--r--      1637 2016-12-04 06:08 classkit.installation.html
-rw-r--r--      5616 2016-12-04 06:08 appenditerator.append.html
-rw-r--r--      7649 2016-12-04 06:08 migration51.oop.html
-rw-r--r--      4113 2016-12-04 06:08 function.xmlwriter-flush.html
-rw-r--r--      3592 2016-12-04 06:08 arrayiterator.append.html
-rw-r--r--      4755 2016-12-04 06:08 rrdupdater.update.html
-rw-r--r--      6537 2016-12-04 06:08 book.xmlwriter.html
-rw-r--r--      3186 2016-12-04 06:07 function.trader-atr.html
-rw-r--r--      2836 2016-12-04 06:07 gmagickdraw.settextdecoration.html
-rw-r--r--      3749 2016-12-04 06:07 gmagick.cropimage.html
-rw-r--r--     12401 2016-12-04 06:07 function.sqlite-create-function.html
-rw-r--r--      3183 2016-12-04 06:08 solrquery.setfacetmissing.html
-rw-r--r--      4250 2016-12-04 06:07 function.get-cfg-var.html
-rw-r--r--      3396 2016-12-04 06:07 ref.pdo-ibm.html
-rw-r--r--      3309 2016-12-04 06:08 filesystemiterator.getflags.html
-rw-r--r--      5743 2016-12-04 06:07 imagick.rotateimage.html
-rw-r--r--      2598 2016-12-04 06:08 v8jsexception.getjssourceline.html
-rw-r--r--      5311 2016-12-04 06:08 internals2.memory.persistence.html
-rw-r--r--      5857 2016-12-04 06:07 context.mongodb.html
-rw-r--r--      3027 2016-12-04 06:08 reflectionparameter.tostring.html
-rw-r--r--      4080 2016-12-04 06:07 mongocollection.setslaveokay.html
-rw-r--r--      4611 2016-12-04 06:08 function.ps-set-border-color.html
-rw-r--r--     20034 2016-12-04 06:07 rar.examples.html
-rw-r--r--      9445 2016-12-04 06:07 datetime.settimestamp.html
-rw-r--r--      2108 2016-12-04 06:08 intro.judy.html
-rw-r--r--      5075 2016-12-04 06:08 oauth.setrsacertificate.html
-rw-r--r--      7154 2016-12-04 06:08 book.oauth.html
-rw-r--r--      5717 2016-12-04 06:08 ds-sequence.find.html
-rw-r--r--      3344 2016-12-04 06:08 function.hebrev.html
-rw-r--r--      3017 2016-12-04 06:08 harupage.moveto.html
-rw-r--r--      2498 2016-12-04 06:08 solrquery.getfacetdatefields.html
-rw-r--r--      2790 2016-12-04 06:08 recursiveiteratoriterator.getdepth.html
-rw-r--r--      9285 2016-12-04 06:07 cairocontext.setfontface.html
-rw-r--r--      1530 2016-12-04 06:07 opcache.setup.html
-rw-r--r--      2452 2016-12-04 06:08 varnishadmin.connect.html
-rw-r--r--      3932 2016-12-04 06:08 domdocument.relaxngvalidatesource.html
-rw-r--r--     12846 2016-12-04 06:08 function.get-html-translation-table.html
-rw-r--r--      6833 2016-12-04 06:08 internals2.pdo.pdo-stmt-t.html
-rw-r--r--    133093 2016-12-04 06:07 imagick.constants.html
-rw-r--r--      2896 2016-12-04 06:08 class.yaf-exception-loadfailed-view.html
-rw-r--r--      9372 2016-12-04 06:07 arrayaccess.offsetexists.html
-rw-r--r--      7946 2016-12-04 06:08 function.xml-set-element-handler.html
-rw-r--r--      8497 2016-12-04 06:07 function.imagechar.html
-rw-r--r--      1294 2016-12-04 06:08 pcre.requirements.html
-rw-r--r--      4308 2016-12-04 06:08 thread.getcreatorid.html
-rw-r--r--      3489 2016-12-04 06:07 function.enchant-dict-is-in-session.html
-rw-r--r--      2724 2016-12-04 06:07 openssl.key-types.html
-rw-r--r--      1524 2016-12-04 06:07 dbplus.setup.html
-rw-r--r--      7354 2016-12-04 06:08 arrayobject.natcasesort.html
-rw-r--r--      3235 2016-12-04 06:07 function.is-infinite.html
-rw-r--r--      2715 2016-12-04 06:08 solrserverexception.getinternalinfo.html
-rw-r--r--      5627 2016-12-04 06:08 internals2.opcodes.fetch-func-arg.html
-rw-r--r--      2971 2016-12-04 06:08 spltype.construct.html
-rw-r--r--      6419 2016-12-04 06:07 intlchar.getintpropertyminvalue.html
-rw-r--r--      3320 2016-12-04 06:07 function.stats-rand-gen-noncenral-chisquare.html
-rw-r--r--     14523 2016-12-04 06:07 function.cubrid-get-db-parameter.html
-rw-r--r--      1815 2016-12-04 06:08 function.pdf-open-tiff.html
-rw-r--r--      4851 2016-12-04 06:07 cairocontext.pathextents.html
-rw-r--r--      3899 2016-12-04 06:07 function.dbplus-aql.html
-rw-r--r--      3251 2016-12-04 06:08 evtimer.again.html
-rw-r--r--      3124 2016-12-04 06:07 imagick.profileimage.html
-rw-r--r--      2612 2016-12-04 06:08 varnishadmin.banurl.html
-rw-r--r--      5486 2016-12-04 06:07 phardata.addemptydir.html
-rw-r--r--     10168 2016-12-04 06:07 language.generators.overview.html
-rw-r--r--      2716 2016-12-04 06:08 evwatcher.invoke.html
-rw-r--r--      1431 2016-12-04 06:07 intro.scream.html
-rw-r--r--      3430 2016-12-04 06:08 function.fann-save-train.html
-rw-r--r--      4530 2016-12-04 06:07 function.cairo-surface-get-font-options.html
-rw-r--r--      5450 2016-12-04 06:08 function.get-resource-type.html
-rw-r--r--      8990 2016-12-04 06:08 class.swftextfield.html
-rw-r--r--     14818 2016-12-04 06:07 maxdb.examples-basic.html
-rw-r--r--      7140 2016-12-04 06:07 function.pg-meta-data.html
-rw-r--r--      4261 2016-12-04 06:07 htscanner.configuration.html
-rw-r--r--      2607 2016-12-04 06:08 yaf-controller-abstract.getview.html
-rw-r--r--      3748 2016-12-04 06:08 harudestination.setfitr.html
-rw-r--r--      4918 2016-12-04 06:07 function.pspell-config-ignore.html
-rw-r--r--      1950 2016-12-04 06:08 function.pdf-end-font.html
-rw-r--r--      1883 2016-12-04 06:08 internals2.ze1.intro.html
-rw-r--r--      1249 2016-12-04 06:07 filepro.constants.html
-rw-r--r--      2716 2016-12-04 06:08 function.pdf-setcolor.html
-rw-r--r--      4967 2016-12-04 06:07 imagick.setimageiterations.html
-rw-r--r--     22553 2016-12-04 06:07 mongocollection.aggregatecursor.html
-rw-r--r--      2324 2016-12-04 06:08 function.pdf-load-image.html
-rw-r--r--     19739 2016-12-04 06:08 swfshape.setline.html
-rw-r--r--      4850 2016-12-04 06:07 cairocontext.getlinejoin.html
-rw-r--r--      8841 2016-12-04 06:07 function.oci-field-type-raw.html
-rw-r--r--      6831 2016-12-04 06:07 intlcalendar.fromdatetime.html
-rw-r--r--      6362 2016-12-04 06:08 cond.wait.html
-rw-r--r--      3553 2016-12-04 06:07 function.msql-drop-db.html
-rw-r--r--      3005 2016-12-04 06:07 function.stats-cdf-exponential.html
-rw-r--r--      2917 2016-12-04 06:08 hwapi.attribute-langdepvalue.html
-rw-r--r--      2413 2016-12-04 06:07 function.ncurses-slk-restore.html
-rw-r--r--      8792 2016-12-04 06:07 function.xdiff-file-patch.html
-rw-r--r--      6455 2016-12-04 06:07 function.mssql-fetch-batch.html
-rw-r--r--      1835 2016-12-04 06:08 ref.rpmreader.html
-rw-r--r--      3555 2016-12-04 06:08 function.fann-set-cascade-min-out-epochs.html
-rw-r--r--     14633 2016-12-04 06:07 function.imap-createmailbox.html
-rw-r--r--      2152 2016-12-04 06:07 function.ocifreecollection.html
-rw-r--r--      4421 2016-12-04 06:08 ds-map.reversed.html
-rw-r--r--      4991 2016-12-04 06:08 soapclient.gettypes.html
-rw-r--r--      2609 2016-12-04 06:08 internals2.pdo.html
-rw-r--r--      2406 2016-12-04 06:08 yaf-session.current.html
-rw-r--r--      2050 2016-12-04 06:07 function.ocinumcols.html
-rw-r--r--      3022 2016-12-04 06:08 solrquery.setfacetmincount.html
-rw-r--r--      2555 2016-12-04 06:08 solrquery.setquery.html
-rw-r--r--      1711 2016-12-04 06:08 internals2.counter.setup.html
-rw-r--r--      2759 2016-12-04 06:08 domnode.issamenode.html
-rw-r--r--      3796 2016-12-04 06:07 class.cairolinecap.html
-rw-r--r--      3965 2016-12-04 06:08 ds-sequence.reverse.html
-rw-r--r--      7226 2016-12-04 06:07 wrappers.audio.html
-rw-r--r--      2987 2016-12-04 06:08 sdo-das-xml-document.setxmldeclaration.html
-rw-r--r--      2652 2016-12-04 06:08 function.fann-get-num-output.html
-rw-r--r--      2689 2016-12-04 06:07 function.trader-midpoint.html
-rw-r--r--      2771 2016-12-04 06:08 sdo-das-changesummary.endlogging.html
-rw-r--r--      2823 2016-12-04 06:07 mysqlnd-uh.changes-one-o.html
-rw-r--r--      5169 2016-12-04 06:08 class.splstring.html
-rw-r--r--      3767 2016-12-04 06:07 function.odbc-exec.html
-rw-r--r--      2999 2016-12-04 06:07 gmagick.cyclecolormapimage.html
-rw-r--r--      3194 2016-12-04 06:08 function.ps-end-template.html
-rw-r--r--      5026 2016-12-04 06:07 reserved.variables.globals.html
-rw-r--r--      3266 2016-12-04 06:08 function.yaz-database.html
-rw-r--r--      4396 2016-12-04 06:07 exception.construct.html
-rw-r--r--      2624 2016-12-04 06:08 migration5.oop.html
-rw-r--r--     17712 2016-12-04 06:07 rararchive.open.html
-rw-r--r--      4646 2016-12-04 06:07 function.sybase-fetch-assoc.html
-rw-r--r--      9187 2016-12-04 06:07 function.db2-fetch-object.html
-rw-r--r--      6448 2016-12-04 06:07 function.gmp-sqrtrem.html
-rw-r--r--      4264 2016-12-04 06:08 function.gupnp-service-info-get-introspection.html
-rw-r--r--      2389 2016-12-04 06:08 book.win32ps.html
-rw-r--r--      3271 2016-12-04 06:08 migration55.classes.html
-rw-r--r--     11180 2016-12-04 06:07 mysqli.insert-id.html
-rw-r--r--      5957 2016-12-04 06:07 function.imap-sort.html
-rw-r--r--      1700 2016-12-04 06:08 ds-vector.count.html
-rw-r--r--      2843 2016-12-04 06:08 eventlistener.disable.html
-rw-r--r--      3113 2016-12-04 06:08 sdo-das-changesummary.getchangeddataobjects.html
-rw-r--r--      3315 2016-12-04 06:08 function.curl-multi-getcontent.html
-rw-r--r--      2820 2016-12-04 06:07 intltimezone.countequivalentids.html
-rw-r--r--      2661 2016-12-04 06:08 book.shmop.html
-rw-r--r--      3476 2016-12-04 06:07 mongo.tutorial.connecting.html
-rw-r--r--      2178 2016-12-04 06:08 ui-control.destroy.html
-rw-r--r--      2723 2016-12-04 06:07 function.ncurses-bkgd.html
-rw-r--r--      2212 2016-12-04 06:08 ui-controls-form.ispadded.html
-rw-r--r--      5123 2016-12-04 06:08 reflectionclass.iscloneable.html
-rw-r--r--      3863 2016-12-04 06:08 function.ps-symbol-name.html
-rw-r--r--     11198 2016-12-04 06:07 function.sqlite-exec.html
-rw-r--r--      3562 2016-12-04 06:07 function.newt-checkbox-tree-multi.html
-rw-r--r--      8623 2016-12-04 06:07 mysqlnduhconnection.getfieldcount.html
-rw-r--r--      1547 2016-12-04 06:07 openssl.setup.html
-rw-r--r--      2649 2016-12-04 06:07 intltimezone.gettzdataversion.html
-rw-r--r--      5714 2016-12-04 06:07 function.mysql-set-charset.html
-rw-r--r--      6140 2016-12-04 06:08 book.posix.html
-rw-r--r--      5284 2016-12-04 06:08 function.ldap-first-attribute.html
-rw-r--r--      5824 2016-12-04 06:07 function.cairo-pattern-add-color-stop-rgba.html
-rw-r--r--      1328 2016-12-04 06:07 imagick.resources.html
-rw-r--r--      4731 2016-12-04 06:07 mongodb-bson-timestamp.tostring.html
-rw-r--r--      4097 2016-12-04 06:07 function.oci-client-version.html
-rw-r--r--      3916 2016-12-04 06:07 cairogradientpattern.getcolorstopcount.html
-rw-r--r--     15165 2016-12-04 06:07 book.datetime.html
-rw-r--r--      1609 2016-12-04 06:07 tokyo-tyrant.setup.html
-rw-r--r--     16489 2016-12-04 06:07 mysqli-result.current-field.html
-rw-r--r--      8488 2016-12-04 06:07 features.remote-files.html
-rw-r--r--      3913 2016-12-04 06:07 function.enchant-broker-set-dict-path.html
-rw-r--r--      3010 2016-12-04 06:08 function.svn-fs-props-changed.html
-rw-r--r--      2506 2016-12-04 06:08 class.countable.html
-rw-r--r--      1486 2016-12-04 06:08 judy.setup.html
-rw-r--r--      8373 2016-12-04 06:07 mongodb-driver-manager.getservers.html
-rw-r--r--      1370 2016-12-04 06:07 password.configuration.html
-rw-r--r--      2763 2016-12-04 06:08 gearmanclient.geterrno.html
-rw-r--r--      5371 2016-12-04 06:07 intlchar.ismirrored.html
-rw-r--r--      3384 2016-12-04 06:08 ui-draw-path.newfigurewitharc.html
-rw-r--r--      2618 2016-12-04 06:07 function.stats-absolute-deviation.html
-rw-r--r--      3636 2016-12-04 06:08 function.variant-cast.html
-rw-r--r--      3005 2016-12-04 06:08 iteratoriterator.construct.html
-rw-r--r--      8321 2016-12-04 06:07 class.serializable.html
-rw-r--r--      1313 2016-12-04 06:08 intro.svm.html
-rw-r--r--      4565 2016-12-04 06:08 syncsharedmemory.size.html
-rw-r--r--      6604 2016-12-04 06:07 function.iconv-substr.html
-rw-r--r--      3588 2016-12-04 06:08 internals2.counter.function.counter-get-value.html
-rw-r--r--      6696 2016-12-04 06:07 closure.call.html
-rw-r--r--     12779 2016-12-04 06:08 memcache.addserver.html
-rw-r--r--      4922 2016-12-04 06:07 iconv.configuration.html
-rw-r--r--      3784 2016-12-04 06:08 function.stomp-connect-error.html
-rw-r--r--      2121 2016-12-04 06:08 function.pdf-setflat.html
-rw-r--r--      4930 2016-12-04 06:08 ds-priorityqueue.allocate.html
-rw-r--r--      5420 2016-12-04 06:07 cairocontext.instroke.html
-rw-r--r--      3083 2016-12-04 06:07 function.zip-close.html
-rw-r--r--      2373 2016-12-04 06:07 function.vpopmail-error.html
-rw-r--r--      5578 2016-12-04 06:08 reflectionfunctionabstract.isclosure.html
-rw-r--r--      3548 2016-12-04 06:07 mongocursor.limit.html
-rw-r--r--      5420 2016-12-04 06:08 ds-set.sum.html
-rw-r--r--      5712 2016-12-04 06:07 ref.gmp.html
-rw-r--r--     17274 2016-12-04 06:07 install.unix.sun.html
-rw-r--r--      1925 2016-12-04 06:07 mysqlnd-qc.changes.html
-rw-r--r--      2991 2016-12-04 06:07 function.stats-dens-cauchy.html
-rw-r--r--      3588 2016-12-04 06:08 function.ps-open-file.html
-rw-r--r--     13353 2016-12-04 06:07 function.ingres-set-environment.html
-rw-r--r--     16525 2016-12-04 06:07 mysqli.affected-rows.html
-rw-r--r--      2871 2016-12-04 06:07 function.ncurses-slk-set.html
-rw-r--r--      2940 2016-12-04 06:08 solrquery.setmltmindocfrequency.html
-rw-r--r--      1772 2016-12-04 06:07 intro.gmagick.html
-rw-r--r--      2455 2016-12-04 06:08 splpriorityqueue.key.html
-rw-r--r--      6226 2016-12-04 06:08 xsltprocessor.transformtouri.html
-rw-r--r--      7604 2016-12-04 06:07 function.db2-table-privileges.html
-rw-r--r--      1315 2016-12-04 06:08 tcpwrap.requirements.html
-rw-r--r--      8168 2016-12-04 06:07 ziparchive.addglob.html
-rw-r--r--      3112 2016-12-04 06:08 function.long2ip.html
-rw-r--r--      3088 2016-12-04 06:08 solrquery.addsortfield.html
-rw-r--r--      2679 2016-12-04 06:07 function.vpopmail-alias-add.html
-rw-r--r--      3131 2016-12-04 06:08 internals2.counter.counter-class.setcounterclass.html
-rw-r--r--      1652 2016-12-04 06:07 constants.newt.listbox-flags.html
-rw-r--r--      2812 2016-12-04 06:07 function.newt-wait-for-key.html
-rw-r--r--      2447 2016-12-04 06:08 ui-controls-entry.construct.html
-rw-r--r--      4914 2016-12-04 06:08 function.ps-place-image.html
-rw-r--r--     10634 2016-12-04 06:08 function.session-create-id.html
-rw-r--r--     25509 2016-12-04 06:08 book.ds.html
-rw-r--r--      1492 2016-12-04 06:08 pcre.setup.html
-rw-r--r--      2712 2016-12-04 06:07 function.newt-set-help-callback.html
-rw-r--r--      3052 2016-12-04 06:08 yaf-request-simple.construct.html
-rw-r--r--      2384 2016-12-04 06:07 imagick.getimageiterations.html
-rw-r--r--      5678 2016-12-04 06:08 class.ui-draw-brush-lineargradient.html
-rw-r--r--      4895 2016-12-04 06:07 install.windows.recommended.html
-rw-r--r--      3021 2016-12-04 06:08 function.ldap-free-result.html
-rw-r--r--     11167 2016-12-04 06:08 function.each.html
-rw-r--r--      3574 2016-12-04 06:08 function.yaz-range.html
-rw-r--r--      2214 2016-12-04 06:08 ui-window.onclosing.html
-rw-r--r--      2554 2016-12-04 06:08 judy.offsetget.html
-rw-r--r--     10744 2016-12-04 06:07 cairocontext.getcurrentpoint.html
-rw-r--r--      2740 2016-12-04 06:07 imagick.displayimages.html
-rw-r--r--      1464 2016-12-04 06:07 gmagick.setup.html
-rw-r--r--      2803 2016-12-04 06:08 function.svn-fs-revision-root.html
-rw-r--r--      6632 2016-12-04 06:07 function.log-cmd-update.html
-rw-r--r--      8420 2016-12-04 06:07 function.imagecropauto.html
-rw-r--r--      2696 2016-12-04 06:07 function.bson-encode.html
-rw-r--r--      3065 2016-12-04 06:08 solrquery.addfacetdateother.html
-rw-r--r--      4639 2016-12-04 06:07 mysqli.persistconns.html
-rw-r--r--      6252 2016-12-04 06:08 memcache.getserverstatus.html
-rw-r--r--     10785 2016-12-04 06:08 function.socket-set-option.html
-rw-r--r--      3632 2016-12-04 06:08 xmlreader.setrelaxngschema.html
-rw-r--r--     11310 2016-12-04 06:07 numberformatter.gettextattribute.html
-rw-r--r--      2906 2016-12-04 06:07 intlbreakiterator.following.html
-rw-r--r--      8071 2016-12-04 06:08 filter.filters.validate.html
-rw-r--r--      2369 2016-12-04 06:07 id3v2tag.getframelist.html
-rw-r--r--     13149 2016-12-04 06:08 function.ps-begin-pattern.html
-rw-r--r--      2583 2016-12-04 06:08 yaf-request-abstract.isput.html
-rw-r--r--      3864 2016-12-04 06:08 function.spl-autoload.html
-rw-r--r--      2029 2016-12-04 06:07 features.commandline.html
-rw-r--r--      3177 2016-12-04 06:07 function.fbsql-free-result.html
-rw-r--r--     16734 2016-12-04 06:07 mysqli-result.fetch-field-direct.html
-rw-r--r--      3200 2016-12-04 06:08 eventutil.getlastsocketerror.html
-rw-r--r--      4451 2016-12-04 06:08 class.ds-collection.html
-rw-r--r--      6595 2016-12-04 06:08 function.strval.html
-rw-r--r--      2690 2016-12-04 06:08 function.fann-get-num-layers.html
-rw-r--r--      4018 2016-12-04 06:08 ref.pcntl.html
-rw-r--r--      3837 2016-12-04 06:07 function.crack-opendict.html
-rw-r--r--      4651 2016-12-04 06:08 syncsemaphore.lock.html
-rw-r--r--      4763 2016-12-04 06:07 function.decoct.html
-rw-r--r--      4871 2016-12-04 06:07 class.cairopatterntype.html
-rw-r--r--      4027 2016-12-04 06:07 function.radius-salt-encrypt-attr.html
-rw-r--r--      2647 2016-12-04 06:08 yaf-request-abstract.getparams.html
-rw-r--r--      4488 2016-12-04 06:07 mysqli.client-info.html
-rw-r--r--      3033 2016-12-04 06:08 harupage.gettextmatrix.html
-rw-r--r--      4083 2016-12-04 06:07 cairopdfsurface.setsize.html
-rw-r--r--      2812 2016-12-04 06:07 function.trader-linearreg-slope.html
-rw-r--r--      3336 2016-12-04 06:07 mime-magic.installation.html
-rw-r--r--      3923 2016-12-04 06:07 gmagickdraw.arc.html
-rw-r--r--      3182 2016-12-04 06:07 imagickdraw.pathmovetoabsolute.html
-rw-r--r--     15132 2016-12-04 06:08 reflectionproperty.construct.html
-rw-r--r--      5581 2016-12-04 06:08 geoip.constants.html
-rw-r--r--      3466 2016-12-04 06:07 phar.isvalidpharfilename.html
-rw-r--r--      8946 2016-12-04 06:08 yaml.constants.html
-rw-r--r--      5959 2016-12-04 06:07 function.log-cmd-insert.html
-rw-r--r--      8645 2016-12-04 06:08 class.appenditerator.html
-rw-r--r--      2482 2016-12-04 06:08 sem.configuration.html
-rw-r--r--      5940 2016-12-04 06:08 class.filteriterator.html
-rw-r--r--      3109 2016-12-04 06:08 solrquery.sethighlightregexmaxanalyzedchars.html
-rw-r--r--      6424 2016-12-04 06:07 intlchar.getintpropertymaxvalue.html
-rw-r--r--      2801 2016-12-04 06:07 function.trader-sub.html
-rw-r--r--      2369 2016-12-04 06:07 function.ibase-service-attach.html
-rw-r--r--      7879 2016-12-04 06:08 class.solrparams.html
-rw-r--r--     15496 2016-12-04 06:07 mysqlnd-uh.quickstart.proxy-installation.html
-rw-r--r--      2906 2016-12-04 06:07 harudoc.usejpencodings.html
-rw-r--r--      2022 2016-12-04 06:08 function.pdf-get-apiname.html
-rw-r--r--     13132 2016-12-04 06:08 swfgradient.construct.html
-rw-r--r--      6202 2016-12-04 06:08 regexp.reference.onlyonce.html
-rw-r--r--      2932 2016-12-04 06:08 gearmanclient.echo.html
-rw-r--r--      7212 2016-12-04 06:07 function.mcrypt-create-iv.html
-rw-r--r--      1489 2016-12-04 06:07 fileinfo.resources.html
-rw-r--r--      2873 2016-12-04 06:08 migration51.datetime.html
-rw-r--r--      3356 2016-12-04 06:07 function.ingres-autocommit-state.html
-rw-r--r--      7517 2016-12-04 06:08 quickhashintset.add.html
-rw-r--r--      5134 2016-12-04 06:07 cairogradientpattern.addcolorstoprgba.html
-rw-r--r--      4981 2016-12-04 06:08 ds-sequence.push.html
-rw-r--r--      1533 2016-12-04 06:07 inclued.setup.html
-rw-r--r--      3508 2016-12-04 06:07 function.imap-close.html
-rw-r--r--      3608 2016-12-04 06:07 mongocursor.dead.html
-rw-r--r--      4456 2016-12-04 06:07 mongolog.getlevel.html
-rw-r--r--      1313 2016-12-04 06:07 opcache.requirements.html
-rw-r--r--      5349 2016-12-04 06:08 function.ftp-pwd.html
-rw-r--r--      2998 2016-12-04 06:07 function.stats-dens-laplace.html
-rw-r--r--      7262 2016-12-04 06:07 class.resourcebundle.html
-rw-r--r--      2489 2016-12-04 06:07 imagick.readimage.html
-rw-r--r--      2605 2016-12-04 06:07 mongo.manual.html
-rw-r--r--      6676 2016-12-04 06:07 function.fbsql-error.html
-rw-r--r--      2012 2016-12-04 06:07 xdiff.installation.html
-rw-r--r--     14105 2016-12-04 06:08 function.stream-socket-server.html
-rw-r--r--      3832 2016-12-04 06:07 function.ncurses-prefresh.html
-rw-r--r--      7988 2016-12-04 06:08 splobjectstorage.getinfo.html
-rw-r--r--      7690 2016-12-04 06:08 migration71.other-changes.html
-rw-r--r--      3187 2016-12-04 06:07 function.fdf-error.html
-rw-r--r--      3409 2016-12-04 06:08 gearmanworker.unregister.html
-rw-r--r--      6991 2016-12-04 06:08 reflectionmethod.invokeargs.html
-rw-r--r--     12379 2016-12-04 06:07 class.mongowritebatch.html
-rw-r--r--      3175 2016-12-04 06:08 event.free.html
-rw-r--r--      5863 2016-12-04 06:08 splobjectstorage.valid.html
-rw-r--r--     19663 2016-12-04 06:07 language.variables.external.html
-rw-r--r--      1301 2016-12-04 06:08 shmop.requirements.html
-rw-r--r--      1490 2016-12-04 06:08 event.setup.html
-rw-r--r--      3323 2016-12-04 06:08 function.memcache-debug.html
-rw-r--r--     11838 2016-12-04 06:07 class.errorexception.html
-rw-r--r--      7763 2016-12-04 06:08 ds-deque.sort.html
-rw-r--r--      2014 2016-12-04 06:08 intro.event.html
-rw-r--r--      2931 2016-12-04 06:07 imagick.getimagecolormapcolor.html
-rw-r--r--      4880 2016-12-04 06:08 ds-queue.push.html
-rw-r--r--      7536 2016-12-04 06:07 function.wincache-ucache-clear.html
-rw-r--r--      2629 2016-12-04 06:07 function.imap-headers.html
-rw-r--r--      8650 2016-12-04 06:08 samconnection.peekall.html
-rw-r--r--      6205 2016-12-04 06:07 imagick.haldclutimage.html
-rw-r--r--      6392 2016-12-04 06:07 class.ktaglib-mpeg-audioproperties.html
-rw-r--r--      6749 2016-12-04 06:07 tokyotyrant.fwmkeys.html
-rw-r--r--      3944 2016-12-04 06:07 cairosurfacepattern.setfilter.html
-rw-r--r--      9534 2016-12-04 06:07 function.dba-open.html
-rw-r--r--      2558 2016-12-04 06:08 gearmanjob.setreturn.html
-rw-r--r--      6163 2016-12-04 06:07 imagick.gaussianblurimage.html
-rw-r--r--      2451 2016-12-04 06:07 imagickdraw.render.html
-rw-r--r--      2890 2016-12-04 06:07 function.trader-trange.html
-rw-r--r--      4628 2016-12-04 06:08 ds-set.allocate.html
-rw-r--r--      2666 2016-12-04 06:07 function.vpopmail-add-alias-domain.html
-rw-r--r--      4048 2016-12-04 06:08 arrayiterator.key.html
-rw-r--r--      3292 2016-12-04 06:08 arrayiterator.asort.html
-rw-r--r--      2342 2016-12-04 06:08 solrdocument.destruct.html
-rw-r--r--      4702 2016-12-04 06:08 function.ssh2-auth-agent.html
-rw-r--r--      6472 2016-12-04 06:08 samconnection.peek.html
-rw-r--r--      1448 2016-12-04 06:08 rpmreader.resources.html
-rw-r--r--      2489 2016-12-04 06:08 splpriorityqueue.valid.html
-rw-r--r--      4150 2016-12-04 06:08 function.ord.html
-rw-r--r--      2642 2016-12-04 06:08 svn.installation.html
-rw-r--r--      4867 2016-12-04 06:07 function.cairo-pattern-create-rgb.html
-rw-r--r--      7892 2016-12-04 06:07 function.mssql-field-length.html
-rw-r--r--      3125 2016-12-04 06:07 function.imap-utf8.html
-rw-r--r--      2734 2016-12-04 06:07 function.ncurses-scr-dump.html
-rw-r--r--      4116 2016-12-04 06:07 pdo.pgsqlcopyfromarray.html
-rw-r--r--      1722 2016-12-04 06:07 features.gc.html
-rw-r--r--      3005 2016-12-04 06:07 function.ncurses-has-il.html
-rw-r--r--      3746 2016-12-04 06:08 function.gupnp-context-unhost-path.html
-rw-r--r--     14762 2016-12-04 06:07 function.cubrid-pconnect-with-url.html
-rw-r--r--      4896 2016-12-04 06:08 function.xmlwriter-write-dtd-attlist.html
-rw-r--r--      1523 2016-12-04 06:08 libxml.setup.html
-rw-r--r--      2475 2016-12-04 06:07 function.trader-tan.html
-rw-r--r--     15900 2016-12-04 06:08 function.stream-socket-client.html
-rw-r--r--     10524 2016-12-04 06:07 function.mysql-db-query.html
-rw-r--r--      3855 2016-12-04 06:08 ds-set.first.html
-rw-r--r--      3142 2016-12-04 06:08 function.gupnp-service-action-return.html
-rw-r--r--      1287 2016-12-04 06:08 sem.requirements.html
-rw-r--r--      6196 2016-12-04 06:07 imagickpixel.getcolor.html
-rw-r--r--      4463 2016-12-04 06:08 sam.errors.html
-rw-r--r--      2164 2016-12-04 06:08 function.pdf-close-image.html
-rw-r--r--      3276 2016-12-04 06:07 imagick.getimagedistortion.html
-rw-r--r--      7975 2016-12-04 06:08 eventhttp.setdefaultcallback.html
-rw-r--r--     25122 2016-12-04 06:08 swfbutton.construct.html
-rw-r--r--      5406 2016-12-04 06:08 zookeeper.delete.html
-rw-r--r--      4580 2016-12-04 06:07 function.ob-get-contents.html
-rw-r--r--      3497 2016-12-04 06:07 function.password-get-info.html
-rw-r--r--      1501 2016-12-04 06:08 varnish.examples.html
-rw-r--r--      9667 2016-12-04 06:07 language.oop5.object-comparison.html
-rw-r--r--      3574 2016-12-04 06:07 cairomatrix.invert.html
-rw-r--r--      4484 2016-12-04 06:08 function.ldap-get-entries.html
-rw-r--r--      5411 2016-12-04 06:07 memtrack.ini.html
-rw-r--r--      2378 2016-12-04 06:08 ui-controls-button.construct.html
-rw-r--r--      1536 2016-12-04 06:08 win32ps.setup.html
-rw-r--r--      2417 2016-12-04 06:07 imagickdraw.getfillcolor.html
-rw-r--r--      1307 2016-12-04 06:07 apcu.resources.html
-rw-r--r--      6398 2016-12-04 06:07 imagick.textureimage.html
-rw-r--r--      5815 2016-12-04 06:07 mongodb-driver-server.getport.html
-rw-r--r--      3575 2016-12-04 06:08 book.sdodasrel.html
-rw-r--r--     12264 2016-12-04 06:07 imagickdraw.setstrokemiterlimit.html
-rw-r--r--     14023 2016-12-04 06:08 class.spldoublylinkedlist.html
-rw-r--r--      4529 2016-12-04 06:07 rarentry.isdirectory.html
-rw-r--r--      5633 2016-12-04 06:07 function.imagefontheight.html
-rw-r--r--      2411 2016-12-04 06:07 rarentry.getfiletime.html
-rw-r--r--      7199 2016-12-04 06:07 mongodb-driver-writeconcernerror.getcode.html
-rw-r--r--      4389 2016-12-04 06:07 function.mhash-keygen-s2k.html
-rw-r--r--      3573 2016-12-04 06:08 function.fann-set-sarprop-weight-decay-shift.html
-rw-r--r--      2446 2016-12-04 06:08 splpriorityqueue.next.html
-rw-r--r--      3485 2016-12-04 06:08 recursivefilteriterator.haschildren.html
-rw-r--r--      8442 2016-12-04 06:07 function.pg-fetch-assoc.html
-rw-r--r--      5266 2016-12-04 06:08 evwatcher.keepalive.html
-rw-r--r--      3010 2016-12-04 06:08 function.wddx-serialize-value.html
-rw-r--r--      5607 2016-12-04 06:07 mongo.connecting.persistent.html
-rw-r--r--      2739 2016-12-04 06:07 mysql.html
-rw-r--r--      2718 2016-12-04 06:08 swftextfield.setfont.html
-rw-r--r--      2647 2016-12-04 06:08 yaf-route-static.match.html
-rw-r--r--      2517 2016-12-04 06:07 harudoc.construct.html
-rw-r--r--      5488 2016-12-04 06:08 class.ui-draw-text-font-descriptor.html
-rw-r--r--      8606 2016-12-04 06:08 refs.xml.html
-rw-r--r--      4853 2016-12-04 06:08 class.zmqcontext.html
-rw-r--r--      2884 2016-12-04 06:08 internals2.opcodes.cast.html
-rw-r--r--      2225 2016-12-04 06:08 ui-window.save.html
-rw-r--r--      4395 2016-12-04 06:07 function.newt-form-run.html
-rw-r--r--      4670 2016-12-04 06:08 function.ps-set-value.html
-rw-r--r--     10486 2016-12-04 06:07 intlcalendar.settimezone.html
-rw-r--r--      1522 2016-12-04 06:07 iconv.setup.html
-rw-r--r--      6255 2016-12-04 06:07 function.imagecolorclosesthwb.html
-rw-r--r--      5731 2016-12-04 06:07 mongocommandcursor.rewind.html
-rw-r--r--     15643 2016-12-04 06:07 mysqli.use-result.html
-rw-r--r--      8539 2016-12-04 06:07 security.errors.html
-rw-r--r--      7130 2016-12-04 06:07 mongodb-driver-readconcern.construct.html
-rw-r--r--      6204 2016-12-04 06:07 function.pg-end-copy.html
-rw-r--r--     12529 2016-12-04 06:07 function.imagesetstyle.html
-rw-r--r--      5616 2016-12-04 06:07 function.cairo-pattern-create-radial.html
-rw-r--r--      5071 2016-12-04 06:08 domdocument.createdocumentfragment.html
-rw-r--r--      4879 2016-12-04 06:08 domnode.insertbefore.html
-rw-r--r--      4032 2016-12-04 06:07 exception.getfile.html
-rw-r--r--      2617 2016-12-04 06:08 solrinputdocument.getboost.html
-rw-r--r--      1940 2016-12-04 06:08 function.socket-set-blocking.html
-rw-r--r--      3196 2016-12-04 06:08 sdo-model-type.issequencedtype.html
-rw-r--r--      8738 2016-12-04 06:07 function.sqlsrv-num-fields.html
-rw-r--r--      1377 2016-12-04 06:07 intro.msql.html
-rw-r--r--      1498 2016-12-04 06:08 ming.setup.html
-rw-r--r--      5439 2016-12-04 06:07 function.gnupg-setsignmode.html
-rw-r--r--     11566 2016-12-04 06:08 bbcode.constants.html
-rw-r--r--      2234 2016-12-04 06:08 ui-window.open.html
-rw-r--r--     13544 2016-12-04 06:07 book.mongodb.html
-rw-r--r--      5174 2016-12-04 06:07 function.ingres-num-rows.html
-rw-r--r--      1824 2016-12-04 06:07 ref.bson.html
-rw-r--r--     17711 2016-12-04 06:07 function.mysql-connect.html
-rw-r--r--      1267 2016-12-04 06:08 judy.resources.html
-rw-r--r--      1239 2016-12-04 06:07 intro.sqlite3.html
-rw-r--r--      5606 2016-12-04 06:07 imagick.setfont.html
-rw-r--r--      3564 2016-12-04 06:07 cairosurface.flush.html
-rw-r--r--      2070 2016-12-04 06:08 solrquery.getexpandquery.html
-rw-r--r--      3078 2016-12-04 06:07 function.ncurses-noecho.html
-rw-r--r--      1861 2016-12-04 06:07 function.msql-fieldtype.html
-rw-r--r--      2508 2016-12-04 06:08 yaf-config-ini.readonly.html
-rw-r--r--      1660 2016-12-04 06:08 sockets.installation.html
-rw-r--r--      5735 2016-12-04 06:07 wrappers.glob.html
-rw-r--r--     17881 2016-12-04 06:07 function.db2-lob-read.html
-rw-r--r--     16086 2016-12-04 06:07 intldateformatter.islenient.html
-rw-r--r--      1809 2016-12-04 06:07 enchant.installation.html
-rw-r--r--      8747 2016-12-04 06:08 class.gearmantask.html
-rw-r--r--      4217 2016-12-04 06:07 error.getline.html
-rw-r--r--      5381 2016-12-04 06:07 tokyotyrant.out.html
-rw-r--r--      2818 2016-12-04 06:08 yaf-config-ini.construct.html
-rw-r--r--     13451 2016-12-04 06:08 yar-concurrent-client.loop.html
-rw-r--r--     11606 2016-12-04 06:08 class.solrqueryresponse.html
-rw-r--r--      5407 2016-12-04 06:07 mongodb-bson-objectid.construct.html
-rw-r--r--      6814 2016-12-04 06:08 rrd.examples-oop.html
-rw-r--r--      5166 2016-12-04 06:08 function.ssh2-sftp.html
-rw-r--r--      4050 2016-12-04 06:08 book.msession.html
-rw-r--r--      4014 2016-12-04 06:08 function.xmlwriter-end-element.html
-rw-r--r--      2554 2016-12-04 06:07 imagick.getimageattribute.html
-rw-r--r--      2897 2016-12-04 06:08 sdo-dataobject.getcontainer.html
-rw-r--r--      3360 2016-12-04 06:07 constants.newt.components-flags.html
-rw-r--r--      2779 2016-12-04 06:08 solrinputdocument.deletefield.html
-rw-r--r--     29975 2016-12-04 06:07 function.imagefilter.html
-rw-r--r--      2585 2016-12-04 06:08 swftext.setheight.html
-rw-r--r--      2922 2016-12-04 06:07 function.m-numrows.html
-rw-r--r--      3378 2016-12-04 06:08 function.ps-restore.html
-rw-r--r--      5955 2016-12-04 06:07 imagick.cropimage.html
-rw-r--r--      1833 2016-12-04 06:08 intro.json.html
-rw-r--r--     43125 2016-12-04 06:07 class.rarentry.html
-rw-r--r--      5349 2016-12-04 06:08 function.snmpget.html
-rw-r--r--     29429 2016-12-04 06:07 mysqli.quickstart.statements.html
-rw-r--r--     10904 2016-12-04 06:07 intldateformatter.getlocale.html
-rw-r--r--      5483 2016-12-04 06:07 mongodb.getwriteconcern.html
-rw-r--r--      4018 2016-12-04 06:07 imagickdraw.pathcurvetoquadraticbezierrelative.html
-rw-r--r--      2697 2016-12-04 06:08 function.event-buffer-read.html
-rw-r--r--      8436 2016-12-04 06:07 function.mysql-errno.html
-rw-r--r--      3231 2016-12-04 06:08 sdo-das-setting.getlistindex.html
-rw-r--r--      3270 2016-12-04 06:08 function.event-buffer-priority-set.html
-rw-r--r--      8572 2016-12-04 06:08 solrclient.construct.html
-rw-r--r--      6190 2016-12-04 06:08 function.curl-init.html
-rw-r--r--      3186 2016-12-04 06:07 function.imap-num-msg.html
-rw-r--r--      7052 2016-12-04 06:07 cairocontext.clipextents.html
-rw-r--r--      6250 2016-12-04 06:07 phar.offsetexists.html
-rw-r--r--      6007 2016-12-04 06:07 imagick.newimage.html
-rw-r--r--      1548 2016-12-04 06:08 xmlreader.requirements.html
-rw-r--r--      6447 2016-12-04 06:07 mongocollection.setreadpreference.html
-rw-r--r--      5686 2016-12-04 06:07 pgsql.configuration.html
-rw-r--r--      3673 2016-12-04 06:08 oauthprovider.callconsumerhandler.html
-rw-r--r--      1315 2016-12-04 06:07 weakref.requirements.html
-rw-r--r--      4859 2016-12-04 06:07 transliterator.createfromrules.html
-rw-r--r--      7829 2016-12-04 06:07 phar.extractto.html
-rw-r--r--      2009 2016-12-04 06:08 ui.installation.html
-rw-r--r--      6466 2016-12-04 06:08 zookeeper.set.html
-rw-r--r--      1862 2016-12-04 06:07 function.imap-create.html
-rw-r--r--      2460 2016-12-04 06:08 solrquery.gettermslowerbound.html
-rw-r--r--      2784 2016-12-04 06:07 imagick.setsize.html
-rw-r--r--      4320 2016-12-04 06:08 syncreaderwriter.writelock.html
-rw-r--r--      2417 2016-12-04 06:07 mysqli-warning.construct.html
-rw-r--r--      5689 2016-12-04 06:07 function.blenc-encrypt.html
-rw-r--r--      5434 2016-12-04 06:07 function.bzwrite.html
-rw-r--r--      1918 2016-12-04 06:08 sca.requirements.html
-rw-r--r--      1307 2016-12-04 06:08 chdb.resources.html
-rw-r--r--      3647 2016-12-04 06:08 evprepare.construct.html
-rw-r--r--      9601 2016-12-04 06:07 function.wincache-ocache-fileinfo.html
-rw-r--r--      1684 2016-12-04 06:08 stomp.installation.html
-rw-r--r--      4376 2016-12-04 06:07 function.sqlite-close.html
-rw-r--r--      4227 2016-12-04 06:07 function.msql-list-fields.html
-rw-r--r--      3825 2016-12-04 06:07 language.pseudo-types.html
-rw-r--r--     53554 2016-12-04 06:08 book.solr.html
-rw-r--r--      1349 2016-12-04 06:08 ctype.configuration.html
-rw-r--r--      6881 2016-12-04 06:08 appenditerator.getiteratorindex.html
-rw-r--r--      5068 2016-12-04 06:08 gearmanclient.addserver.html
-rw-r--r--      2629 2016-12-04 06:07 function.newt-listbox-get-selection.html
-rw-r--r--     27503 2016-12-04 06:08 eventlistener.construct.html
-rw-r--r--      4733 2016-12-04 06:07 class.mongogridfscursor.html
-rw-r--r--      8586 2016-12-04 06:08 ds-map.ksorted.html
-rw-r--r--     10340 2016-12-04 06:08 quickhashstringinthash.loadfromfile.html
-rw-r--r--      3701 2016-12-04 06:07 function.sybase-min-error-severity.html
-rw-r--r--      3486 2016-12-04 06:07 function.imageaffine.html
-rw-r--r--      6964 2016-12-04 06:08 yaf-route-simple.assemble.html
-rw-r--r--      8835 2016-12-04 06:07 imagickdraw.setclippath.html
-rw-r--r--      6574 2016-12-04 06:07 intlchar.isulowercase.html
-rw-r--r--      6285 2016-12-04 06:08 function.ctype-cntrl.html
-rw-r--r--     11560 2016-12-04 06:08 class.yaf-router.html
-rw-r--r--      5524 2016-12-04 06:08 function.fann-set-callback.html
-rw-r--r--      3659 2016-12-04 06:08 function.use-soap-error-handler.html
-rw-r--r--      1815 2016-12-04 06:07 function.read-exif-data.html
-rw-r--r--      3771 2016-12-04 06:07 function.trader-adosc.html
-rw-r--r--      2315 2016-12-04 06:07 imagick.getimagedelay.html
-rw-r--r--      2688 2016-12-04 06:07 id3v2attachedpictureframe.getdescription.html
-rw-r--r--      2536 2016-12-04 06:08 varnishadmin.ban.html
-rw-r--r--      6204 2016-12-04 06:07 function.wincache-ucache-inc.html
-rw-r--r--      8558 2016-12-04 06:07 imagick.adaptiveresizeimage.html
-rw-r--r--      5861 2016-12-04 06:08 yaf-response-abstract.appendbody.html
-rw-r--r--      2256 2016-12-04 06:08 ui-controls-radio.onselected.html
-rw-r--r--      6082 2016-12-04 06:08 class.overflowexception.html
-rw-r--r--      5902 2016-12-04 06:08 class.yaf-registry.html
-rw-r--r--      2341 2016-12-04 06:07 imagickdraw.poppattern.html
-rw-r--r--      3861 2016-12-04 06:07 function.stats-rand-gen-noncentral-f.html
-rw-r--r--      2563 2016-12-04 06:07 harudoc.reseterror.html
-rw-r--r--      2383 2016-12-04 06:08 ref.fam.html
-rw-r--r--      7600 2016-12-04 06:07 phar.configuration.html
-rw-r--r--      4841 2016-12-04 06:07 mbstring.installation.html
-rw-r--r--      7300 2016-12-04 06:07 function.maxdb-stat.html
-rw-r--r--      5085 2016-12-04 06:08 simplexmlelement.count.html
-rw-r--r--      6152 2016-12-04 06:08 class.badfunctioncallexception.html
-rw-r--r--      1972 2016-12-04 06:07 book.memtrack.html
-rw-r--r--      9521 2016-12-04 06:07 function.cubrid-set-drop.html
-rw-r--r--      3737 2016-12-04 06:08 expect.constants.html
-rw-r--r--      7055 2016-12-04 06:08 reflectiontype.isbuiltin.html
-rw-r--r--      6781 2016-12-04 06:07 function.pg-last-oid.html
-rw-r--r--      2882 2016-12-04 06:08 sessionhandlerinterface.close.html
-rw-r--r--      2408 2016-12-04 06:07 imagick.getsizeoffset.html
-rw-r--r--      1348 2016-12-04 06:08 yaml.callbacks.html
-rw-r--r--      1268 2016-12-04 06:08 exec.constants.html
-rw-r--r--      2929 2016-12-04 06:08 gearmanjob.unique.html
-rw-r--r--      2467 2016-12-04 06:08 function.rrd-last.html
-rw-r--r--      2739 2016-12-04 06:08 ref.apache.html
-rw-r--r--      3033 2016-12-04 06:08 rrdcreator.addarchive.html
-rw-r--r--      2346 2016-12-04 06:07 imagickpixel.getindex.html
-rw-r--r--      2739 2016-12-04 06:08 hwapi.content-read.html
-rw-r--r--      8889 2016-12-04 06:07 imagickdraw.translate.html
-rw-r--r--      4695 2016-12-04 06:08 cond.destroy.html
-rw-r--r--      6783 2016-12-04 06:07 function.chown.html
-rw-r--r--      4128 2016-12-04 06:08 syncmutex.unlock.html
-rw-r--r--      6715 2016-12-04 06:07 fdf.examples.html
-rw-r--r--      1565 2016-12-04 06:07 mongo.batch.html
-rw-r--r--      3336 2016-12-04 06:07 function.trader-cdlclosingmarubozu.html
-rw-r--r--      1506 2016-12-04 06:07 security.sessions.html
-rw-r--r--      2947 2016-12-04 06:08 solrcollapsefunction.setfield.html
-rw-r--r--      3645 2016-12-04 06:07 function.openssl-error-string.html
-rw-r--r--      4863 2016-12-04 06:07 cairopattern.getmatrix.html
-rw-r--r--     11561 2016-12-04 06:07 function.db2-fetch-array.html
-rw-r--r--      5914 2016-12-04 06:07 mongodb-driver-server.getinfo.html
-rw-r--r--      2556 2016-12-04 06:08 ui-controls-label.gettext.html
-rw-r--r--      2113 2016-12-04 06:07 function.ocicolumnisnull.html
-rw-r--r--      3191 2016-12-04 06:08 varnish.example.log.html
-rw-r--r--      1500 2016-12-04 06:07 intro.proctitle.html
-rw-r--r--      9077 2016-12-04 06:07 pharfileinfo.setmetadata.html
-rw-r--r--      8810 2016-12-04 06:08 ds-vector.reduce.html
-rw-r--r--      1678 2016-12-04 06:08 ds-stack.count.html
-rw-r--r--      8015 2016-12-04 06:07 function.mkdir.html
-rw-r--r--      4422 2016-12-04 06:07 function.cairo-ps-surface-get-eps.html
-rw-r--r--      1846 2016-12-04 06:07 function.msql-createdb.html
-rw-r--r--      3312 2016-12-04 06:07 function.dbplus-freealllocks.html
-rw-r--r--      2806 2016-12-04 06:07 id3v2attachedpictureframe.setpicture.html
-rw-r--r--      4400 2016-12-04 06:07 function.return.html
-rw-r--r--      3131 2016-12-04 06:07 tokyotyranttable.setindex.html
-rw-r--r--     10387 2016-12-04 06:08 hwapi.object.html
-rw-r--r--      8610 2016-12-04 06:07 imagick.annotateimage.html
-rw-r--r--      4475 2016-12-04 06:08 eventbuffer.readfrom.html
-rw-r--r--      4182 2016-12-04 06:07 class.mysqli-warning.html
-rw-r--r--      6727 2016-12-04 06:08 domnode.removechild.html
-rw-r--r--      2327 2016-12-04 06:07 iterator.current.html
-rw-r--r--      3745 2016-12-04 06:08 gearmanclient.runtasks.html
-rw-r--r--      1973 2016-12-04 06:07 constants.newt.sense-flags.html
-rw-r--r--      2795 2016-12-04 06:08 solrcollapsefunction.gethint.html
-rw-r--r--     69743 2016-12-04 06:07 function.db2-set-option.html
-rw-r--r--      6110 2016-12-04 06:07 function.mb-ereg.html
-rw-r--r--      3073 2016-12-04 06:08 harudestination.setfitbh.html
-rw-r--r--      4921 2016-12-04 06:08 yaf-application.getconfig.html
-rw-r--r--      3058 2016-12-04 06:07 intltimezone.createenumeration.html
-rw-r--r--      6848 2016-12-04 06:07 intlcalendar.todatetime.html
-rw-r--r--      3050 2016-12-04 06:07 imagick.cropthumbnailimage.html
-rw-r--r--      3416 2016-12-04 06:07 book.dba.html
-rw-r--r--     13055 2016-12-04 06:07 imagick.forwardfouriertransformimage.html
-rw-r--r--     10472 2016-12-04 06:08 function.xml-set-object.html
-rw-r--r--      5069 2016-12-04 06:08 function.xml-set-default-handler.html
-rw-r--r--      7112 2016-12-04 06:08 function.array-combine.html
-rw-r--r--      5081 2016-12-04 06:07 function.mysqlnd-qc-get-available-handlers.html
-rw-r--r--      7850 2016-12-04 06:07 function.openssl-spki-new.html
-rw-r--r--      2527 2016-12-04 06:08 harufont.getfontname.html
-rw-r--r--      1507 2016-12-04 06:08 intro.rrd.html
-rw-r--r--      4528 2016-12-04 06:08 ds-deque.construct.html
-rw-r--r--      4565 2016-12-04 06:08 ds-vector.allocate.html
-rw-r--r--      1702 2016-12-04 06:08 internals2.counter.examples.html
-rw-r--r--      4114 2016-12-04 06:07 generator.getreturn.html
-rw-r--r--     11546 2016-12-04 06:07 mongodb.tutorial.library.html
-rw-r--r--      4478 2016-12-04 06:07 function.getcwd.html
-rw-r--r--      4396 2016-12-04 06:08 ds-deque.copy.html
-rw-r--r--      6831 2016-12-04 06:07 intlchar.islower.html
-rw-r--r--      3022 2016-12-04 06:08 evtimer.set.html
-rw-r--r--      1502 2016-12-04 06:07 ref.intl.idn.html
-rw-r--r--      5660 2016-12-04 06:08 win32ps.examples-process.html
-rw-r--r--      1556 2016-12-04 06:07 intro.cubrid.html
-rw-r--r--      2730 2016-12-04 06:07 function.openal-buffer-create.html
-rw-r--r--      7130 2016-12-04 06:08 function.svn-checkout.html
-rw-r--r--      2936 2016-12-04 06:08 internals2.opcodes.assign-bw-and.html
-rw-r--r--      1356 2016-12-04 06:07 radius.configuration.html
-rw-r--r--      7202 2016-12-04 06:07 function.basename.html
-rw-r--r--      6419 2016-12-04 06:08 function.method-exists.html
-rw-r--r--      6947 2016-12-04 06:07 cairocontext.relcurveto.html
-rw-r--r--      3170 2016-12-04 06:07 function.msql-affected-rows.html
-rw-r--r--      7569 2016-12-04 06:07 phardata.decompress.html
-rw-r--r--      2534 2016-12-04 06:08 yaf-exception.getprevious.html
-rw-r--r--      3642 2016-12-04 06:07 harudoc.readfromstream.html
-rw-r--r--      2626 2016-12-04 06:08 yaf-response-abstract.tostring.html
-rw-r--r--     13089 2016-12-04 06:07 class.mongocommandcursor.html
-rw-r--r--      4160 2016-12-04 06:08 book.mnogosearch.html
-rw-r--r--      1703 2016-12-04 06:08 intro.yaf.html
-rw-r--r--     22300 2016-12-04 06:08 class.filesystemiterator.html
-rw-r--r--      1534 2016-12-04 06:07 ingres.setup.html
-rw-r--r--      2045 2016-12-04 06:08 function.pdf-fill.html
-rw-r--r--      3044 2016-12-04 06:08 yaf-view-interface.display.html
-rw-r--r--      3175 2016-12-04 06:08 streamwrapper.stream-truncate.html
-rw-r--r--      5687 2016-12-04 06:07 mysql.examples-basic.html
-rw-r--r--      3287 2016-12-04 06:07 function.gmp-rootrem.html
-rw-r--r--      6428 2016-12-04 06:07 function.odbc-prepare.html
-rw-r--r--      3567 2016-12-04 06:08 function.apache-reset-timeout.html
-rw-r--r--      8923 2016-12-04 06:07 class.exception.html
-rw-r--r--      2664 2016-12-04 06:07 imagick.getquantumrange.html
-rw-r--r--      1510 2016-12-04 06:08 swish.setup.html
-rw-r--r--     25339 2016-12-04 06:07 class.ziparchive.html
-rw-r--r--      2617 2016-12-04 06:07 function.oci-cancel.html
-rw-r--r--      2331 2016-12-04 06:08 function.pdf-begin-template-ext.html
-rw-r--r--      2810 2016-12-04 06:08 reflectionfunction.getclosure.html
-rw-r--r--      2765 2016-12-04 06:08 cachingiterator.offsetunset.html
-rw-r--r--      4895 2016-12-04 06:08 function.gupnp-context-get-host-ip.html
-rw-r--r--      2571 2016-12-04 06:08 yaf-request-simple.getpost.html
-rw-r--r--     11269 2016-12-04 06:08 yaf.configuration.html
-rw-r--r--      6093 2016-12-04 06:08 function.strlen.html
-rw-r--r--      7151 2016-12-04 06:08 stomp.setreadtimeout.html
-rw-r--r--      2209 2016-12-04 06:08 svm.construct.html
-rw-r--r--     25758 2016-12-04 06:07 install.fpm.configuration.html
-rw-r--r--      8493 2016-12-04 06:07 mysqlnduhconnection.getlastmessage.html
-rw-r--r--      4575 2016-12-04 06:07 scream.examples-simple.html
-rw-r--r--      6048 2016-12-04 06:08 splqueue.construct.html
-rw-r--r--      3592 2016-12-04 06:08 domelement.getelementsbytagname.html
-rw-r--r--      1846 2016-12-04 06:07 function.recode.html
-rw-r--r--      3120 2016-12-04 06:08 recursivedirectoryiterator.haschildren.html
-rw-r--r--      2908 2016-12-04 06:08 function.fann-get-total-neurons.html
-rw-r--r--      5485 2016-12-04 06:08 gearmanclient.setclientcallback.html
-rw-r--r--      4551 2016-12-04 06:07 function.error-clear-last.html
-rw-r--r--      3008 2016-12-04 06:07 mongodate.tostring.html
-rw-r--r--      8779 2016-12-04 06:08 ds-deque.reduce.html
-rw-r--r--      6111 2016-12-04 06:08 syncsemaphore.construct.html
-rw-r--r--      5631 2016-12-04 06:08 book.sockets.html
-rw-r--r--      1335 2016-12-04 06:08 xml.configuration.html
-rw-r--r--      1554 2016-12-04 06:07 vpopmail.setup.html
-rw-r--r--      6049 2016-12-04 06:07 intlchar.isidstart.html
-rw-r--r--      7208 2016-12-04 06:08 function.escapeshellcmd.html
-rw-r--r--      2474 2016-12-04 06:08 yaf-registry.del.html
-rw-r--r--      3253 2016-12-04 06:07 harudoc.loadjpeg.html
-rw-r--r--      1337 2016-12-04 06:07 math.installation.html
-rw-r--r--      3914 2016-12-04 06:08 function.com-message-pump.html
-rw-r--r--      1356 2016-12-04 06:07 dbplus.configuration.html
-rw-r--r--      2817 2016-12-04 06:07 datetime.constants.html
-rw-r--r--      3111 2016-12-04 06:07 apcuiterator.current.html
-rw-r--r--      3662 2016-12-04 06:08 limititerator.rewind.html
-rw-r--r--      9997 2016-12-04 06:07 pdostatement.bindvalue.html
-rw-r--r--      3086 2016-12-04 06:07 gmagick.getimageblueprimary.html
-rw-r--r--      2463 2016-12-04 06:08 ui-area.scrollto.html
-rw-r--r--      2536 2016-12-04 06:08 ui-controls-multilineentry.setreadonly.html
-rw-r--r--      7387 2016-12-04 06:07 function.apc-cache-info.html
-rw-r--r--     16382 2016-12-04 06:07 function.cubrid-commit.html
-rw-r--r--      4906 2016-12-04 06:08 function.variant-int.html
-rw-r--r--      7970 2016-12-04 06:08 function.urlencode.html
-rw-r--r--      4269 2016-12-04 06:08 splfileobject.ftell.html
-rw-r--r--      1335 2016-12-04 06:07 readline.resources.html
-rw-r--r--      2566 2016-12-04 06:08 varnishadmin.setcompat.html
-rw-r--r--      5880 2016-12-04 06:08 directoryiterator.isfile.html
-rw-r--r--      6447 2016-12-04 06:07 function.mb-convert-variables.html
-rw-r--r--      2910 2016-12-04 06:07 function.trader-typprice.html
-rw-r--r--      8045 2016-12-04 06:08 function.strstr.html
-rw-r--r--     13308 2016-12-04 06:07 wrappers.ssh2.html
-rw-r--r--     15974 2016-12-04 06:07 class.tokyotyrantiterator.html
-rw-r--r--      4232 2016-12-04 06:07 function.sqlite-valid.html
-rw-r--r--      3071 2016-12-04 06:07 ref.dbase.html
-rw-r--r--      2972 2016-12-04 06:08 solrquery.setfacetdategap.html
-rw-r--r--      3371 2016-12-04 06:07 function.trader-cdlrisefall3methods.html
-rw-r--r--      2033 2016-12-04 06:08 swffont.getleading.html
-rw-r--r--      5312 2016-12-04 06:08 reflectionmethod.getdeclaringclass.html
-rw-r--r--      3037 2016-12-04 06:08 zmqsocket.bind.html
-rw-r--r--     19966 2016-12-04 06:08 function.json-decode.html
-rw-r--r--      2633 2016-12-04 06:08 harupage.closepath.html
-rw-r--r--      1827 2016-12-04 06:08 function.pdf-open-jpeg.html
-rw-r--r--      1569 2016-12-04 06:07 mysqlnd-qc.setup.html
-rw-r--r--      1600 2016-12-04 06:08 migration55.extensions-other.html
-rw-r--r--      5016 2016-12-04 06:08 sam.messages.html
-rw-r--r--      6791 2016-12-04 06:07 function.radius-get-tagged-attr-data.html
-rw-r--r--      7627 2016-12-04 06:07 mongo.tutorial.findone.html
-rw-r--r--      6213 2016-12-04 06:07 function.ingres-field-type.html
-rw-r--r--      3082 2016-12-04 06:07 imagick.setresourcelimit.html
-rw-r--r--      3792 2016-12-04 06:07 cairogradientpattern.getextend.html
-rw-r--r--      7508 2016-12-04 06:07 function.image-type-to-mime-type.html
-rw-r--r--      1335 2016-12-04 06:08 lua.configuration.html
-rw-r--r--      3954 2016-12-04 06:07 class.mongodb-bson-utcdatetime.html
-rw-r--r--      2950 2016-12-04 06:08 eventhttprequest.getinputbuffer.html
-rw-r--r--      3972 2016-12-04 06:07 openssl.certparams.html
-rw-r--r--      2906 2016-12-04 06:08 function.fann-run.html
-rw-r--r--      3179 2016-12-04 06:07 mysqli-driver.embedded-server-start.html
-rw-r--r--      3622 2016-12-04 06:08 function.ftok.html
-rw-r--r--      2194 2016-12-04 06:08 function.pdf-delete-table.html
-rw-r--r--      2533 2016-12-04 06:08 function.pdf-fit-textline.html
-rw-r--r--      7813 2016-12-04 06:07 function.mysql-drop-db.html
-rw-r--r--      6298 2016-12-04 06:08 ref.xmlwriter.html
-rw-r--r--      1655 2016-12-04 06:07 lapack.installation.html
-rw-r--r--     35139 2016-12-04 06:08 book.yaf.html
-rw-r--r--      2197 2016-12-04 06:08 ming.install.html
-rw-r--r--      6946 2016-12-04 06:07 function.pg-copy-from.html
-rw-r--r--      6400 2016-12-04 06:07 mongoclient.setreadpreference.html
-rw-r--r--      3590 2016-12-04 06:07 imagick.getimageartifact.html
-rw-r--r--      2716 2016-12-04 06:08 hwapi.move.html
-rw-r--r--      5120 2016-12-04 06:08 sdo.examples-basic.html
-rw-r--r--      1363 2016-12-04 06:08 varnish.configuration.html
-rw-r--r--      2320 2016-12-04 06:07 function.newt-cursor-off.html
-rw-r--r--      3849 2016-12-04 06:07 function.maxdb-more-results.html
-rw-r--r--      2606 2016-12-04 06:07 function.bson-decode.html
-rw-r--r--      2574 2016-12-04 06:08 solrdocument.offsetunset.html
-rw-r--r--     15364 2016-12-04 06:08 yaf-route-rewrite.construct.html
-rw-r--r--      5529 2016-12-04 06:07 class.mongogridfsfile.html
-rw-r--r--      3971 2016-12-04 06:07 function.expm1.html
-rw-r--r--      6594 2016-12-04 06:07 mongodb-driver-readconcern.getlevel.html
-rw-r--r--      1919 2016-12-04 06:07 intro.haru.html
-rw-r--r--      4741 2016-12-04 06:07 imagick.shaveimage.html
-rw-r--r--      1370 2016-12-04 06:07 vpopmail.configuration.html
-rw-r--r--      1601 2016-12-04 06:08 win32service.setup.html
-rw-r--r--      1414 2016-12-04 06:08 yaml.requirements.html
-rw-r--r--      8955 2016-12-04 06:07 function.wincache-fcache-fileinfo.html
-rw-r--r--      7272 2016-12-04 06:08 function.geoip-region-name-by-code.html
-rw-r--r--      3694 2016-12-04 06:07 cairoimagesurface.getstride.html
-rw-r--r--      7977 2016-12-04 06:07 intlcalendar.setfirstdayofweek.html
-rw-r--r--      3371 2016-12-04 06:08 function.ldap-escape.html
-rw-r--r--      3685 2016-12-04 06:08 function.variant-neg.html
-rw-r--r--      1570 2016-12-04 06:08 net-gopher.setup.html
-rw-r--r--      2872 2016-12-04 06:08 internals2.opcodes.bw-not.html
-rw-r--r--      5115 2016-12-04 06:07 function.imageinterlace.html
-rw-r--r--      3447 2016-12-04 06:07 function.acos.html
-rw-r--r--     10713 2016-12-04 06:07 function.db2-prepare.html
-rw-r--r--      6489 2016-12-04 06:07 function.pg-lo-read.html
-rw-r--r--      3531 2016-12-04 06:08 function.socket-recvmsg.html
-rw-r--r--      4727 2016-12-04 06:07 function.ncurses-color-content.html
-rw-r--r--      1342 2016-12-04 06:07 bcompiler.resources.html
-rw-r--r--     12725 2016-12-04 06:07 collator.setstrength.html
-rw-r--r--      4033 2016-12-04 06:08 class.emptyiterator.html
-rw-r--r--      3400 2016-12-04 06:08 gearmanjob.sendwarning.html
-rw-r--r--      3942 2016-12-04 06:08 function.ldap-modify.html
-rw-r--r--      4459 2016-12-04 06:08 function.fann-create-standard-array.html
-rw-r--r--      7347 2016-12-04 06:07 phar.addfromstring.html
-rw-r--r--     11007 2016-12-04 06:07 function.mssql-field-seek.html
-rw-r--r--      1563 2016-12-04 06:07 datetime.setup.html
-rw-r--r--      3999 2016-12-04 06:08 domnode.c14nfile.html
-rw-r--r--      3843 2016-12-04 06:08 internals2.opcodes.jmp.html
-rw-r--r--      5786 2016-12-04 06:08 regexp.reference.subpatterns.html
-rw-r--r--      5237 2016-12-04 06:07 function.gzuncompress.html
-rw-r--r--      2583 2016-12-04 06:08 com.examples.arrays.html
-rw-r--r--      2704 2016-12-04 06:08 solrdocument.get.html
-rw-r--r--      6357 2016-12-04 06:07 mongodb-driver-writeerror.getcode.html
-rw-r--r--      2706 2016-12-04 06:07 imagick.setimagescene.html
-rw-r--r--      9918 2016-12-04 06:07 tokyotyrantquery.valid.html
-rw-r--r--      5727 2016-12-04 06:07 function.recode-file.html
-rw-r--r--      2654 2016-12-04 06:07 function.odbc-rollback.html
-rw-r--r--      3234 2016-12-04 06:08 function.fann-get-rprop-delta-min.html
-rw-r--r--      7728 2016-12-04 06:07 ref.mysql.html
-rw-r--r--      9138 2016-12-04 06:07 function.pg-update.html
-rw-r--r--      1349 2016-12-04 06:07 cyrus.configuration.html
-rw-r--r--      2546 2016-12-04 06:08 function.ldap-dn2ufn.html
-rw-r--r--      1328 2016-12-04 06:07 openssl.resources.html
-rw-r--r--      6708 2016-12-04 06:08 class.ui-controls-button.html
-rw-r--r--      2404 2016-12-04 06:08 ui-controls-entry.isreadonly.html
-rw-r--r--      3888 2016-12-04 06:08 yaf-response-abstract.clearbody.html
-rw-r--r--      3106 2016-12-04 06:08 stomp.hasframe.html
-rw-r--r--      7610 2016-12-04 06:07 intro-whatcando.html
-rw-r--r--     11286 2016-12-04 06:08 function.eio-open.html
-rw-r--r--      9531 2016-12-04 06:08 function.rtrim.html
-rw-r--r--      6698 2016-12-04 06:08 migration56.changed-functions.html
-rw-r--r--      4347 2016-12-04 06:07 mysqli.init.html
-rw-r--r--      8523 2016-12-04 06:08 internals2.structure.lifecycle.html
-rw-r--r--      2511 2016-12-04 06:08 ref.ctype.html
-rw-r--r--      4443 2016-12-04 06:08 function.msg-set-queue.html
-rw-r--r--      3455 2016-12-04 06:07 function.ibase-affected-rows.html
-rw-r--r--     39800 2016-12-04 06:07 book.cairo.html
-rw-r--r--      2724 2016-12-04 06:08 memcached.installation.html
-rw-r--r--      8312 2016-12-04 06:07 mongodb.getcollectioninfo.html
-rw-r--r--      2755 2016-12-04 06:08 eventhttpconnection.getbase.html
-rw-r--r--      2830 2016-12-04 06:07 gmagick.setimagegamma.html
-rw-r--r--      4282 2016-12-04 06:07 intlcalendar.getminimum.html
-rw-r--r--      5105 2016-12-04 06:08 memcached.getdelayedbykey.html
-rw-r--r--      1495 2016-12-04 06:07 pdo.setup.html
-rw-r--r--      6518 2016-12-04 06:07 function.mysql-get-proto-info.html
-rw-r--r--      4644 2016-12-04 06:07 function.ceil.html
-rw-r--r--      8725 2016-12-04 06:07 phar.buildfromdirectory.html
-rw-r--r--      3773 2016-12-04 06:07 function.fdf-set-version.html
-rw-r--r--     35854 2016-12-04 06:07 function.mb-decode-numericentity.html
-rw-r--r--      7968 2016-12-04 06:07 function.fnmatch.html
-rw-r--r--      3132 2016-12-04 06:07 install.pecl.static.html
-rw-r--r--      8263 2016-12-04 06:08 regexp.reference.repetition.html
-rw-r--r--      5251 2016-12-04 06:07 ref.msql.html
-rw-r--r--      2759 2016-12-04 06:07 throwable.gettraceasstring.html
-rw-r--r--      4340 2016-12-04 06:08 function.gupnp-context-new.html
-rw-r--r--      2614 2016-12-04 06:08 ref.mqseries.html
-rw-r--r--      6267 2016-12-04 06:07 function.mcrypt-get-iv-size.html
-rw-r--r--      3102 2016-12-04 06:07 gmagick.readimageblob.html
-rw-r--r--      2578 2016-12-04 06:08 internals2.opcodes.ext-stmt.html
-rw-r--r--      4564 2016-12-04 06:07 function.iptcparse.html
-rw-r--r--      8965 2016-12-04 06:08 function.wordwrap.html
-rw-r--r--      2661 2016-12-04 06:08 hwapi.user.html
-rw-r--r--      3339 2016-12-04 06:07 imagick.combineimages.html
-rw-r--r--      3095 2016-12-04 06:07 function.mcrypt-enc-is-block-algorithm-mode.html
-rw-r--r--      2767 2016-12-04 06:08 emptyiterator.key.html
-rw-r--r--      4908 2016-12-04 06:07 function.cairo-matrix-transform-point.html
-rw-r--r--      3308 2016-12-04 06:07 function.trader-cdlengulfing.html
-rw-r--r--      4940 2016-12-04 06:07 function.getenv.html
-rw-r--r--      4897 2016-12-04 06:07 security.variables.html
-rw-r--r--      3144 2016-12-04 06:07 imap.requirements.html
-rw-r--r--      4691 2016-12-04 06:07 class.mongowriteconcernexception.html
-rw-r--r--      2505 2016-12-04 06:07 imagickpixel.setindex.html
-rw-r--r--      2290 2016-12-04 06:07 imagick.getimagecompressionquality.html
-rw-r--r--      6502 2016-12-04 06:07 tokyotyrant.putnr.html
-rw-r--r--     20971 2016-12-04 06:08 fann.constants.html
-rw-r--r--      4562 2016-12-04 06:08 reflectionclass.getextensionname.html
-rw-r--r--      7396 2016-12-04 06:08 simplexmlelement.xpath.html
-rw-r--r--      2672 2016-12-04 06:08 yaf-response-abstract.setredirect.html
-rw-r--r--      7972 2016-12-04 06:07 mongodb-driver-cursor.settypemap.html
-rw-r--r--     18852 2016-12-04 06:08 function.ldap-modify-batch.html
-rw-r--r--      2199 2016-12-04 06:07 tag.gettitle.html
-rw-r--r--      8448 2016-12-04 06:08 function.is-scalar.html
-rw-r--r--      5773 2016-12-04 06:08 book.network.html
-rw-r--r--      5888 2016-12-04 06:07 function.log-write-batch.html
-rw-r--r--      4341 2016-12-04 06:07 wincache.installation.html
-rw-r--r--     19473 2016-12-04 06:07 function.ob-start.html
-rw-r--r--      3107 2016-12-04 06:08 ui-executor.setinterval.html
-rw-r--r--      2456 2016-12-04 06:08 curlfile.setpostfilename.html
-rw-r--r--      6177 2016-12-04 06:08 function.headers-list.html
-rw-r--r--      1294 2016-12-04 06:07 msql.requirements.html
-rw-r--r--     20371 2016-12-04 06:07 mongodb-driver-manager.executebulkwrite.html
-rw-r--r--      2390 2016-12-04 06:08 yaf-loader.construct.html
-rw-r--r--      8453 2016-12-04 06:07 function.cubrid-get-client-info.html
-rw-r--r--      3572 2016-12-04 06:08 callbackfilteriterator.accept.html
-rw-r--r--      4848 2016-12-04 06:07 mongodb-bson-regex.getflags.html
-rw-r--r--      2215 2016-12-04 06:07 tag.getartist.html
-rw-r--r--     20977 2016-12-04 06:08 class.ds-map.html
-rw-r--r--      2054 2016-12-04 06:08 pdf.installation.html
-rw-r--r--      3815 2016-12-04 06:07 mysqlnd.plugin.obtaining.html
-rw-r--r--      8467 2016-12-04 06:07 imagick.frameimage.html
-rw-r--r--      2930 2016-12-04 06:07 intlbreakiterator.getpartsiterator.html
-rw-r--r--      2107 2016-12-04 06:08 history.html
-rw-r--r--     10747 2016-12-04 06:07 function.version-compare.html
-rw-r--r--      2074 2016-12-04 06:07 mongodb.setup.html
-rw-r--r--      2012 2016-12-04 06:07 function.date-interval-format.html
-rw-r--r--     10549 2016-12-04 06:07 function.easter-date.html
-rw-r--r--      4080 2016-12-04 06:07 function.main.html
-rw-r--r--      3021 2016-12-04 06:07 function.ncurses-assume-default-colors.html
-rw-r--r--      3085 2016-12-04 06:07 intro.cairo.html
-rw-r--r--      2909 2016-12-04 06:07 function.m-verifysslcert.html
-rw-r--r--      2217 2016-12-04 06:08 ui-size.getheight.html
-rw-r--r--     11983 2016-12-04 06:07 function.mssql-bind.html
-rw-r--r--      4346 2016-12-04 06:08 class.domnamednodemap.html
-rw-r--r--      3258 2016-12-04 06:08 internals2.counter.function.counter-bump.html
-rw-r--r--      4459 2016-12-04 06:08 function.svn-delete.html
-rw-r--r--      5615 2016-12-04 06:07 function.gregoriantojd.html
-rw-r--r--      2918 2016-12-04 06:08 recursivetreeiterator.enditeration.html
-rw-r--r--      1462 2016-12-04 06:07 crack.resources.html
-rw-r--r--      6990 2016-12-04 06:08 function.var-dump.html
-rw-r--r--      3010 2016-12-04 06:08 multipleiterator.next.html
-rw-r--r--      2229 2016-12-04 06:08 ui-window.setmargin.html
-rw-r--r--      2708 2016-12-04 06:07 function.log10.html
-rw-r--r--      8508 2016-12-04 06:08 function.system.html
-rw-r--r--      5098 2016-12-04 06:07 function.bzcompress.html
-rw-r--r--     12891 2016-12-04 06:07 function.sqlsrv-connect.html
-rw-r--r--      3561 2016-12-04 06:07 function.openal-listener-set.html
-rw-r--r--      4188 2016-12-04 06:08 function.apache-child-terminate.html
-rw-r--r--      4493 2016-12-04 06:07 function.openssl-pkey-export.html
-rw-r--r--      6328 2016-12-04 06:08 arrayobject.ksort.html
-rw-r--r--      1916 2016-12-04 06:08 function.socket-getopt.html
-rw-r--r--      9522 2016-12-04 06:08 class.ui-controls-multilineentry.html
-rw-r--r--      1533 2016-12-04 06:07 oggvorbis.requirements.html
-rw-r--r--     10021 2016-12-04 06:08 function.array-intersect-key.html
-rw-r--r--      6405 2016-12-04 06:08 xsltprocessor.transformtoxml.html
-rw-r--r--      9365 2016-12-04 06:07 class.cairopdfsurface.html
-rw-r--r--     22724 2016-12-04 06:07 book.gmagick.html
-rw-r--r--      6079 2016-12-04 06:08 history.php.related.html
-rw-r--r--      3459 2016-12-04 06:08 reflectionfunctionabstract.getextension.html
-rw-r--r--      4139 2016-12-04 06:08 intro.sdo.html
-rw-r--r--     11208 2016-12-04 06:08 filter.examples.validation.html
-rw-r--r--      7647 2016-12-04 06:08 ref.stream.html
-rw-r--r--      9733 2016-12-04 06:08 function.stream-wrapper-register.html
-rw-r--r--      4246 2016-12-04 06:08 yaf-route-interface.route.html
-rw-r--r--      3148 2016-12-04 06:07 gmagick.separateimagechannel.html
-rw-r--r--      7204 2016-12-04 06:08 function.curl-unescape.html
-rw-r--r--      4077 2016-12-04 06:08 gearmanworker.setid.html
-rw-r--r--      4885 2016-12-04 06:08 splfixedarray.getsize.html
-rw-r--r--      7128 2016-12-04 06:07 mysqlnd.plugin.html
-rw-r--r--      3685 2016-12-04 06:08 internals2.opcodes.assign-dim.html
-rw-r--r--      8622 2016-12-04 06:07 function.db2-foreign-keys.html
-rw-r--r--      4480 2016-12-04 06:07 function.cairo-image-surface-get-format.html
-rw-r--r--      5360 2016-12-04 06:08 splfileobject.setmaxlinelen.html
-rw-r--r--      1305 2016-12-04 06:07 gender.examples.html
-rw-r--r--      2497 2016-12-04 06:08 harufont.getascent.html
-rw-r--r--      2805 2016-12-04 06:07 gmagickdraw.setstrokewidth.html
-rw-r--r--      2449 2016-12-04 06:07 gmagick.flipimage.html
-rw-r--r--      5174 2016-12-04 06:07 function.bccomp.html
-rw-r--r--      1795 2016-12-04 06:08 function.ldap-close.html
-rw-r--r--      4626 2016-12-04 06:07 function.cairo-scaled-font-get-font-matrix.html
-rw-r--r--      4052 2016-12-04 06:07 function.sqlite-prev.html
-rw-r--r--      9607 2016-12-04 06:08 solrclient.getbyids.html
-rw-r--r--      8243 2016-12-04 06:07 function.mysql-ping.html
-rw-r--r--      3209 2016-12-04 06:08 gearmanjob.senddata.html
-rw-r--r--      4981 2016-12-04 06:07 image.installation.html
-rw-r--r--     10054 2016-12-04 06:07 functions.user-defined.html
-rw-r--r--      6192 2016-12-04 06:07 mongocollection.createdbref.html
-rw-r--r--      7130 2016-12-04 06:07 intlchar.charname.html
-rw-r--r--      4177 2016-12-04 06:08 harupage.curveto.html
-rw-r--r--      4694 2016-12-04 06:07 cairoimagesurface.getheight.html
-rw-r--r--      4904 2016-12-04 06:07 cairocontext.showpage.html
-rw-r--r--      7740 2016-12-04 06:07 imagick.sigmoidalcontrastimage.html
-rw-r--r--      7183 2016-12-04 06:07 mysqlnduhconnection.txcommit.html
-rw-r--r--      2828 2016-12-04 06:07 gmagick.getimageredprimary.html
-rw-r--r--      1883 2016-12-04 06:07 intro.ifx.html
-rw-r--r--      3335 2016-12-04 06:08 infiniteiterator.next.html
-rw-r--r--      2336 2016-12-04 06:08 ui-draw-path.newfigure.html
-rw-r--r--      5325 2016-12-04 06:08 solrclient.ping.html
-rw-r--r--      2477 2016-12-04 06:07 gmagick.enhanceimage.html
-rw-r--r--      4187 2016-12-04 06:08 ds-deque.reversed.html
-rw-r--r--      1858 2016-12-04 06:07 function.msql-fieldtable.html
-rw-r--r--     14060 2016-12-04 06:07 mysqlnd-qc.constants.html
-rw-r--r--      8768 2016-12-04 06:08 gearmanclient.jobstatus.html
-rw-r--r--      2564 2016-12-04 06:08 varnishadmin.setident.html
-rw-r--r--      8647 2016-12-04 06:07 function.fbsql-query.html
-rw-r--r--      2391 2016-12-04 06:08 yaf-session.construct.html
-rw-r--r--      2027 2016-12-04 06:08 migration51.integer-parameters.html
-rw-r--r--      3048 2016-12-04 06:08 function.yp-all.html
-rw-r--r--      2103 2016-12-04 06:08 function.pdf-closepath-stroke.html
-rw-r--r--      1322 2016-12-04 06:08 classkit.requirements.html
-rw-r--r--      3572 2016-12-04 06:07 mcve.installation.html
-rw-r--r--      1328 2016-12-04 06:08 varnish.resources.html
-rw-r--r--      9583 2016-12-04 06:07 function.maxdb-num-fields.html
-rw-r--r--      5752 2016-12-04 06:08 oauthprovider.tokenhandler.html
-rw-r--r--      1633 2016-12-04 06:08 wddx.installation.html
-rw-r--r--      2313 2016-12-04 06:08 swfmovie.addfont.html
-rw-r--r--      8401 2016-12-04 06:07 mbstring.overload.html
-rw-r--r--      8109 2016-12-04 06:08 reflectionclass.hasmethod.html
-rw-r--r--      2405 2016-12-04 06:08 eventbase.reinit.html
-rw-r--r--      8881 2016-12-04 06:07 mongocursor.setflag.html
-rw-r--r--      3967 2016-12-04 06:08 splenum.getconstlist.html
-rw-r--r--      6037 2016-12-04 06:08 function.escapeshellarg.html
-rw-r--r--      6810 2016-12-04 06:07 function.db2-conn-error.html
-rw-r--r--      4200 2016-12-04 06:07 function.fdf-set-javascript-action.html
-rw-r--r--      4503 2016-12-04 06:07 function.cairo-font-options-get-antialias.html
-rw-r--r--      4017 2016-12-04 06:07 function.msql-list-tables.html
-rw-r--r--      2492 2016-12-04 06:07 function.trader-sinh.html
-rw-r--r--     16177 2016-12-04 06:08 migration55.new-features.html
-rw-r--r--      2102 2016-12-04 06:07 function.trader-errno.html
-rw-r--r--      4398 2016-12-04 06:07 function.imap-timeout.html
-rw-r--r--      3290 2016-12-04 06:08 solrobject.construct.html
-rw-r--r--      2956 2016-12-04 06:08 function.fann-length-train-data.html
-rw-r--r--      2185 2016-12-04 06:08 ui-controls-spin.getvalue.html
-rw-r--r--      1342 2016-12-04 06:08 judy.configuration.html
-rw-r--r--      4541 2016-12-04 06:07 intl.examples.basic.html
-rw-r--r--      3860 2016-12-04 06:07 mongo.context.html
-rw-r--r--      2683 2016-12-04 06:07 function.trader-tema.html
-rw-r--r--      7022 2016-12-04 06:07 function.wincache-rplist-meminfo.html
-rw-r--r--      4390 2016-12-04 06:07 function.cairo-pattern-get-rgba.html
-rw-r--r--      3358 2016-12-04 06:08 function.yaz-schema.html
-rw-r--r--      2765 2016-12-04 06:08 solrquery.getfacetdateend.html
-rw-r--r--      2223 2016-12-04 06:08 curlfile.getmimetype.html
-rw-r--r--      2554 2016-12-04 06:08 yaf-application.getappdirectory.html
-rw-r--r--      2901 2016-12-04 06:08 arrayiterator.getflags.html
-rw-r--r--      2640 2016-12-04 06:08 reference.pcre.pattern.syntax.html
-rw-r--r--      6793 2016-12-04 06:07 class.mongodb-driver-exception-runtimeexception.html
-rw-r--r--     10110 2016-12-04 06:07 mysqlnduhconnection.setserveroption.html
-rw-r--r--      1365 2016-12-04 06:08 funchand.installation.html
-rw-r--r--      1697 2016-12-04 06:07 mysqli.requirements.html
-rw-r--r--      7554 2016-12-04 06:07 control-structures.elseif.html
-rw-r--r--      7903 2016-12-04 06:07 function.gmdate.html
-rw-r--r--      9178 2016-12-04 06:08 domimplementation.createdocumenttype.html
-rw-r--r--      2857 2016-12-04 06:08 solrquery.getfacetmincount.html
-rw-r--r--      6314 2016-12-04 06:08 function.ftp-size.html
-rw-r--r--      6244 2016-12-04 06:08 class.ui-exception-invalidargumentexception.html
-rw-r--r--      2948 2016-12-04 06:08 function.filter-has-var.html
-rw-r--r--      6814 2016-12-04 06:07 gnupg.examples-clearsign.html
-rw-r--r--      2468 2016-12-04 06:08 gearmantask.isknown.html
-rw-r--r--      5662 2016-12-04 06:07 function.db2-close.html
-rw-r--r--      1774 2016-12-04 06:08 ref.parsekit.html
-rw-r--r--      1496 2016-12-04 06:08 eio.setup.html
-rw-r--r--      9340 2016-12-04 06:07 intldateformatter.geterrormessage.html
-rw-r--r--      5774 2016-12-04 06:07 function.mb-strpos.html
-rw-r--r--      6373 2016-12-04 06:07 tokyotyrant.putshl.html
-rw-r--r--      1289 2016-12-04 06:08 ldap.examples.html
-rw-r--r--      3991 2016-12-04 06:08 domelement.setattributenode.html
-rw-r--r--      2388 2016-12-04 06:07 function.ncurses-werase.html
-rw-r--r--      3975 2016-12-04 06:07 cairosvgsurface.versiontostring.html
-rw-r--r--      6898 2016-12-04 06:08 arrayobject.getiteratorclass.html
-rw-r--r--      2599 2016-12-04 06:07 ziparchive.getstatusstring.html
-rw-r--r--      1531 2016-12-04 06:08 xmlrpc.setup.html
-rw-r--r--      5902 2016-12-04 06:07 book.gmp.html
-rw-r--r--      5211 2016-12-04 06:08 samconnection.errno.html
-rw-r--r--      7076 2016-12-04 06:08 tidynode.isasp.html
-rw-r--r--      1295 2016-12-04 06:07 proctitle.requirements.html
-rw-r--r--      3391 2016-12-04 06:08 reflectionproperty.isprotected.html
-rw-r--r--      4980 2016-12-04 06:08 ds-set.merge.html
-rw-r--r--      2614 2016-12-04 06:08 filteriterator.valid.html
-rw-r--r--      5579 2016-12-04 06:08 arrayobject.count.html
-rw-r--r--      1349 2016-12-04 06:08 net-gopher.resources.html
-rw-r--r--      7235 2016-12-04 06:07 function.cubrid-num-rows.html
-rw-r--r--      2647 2016-12-04 06:08 evwatcher.start.html
-rw-r--r--     20368 2016-12-04 06:07 function.oci-close.html
-rw-r--r--     13104 2016-12-04 06:08 json.constants.html
-rw-r--r--      8068 2016-12-04 06:08 class.solrillegalargumentexception.html
-rw-r--r--      2784 2016-12-04 06:08 swfbitmap.getheight.html
-rw-r--r--      2926 2016-12-04 06:08 gearmantask.tasknumerator.html
-rw-r--r--      2631 2016-12-04 06:07 iterator.key.html
-rw-r--r--      6979 2016-12-04 06:07 tokyotyrantiterator.construct.html
-rw-r--r--      2711 2016-12-04 06:08 gearmanjob.workloadsize.html
-rw-r--r--      4228 2016-12-04 06:08 function.get-declared-interfaces.html
-rw-r--r--      4265 2016-12-04 06:07 function.dio-stat.html
-rw-r--r--     11171 2016-12-04 06:07 numberformatter.setsymbol.html
-rw-r--r--      2464 2016-12-04 06:07 function.vpopmail-del-domain-ex.html
-rw-r--r--     32563 2016-12-04 06:07 mongocollection.aggregate.html
-rw-r--r--      2946 2016-12-04 06:07 gmagick.queryformats.html
-rw-r--r--      1562 2016-12-04 06:08 xmlreader.setup.html
-rw-r--r--      2871 2016-12-04 06:08 book.session-pgsql.html
-rw-r--r--      2226 2016-12-04 06:08 function.pdf-create-fieldgroup.html
-rw-r--r--      9158 2016-12-04 06:07 book.mbstring.html
-rw-r--r--      5911 2016-12-04 06:07 function.gnupg-encrypt.html
-rw-r--r--      2156 2016-12-04 06:07 imagick.getcompression.html
-rw-r--r--      1715 2016-12-04 06:08 com.installation.html
-rw-r--r--      3396 2016-12-04 06:07 function.mailparse-msg-parse-file.html
-rw-r--r--      3149 2016-12-04 06:07 mongocommandcursor.next.html
-rw-r--r--      2765 2016-12-04 06:07 gmagickdraw.setfillopacity.html
-rw-r--r--      2096 2016-12-04 06:08 function.ui-draw-text-font-fontfamilies.html
-rw-r--r--      5587 2016-12-04 06:07 function.gmp-strval.html
-rw-r--r--      3480 2016-12-04 06:08 function.ps-stroke.html
-rw-r--r--      3739 2016-12-04 06:07 function.trader-stochrsi.html
-rw-r--r--      2311 2016-12-04 06:08 solrobject.destruct.html
-rw-r--r--      7495 2016-12-04 06:07 function.kadm5-init-with-password.html
-rw-r--r--      3134 2016-12-04 06:08 evstat.prev.html
-rw-r--r--     28892 2016-12-04 06:07 function.db2-exec.html
-rw-r--r--      1567 2016-12-04 06:08 memcached.setup.html
-rw-r--r--      3455 2016-12-04 06:07 features.dtrace.introduction.html
-rw-r--r--      3739 2016-12-04 06:08 domelement.hasattribute.html
-rw-r--r--      8279 2016-12-04 06:07 locale.filtermatches.html
-rw-r--r--      1435 2016-12-04 06:08 internals2.counter.resources.html
-rw-r--r--      9279 2016-12-04 06:08 domdocument.savexml.html
-rw-r--r--      4025 2016-12-04 06:07 error.getmessage.html
-rw-r--r--      1205 2016-12-04 06:07 lzf.constants.html
-rw-r--r--      1582 2016-12-04 06:07 language.basic-syntax.html
-rw-r--r--      2705 2016-12-04 06:07 gmagick.getimagefilename.html
-rw-r--r--      8440 2016-12-04 06:08 class.soapfault.html
-rw-r--r--      5785 2016-12-04 06:07 wrappers.data.html
-rw-r--r--      4978 2016-12-04 06:07 mongoregex.construct.html
-rw-r--r--      2357 2016-12-04 06:08 ui-controls-check.construct.html
-rw-r--r--     10118 2016-12-04 06:07 pharfileinfo.setcompressedgz.html
-rw-r--r--      3104 2016-12-04 06:08 solrdocument.haschilddocuments.html
-rw-r--r--      2695 2016-12-04 06:08 swfaction.construct.html
-rw-r--r--      7743 2016-12-04 06:07 pharfileinfo.delmetadata.html
-rw-r--r--      7925 2016-12-04 06:08 sdo-das-relational.executequery.html
-rw-r--r--      1714 2016-12-04 06:07 oggvorbis.installation.html
-rw-r--r--      2716 2016-12-04 06:08 intro.filter.html
-rw-r--r--      3522 2016-12-04 06:07 tokyotyrantiterator.next.html
-rw-r--r--      3891 2016-12-04 06:07 mysqlnd.install.html
-rw-r--r--      2746 2016-12-04 06:07 function.ncurses-slk-color.html
-rw-r--r--      8288 2016-12-04 06:07 imagick.queryformats.html
-rw-r--r--      3843 2016-12-04 06:08 sca.createdataobject.html
-rw-r--r--      3045 2016-12-04 06:08 function.ps-include-file.html
-rw-r--r--      1939 2016-12-04 06:08 function.pdf-set-horiz-scaling.html
-rw-r--r--      2308 2016-12-04 06:08 ui-controls-grid.setpadded.html
-rw-r--r--      8479 2016-12-04 06:07 function.msql-fetch-object.html
-rw-r--r--      3312 2016-12-04 06:07 error.construct.html
-rw-r--r--      2611 2016-12-04 06:08 yaf-request-abstract.isoptions.html
-rw-r--r--      2440 2016-12-04 06:08 svmmodel.getsvrprobability.html
-rw-r--r--      2743 2016-12-04 06:08 judy.next.html
-rw-r--r--      2965 2016-12-04 06:08 fannconnection.construct.html
-rw-r--r--      2774 2016-12-04 06:07 function.vpopmail-add-domain.html
-rw-r--r--      7664 2016-12-04 06:08 quickhashintstringhash.loadfromstring.html
-rw-r--r--      2685 2016-12-04 06:08 function.ming-setscale.html
-rw-r--r--      3049 2016-12-04 06:08 function.ps-setoverprintmode.html
-rw-r--r--      4034 2016-12-04 06:07 class.mongoint32.html
-rw-r--r--      2229 2016-12-04 06:08 function.pdf-add-thumbnail.html
-rw-r--r--      3847 2016-12-04 06:08 function.fann-scale-input.html
-rw-r--r--      2264 2016-12-04 06:08 function.pdf-create-action.html
-rw-r--r--     16783 2016-12-04 06:08 class.reflectionfunction.html
-rw-r--r--      5041 2016-12-04 06:08 splfileobject.getcsvcontrol.html
-rw-r--r--      9224 2016-12-04 06:07 language.operators.assignment.html
-rw-r--r--      3690 2016-12-04 06:08 haruencoder.getbytetype.html
-rw-r--r--      4694 2016-12-04 06:08 function.str-repeat.html
-rw-r--r--      5453 2016-12-04 06:07 function.pg-untrace.html
-rw-r--r--      1489 2016-12-04 06:07 rar.setup.html
-rw-r--r--      5588 2016-12-04 06:08 directoryiterator.rewind.html
-rw-r--r--      6181 2016-12-04 06:08 memcache.pconnect.html
-rw-r--r--      3224 2016-12-04 06:07 function.stats-cdf-cauchy.html
-rw-r--r--      4736 2016-12-04 06:07 cairocontext.construct.html
-rw-r--r--     12840 2016-12-04 06:07 function.cubrid-lob2-seek64.html
-rw-r--r--      2756 2016-12-04 06:08 zmqdevice.setidletimeout.html
-rw-r--r--      2271 2016-12-04 06:08 function.msession-get.html
-rw-r--r--      2650 2016-12-04 06:08 book.bbcode.html
-rw-r--r--      3207 2016-12-04 06:08 function.ssdeep-fuzzy-compare.html
-rw-r--r--      5795 2016-12-04 06:08 function.eio-poll.html
-rw-r--r--      2616 2016-12-04 06:08 yaf-session.offsetunset.html
-rw-r--r--      4728 2016-12-04 06:07 function.cairo-ps-surface-dsc-comment.html
-rw-r--r--      2710 2016-12-04 06:07 sqlite3.busytimeout.html
-rw-r--r--      2430 2016-12-04 06:08 varnishadmin.getpanic.html
-rw-r--r--      5626 2016-12-04 06:08 ds-vector.find.html
-rw-r--r--      1954 2016-12-04 06:08 function.pdf-set-leading.html
-rw-r--r--      2758 2016-12-04 06:08 oauth.setsslchecks.html
-rw-r--r--      1715 2016-12-04 06:08 migration53.new-stream-filters.html
-rw-r--r--      8560 2016-12-04 06:07 function.mysql-db-name.html
-rw-r--r--      4819 2016-12-04 06:08 gearmanclient.setwarningcallback.html
-rw-r--r--     10886 2016-12-04 06:07 function.sqlsrv-cancel.html
-rw-r--r--     22619 2016-12-04 06:08 ref.fann.html
-rw-r--r--      3682 2016-12-04 06:07 imagick.contraststretchimage.html
-rw-r--r--     10364 2016-12-04 06:07 function.cubrid-fetch.html
-rw-r--r--      6496 2016-12-04 06:07 function.pg-get-notify.html
-rw-r--r--      3278 2016-12-04 06:07 function.trader-cdlkicking.html
-rw-r--r--      5063 2016-12-04 06:07 function.gmp-sign.html
-rw-r--r--      3642 2016-12-04 06:07 msql.configuration.html
-rw-r--r--      7903 2016-12-04 06:08 function.svn-commit.html
-rw-r--r--      7778 2016-12-04 06:07 function.ingres-fetch-object.html
-rw-r--r--      3608 2016-12-04 06:07 cairosurface.getcontent.html
-rw-r--r--      7833 2016-12-04 06:08 class.ui-draw-color.html
-rw-r--r--      8746 2016-12-04 06:07 class.mongoid.html
-rw-r--r--      5005 2016-12-04 06:07 cairocontext.getfontmatrix.html
-rw-r--r--      2981 2016-12-04 06:07 function.ncurses-mvinch.html
-rw-r--r--      2537 2016-12-04 06:07 function.ibase-errcode.html
-rw-r--r--      8601 2016-12-04 06:08 network.constants.html
-rw-r--r--      3165 2016-12-04 06:07 mysqlnduhconnection.shutdownserver.html
-rw-r--r--      3958 2016-12-04 06:07 function.imap-undelete.html
-rw-r--r--      3232 2016-12-04 06:08 function.udm-clear-search-limits.html
-rw-r--r--      3239 2016-12-04 06:07 function.trader-cdlhangingman.html
-rw-r--r--      6659 2016-12-04 06:07 tokyotyrantquery.hint.html
-rw-r--r--      5269 2016-12-04 06:07 function.fdf-add-doc-javascript.html
-rw-r--r--      8851 2016-12-04 06:08 simplexmlelement.getdocnamespaces.html
-rw-r--r--      3097 2016-12-04 06:08 solrdocument.merge.html
-rw-r--r--     16121 2016-12-04 06:07 language.operators.type.html
-rw-r--r--     13721 2016-12-04 06:08 simplexmlelement.children.html
-rw-r--r--      2736 2016-12-04 06:08 xsltprocessor.getsecurityprefs.html
-rw-r--r--      1332 2016-12-04 06:08 ming.configuration.html
-rw-r--r--     16009 2016-12-04 06:07 function.ingres-connect.html
-rw-r--r--      2962 2016-12-04 06:07 gmagick.setfilename.html
-rw-r--r--     23274 2016-12-04 06:08 book.fann.html
-rw-r--r--      8568 2016-12-04 06:08 ds-map.sorted.html
-rw-r--r--     16748 2016-12-04 06:07 function.ingres-unbuffered-query.html
-rw-r--r--      3039 2016-12-04 06:08 zmqsocket.recvmulti.html
-rw-r--r--      4929 2016-12-04 06:07 function.mb-strlen.html
-rw-r--r--      2592 2016-12-04 06:08 yaf-request-abstract.ishead.html
-rw-r--r--      4731 2016-12-04 06:07 ref.gnupg.html
-rw-r--r--      5532 2016-12-04 06:08 book.simplexml.html
-rw-r--r--      8437 2016-12-04 06:07 locale.getdisplaylanguage.html
-rw-r--r--      5601 2016-12-04 06:07 function.gnupg-setarmor.html
-rw-r--r--      7940 2016-12-04 06:08 class.solrclientexception.html
-rw-r--r--      2399 2016-12-04 06:08 ui-controls-radio.setselected.html
-rw-r--r--      2398 2016-12-04 06:08 solrpingresponse.destruct.html
-rw-r--r--      2364 2016-12-04 06:08 function.pdf-show-xy.html
-rw-r--r--      9002 2016-12-04 06:08 ming.examples.swfsprite-basic.html
-rw-r--r--      1843 2016-12-04 06:07 book.mime-magic.html
-rw-r--r--      1550 2016-12-04 06:07 intro.mcrypt.html
-rw-r--r--      7844 2016-12-04 06:08 stomp.construct.html
-rw-r--r--      2789 2016-12-04 06:07 function.ibase-free-result.html
-rw-r--r--      3305 2016-12-04 06:07 phardata.setalias.html
-rw-r--r--      5146 2016-12-04 06:08 migration70.changed-functions.html
-rw-r--r--      2671 2016-12-04 06:08 intro.sockets.html
-rw-r--r--      1470 2016-12-04 06:08 session.examples.html
-rw-r--r--      4951 2016-12-04 06:08 quickhashstringinthash.construct.html
-rw-r--r--      4462 2016-12-04 06:08 function.geoip-domain-by-name.html
-rw-r--r--      2735 2016-12-04 06:07 gmagickdraw.setfont.html
-rw-r--r--      5841 2016-12-04 06:07 intro.image.html
-rw-r--r--      3107 2016-12-04 06:08 about.howtohelp.html
-rw-r--r--      2885 2016-12-04 06:08 yaf-request-abstract.setcontrollername.html
-rw-r--r--      6192 2016-12-04 06:08 class.globiterator.html
-rw-r--r--      2498 2016-12-04 06:07 function.trader-cosh.html
-rw-r--r--      3408 2016-12-04 06:08 reflectionparameter.isdefaultvalueavailable.html
-rw-r--r--      7868 2016-12-04 06:07 phardata.extractto.html
-rw-r--r--      1824 2016-12-04 06:07 function.user-error.html
-rw-r--r--     12620 2016-12-04 06:08 class.ui-window.html
-rw-r--r--      1416 2016-12-04 06:08 ref.solr.html
-rw-r--r--      3121 2016-12-04 06:08 function.snmp-set-oid-numeric-print.html
-rw-r--r--      7064 2016-12-04 06:08 tidynode.istext.html
-rw-r--r--      2852 2016-12-04 06:08 migration56.html
-rw-r--r--      3076 2016-12-04 06:08 solrquery.setfacetoffset.html
-rw-r--r--      2477 2016-12-04 06:08 varnishadmin.disconnect.html
-rw-r--r--      8364 2016-12-04 06:07 imagick.transformimagecolorspace.html
-rw-r--r--      3028 2016-12-04 06:07 imagick.setimageindex.html
-rw-r--r--     11068 2016-12-04 06:07 function.ifx-query.html
-rw-r--r--      5473 2016-12-04 06:07 tokyo-tyrant.installation.html
-rw-r--r--      9228 2016-12-04 06:07 imagick.setimageclipmask.html
-rw-r--r--      3140 2016-12-04 06:08 function.svn-mkdir.html
-rw-r--r--      3302 2016-12-04 06:07 function.stats-dens-pmf-hypergeometric.html
-rw-r--r--      3635 2016-12-04 06:08 function.fann-num-output-train-data.html
-rw-r--r--      7191 2016-12-04 06:07 function.sqlite-changes.html
-rw-r--r--      3688 2016-12-04 06:08 oauthprovider.calltimestampnoncehandler.html
-rw-r--r--      6633 2016-12-04 06:08 function.posix-access.html
-rw-r--r--      4165 2016-12-04 06:08 zookeeper.construct.html
-rw-r--r--      2106 2016-12-04 06:08 function.pdf-delete.html
-rw-r--r--      3302 2016-12-04 06:08 function.ps-get-buffer.html
-rw-r--r--      3066 2016-12-04 06:08 swfbutton.sethit.html
-rw-r--r--      2577 2016-12-04 06:07 datetimeimmutable.setdate.html
-rw-r--r--      3567 2016-12-04 06:08 function.getservbyport.html
-rw-r--r--      3459 2016-12-04 06:07 install.fpm.html
-rw-r--r--      5304 2016-12-04 06:08 function.inet-pton.html
-rw-r--r--      3727 2016-12-04 06:08 internals2.opcodes.do-fcall-by-name.html
-rw-r--r--      4676 2016-12-04 06:08 worker.unstack.html
-rw-r--r--      5248 2016-12-04 06:08 domnode.replacechild.html
-rw-r--r--      2854 2016-12-04 06:08 hwapi.object-remove.html
-rw-r--r--      3315 2016-12-04 06:08 reflectionfunctionabstract.getdoccomment.html
-rw-r--r--      4877 2016-12-04 06:07 function.fdf-open-string.html
-rw-r--r--      6202 2016-12-04 06:08 splfixedarray.fromarray.html
-rw-r--r--      3465 2016-12-04 06:08 internals2.opcodes.jmpnz-ex.html
-rw-r--r--      3395 2016-12-04 06:07 function.dbplus-sql.html
-rw-r--r--      4339 2016-12-04 06:08 function.posix-times.html
-rw-r--r--      6097 2016-12-04 06:07 function.rmdir.html
-rw-r--r--      1568 2016-12-04 06:07 oggvorbis.setup.html
-rw-r--r--      1957 2016-12-04 06:07 mysqlnd-mux.requirements.html
-rw-r--r--      7194 2016-12-04 06:07 mysqlnduhconnection.txrollback.html
-rw-r--r--      1398 2016-12-04 06:08 memcache.resources.html
-rw-r--r--      1605 2016-12-04 06:08 migration53.undeprecated.html
-rw-r--r--     29584 2016-12-04 06:08 eio.examples.html
-rw-r--r--      1451 2016-12-04 06:08 memcached.callbacks.html
-rw-r--r--      8059 2016-12-04 06:07 function.mb-detect-order.html
-rw-r--r--      4755 2016-12-04 06:07 function.cairo-ps-surface-restrict-to-level.html
-rw-r--r--      1688 2016-12-04 06:07 intro.spplus.html
-rw-r--r--      4067 2016-12-04 06:07 function.inotify-add-watch.html
-rw-r--r--      2681 2016-12-04 06:07 gmagick.getimagecolors.html
-rw-r--r--      3733 2016-12-04 06:08 function.ps-moveto.html
-rw-r--r--      2899 2016-12-04 06:07 harudoc.output.html
-rw-r--r--      4200 2016-12-04 06:07 function.fbsql-change-user.html
-rw-r--r--      8320 2016-12-04 06:07 ref.ibm-db2.html
-rw-r--r--      3986 2016-12-04 06:08 function.tidy-save-config.html
-rw-r--r--      1304 2016-12-04 06:08 spl-types.resources.html
-rw-r--r--      2741 2016-12-04 06:07 function.trader-maxindex.html
-rw-r--r--      3118 2016-12-04 06:08 solrdocument.getchilddocuments.html
-rw-r--r--      3328 2016-12-04 06:08 function.fann-get-sarprop-weight-decay-shift.html
-rw-r--r--      1300 2016-12-04 06:07 apc.resources.html
-rw-r--r--      2607 2016-12-04 06:08 v8jsexception.getjslinenumber.html
-rw-r--r--      2605 2016-12-04 06:08 yaf-config-ini.get.html
-rw-r--r--      2597 2016-12-04 06:07 imagick.getimageredprimary.html
-rw-r--r--      4082 2016-12-04 06:07 mongodb.setslaveokay.html
-rw-r--r--      4371 2016-12-04 06:08 internals2.buildsys.skeleton.html
-rw-r--r--      3665 2016-12-04 06:07 ibm-db2.installation.html
-rw-r--r--      3625 2016-12-04 06:07 mysqlnd-ms.rwsplit.html
-rw-r--r--      4154 2016-12-04 06:08 thread.join.html
-rw-r--r--      2671 2016-12-04 06:07 function.trader-dema.html
-rw-r--r--      6601 2016-12-04 06:08 function.ftp-pasv.html
-rw-r--r--     12652 2016-12-04 06:07 phar.compressfiles.html
-rw-r--r--      4099 2016-12-04 06:07 function.mailparse-msg-extract-whole-part-file.html
-rw-r--r--      4703 2016-12-04 06:07 imagick.edgeimage.html
-rw-r--r--      1796 2016-12-04 06:07 constants.newt.args-flags.html
-rw-r--r--      4965 2016-12-04 06:08 splfileinfo.getpath.html
-rw-r--r--      2897 2016-12-04 06:08 function.fam-open.html
-rw-r--r--      6243 2016-12-04 06:07 imagick.adaptivethresholdimage.html
-rw-r--r--      3306 2016-12-04 06:08 internals2.opcodes.add-char.html
-rw-r--r--      7471 2016-12-04 06:07 mongodb-driver-writeconcernerror.getinfo.html
-rw-r--r--      2464 2016-12-04 06:08 harupage.endtext.html
-rw-r--r--      3851 2016-12-04 06:08 function.xmlrpc-is-fault.html
-rw-r--r--      9867 2016-12-04 06:08 function.ctype-digit.html
-rw-r--r--      3539 2016-12-04 06:08 function.gupnp-context-get-subscription-timeout.html
-rw-r--r--      4308 2016-12-04 06:07 function.cairo-font-face-get-type.html
-rw-r--r--      4250 2016-12-04 06:08 function.curl-multi-remove-handle.html
-rw-r--r--      3069 2016-12-04 06:07 function.pg-connect-poll.html
-rw-r--r--      7562 2016-12-04 06:07 function.iconv-mime-decode.html
-rw-r--r--     17464 2016-12-04 06:07 function.imagegif.html
-rw-r--r--      1468 2016-12-04 06:08 bbcode.resources.html
-rw-r--r--     21923 2016-12-04 06:08 class.sphinxclient.html
-rw-r--r--      7672 2016-12-04 06:07 cairocontext.copypathflat.html
-rw-r--r--      4920 2016-12-04 06:07 book.runkit.html
-rw-r--r--      5782 2016-12-04 06:08 ds-sequence.map.html
-rw-r--r--      8376 2016-12-04 06:07 mysqlnd-uh.quickstart.query-monitoring.html
-rw-r--r--      2985 2016-12-04 06:08 yaf-route-regex.route.html
-rw-r--r--      4529 2016-12-04 06:07 imagick.identifyformat.html
-rw-r--r--      2284 2016-12-04 06:08 function.msession-create.html
-rw-r--r--      5706 2016-12-04 06:08 solrquery.setgrouplimit.html
-rw-r--r--    170815 2016-12-04 06:08 resource.html
-rw-r--r--      2242 2016-12-04 06:07 intro.radius.html
-rw-r--r--      2937 2016-12-04 06:08 zmqcontext.getopt.html
-rw-r--r--      6749 2016-12-04 06:08 internals2.opcodes.case.html
-rw-r--r--     25128 2016-12-04 06:07 mongo.writeconcerns.html
-rw-r--r--      2386 2016-12-04 06:08 solrqueryresponse.destruct.html
-rw-r--r--      3620 2016-12-04 06:07 function.trader-cdleveningdojistar.html
-rw-r--r--      5466 2016-12-04 06:08 zookeeper.exists.html
-rw-r--r--      7918 2016-12-04 06:07 function.ncurses-init-pair.html
-rw-r--r--      2521 2016-12-04 06:08 yaf-config-abstract.toarray.html
-rw-r--r--      9033 2016-12-04 06:08 internals2.counter.examples.extended.html
-rw-r--r--     10771 2016-12-04 06:07 numberformatter.getsymbol.html
-rw-r--r--      2992 2016-12-04 06:08 class.rrdupdater.html
-rw-r--r--      2607 2016-12-04 06:08 judy.last.html
-rw-r--r--      6573 2016-12-04 06:07 function.mysqlnd-ms-xa-gc.html
-rw-r--r--      5066 2016-12-04 06:08 function.apache-getenv.html
-rw-r--r--      2671 2016-12-04 06:08 recursivetreeiterator.next.html
-rw-r--r--      6161 2016-12-04 06:08 simplexmliterator.getchildren.html
-rw-r--r--      6069 2016-12-04 06:08 class.runtimeexception.html
-rw-r--r--      2578 2016-12-04 06:07 kadm5.installation.html
-rw-r--r--      3753 2016-12-04 06:07 language.operators.html
-rw-r--r--      7905 2016-12-04 06:07 function.cubrid-lob-export.html
-rw-r--r--      3144 2016-12-04 06:07 gmagick.charcoalimage.html
-rw-r--r--      8906 2016-12-04 06:08 function.yaz-connect.html
-rw-r--r--      1836 2016-12-04 06:07 ingres.resources.html
-rw-r--r--     12850 2016-12-04 06:07 class.cairopssurface.html
-rw-r--r--     10050 2016-12-04 06:07 mysqlnduhconnection.listfields.html
-rw-r--r--      4317 2016-12-04 06:08 ref.snmp.html
-rw-r--r--      1535 2016-12-04 06:07 memtrack.setup.html
-rw-r--r--      2401 2016-12-04 06:08 hwapi.error-count.html
-rw-r--r--      3189 2016-12-04 06:08 function.ps-show2.html
-rw-r--r--     18806 2016-12-04 06:07 class.mongocursorexception.html
-rw-r--r--      2696 2016-12-04 06:07 weakmap.offsetget.html
-rw-r--r--      3925 2016-12-04 06:08 swftextfield.setcolor.html
-rw-r--r--      2827 2016-12-04 06:07 function.nthmac.html
-rw-r--r--      8706 2016-12-04 06:07 odbc.configuration.html
-rw-r--r--      2467 2016-12-04 06:08 zmqsocket.getpersistentid.html
-rw-r--r--      3253 2016-12-04 06:07 function.dbplus-close.html
-rw-r--r--      4014 2016-12-04 06:08 streamwrapper.stream-eof.html
-rw-r--r--      2228 2016-12-04 06:07 mongodb.--tostring.html
-rw-r--r--      3215 2016-12-04 06:08 eventbufferevent.write.html
-rw-r--r--      2826 2016-12-04 06:07 function.ncurses-slk-attron.html
-rw-r--r--     19386 2016-12-04 06:08 function.preg-match.html
-rw-r--r--      4282 2016-12-04 06:07 function.mb-preferred-mime-name.html
-rw-r--r--     10978 2016-12-04 06:08 recursiveregexiterator.construct.html
-rw-r--r--      7098 2016-12-04 06:08 tidynode.iscomment.html
-rw-r--r--      6547 2016-12-04 06:07 function.xattr-list.html
-rw-r--r--      3055 2016-12-04 06:07 function.stats-dens-normal.html
-rw-r--r--      2940 2016-12-04 06:08 solrquery.addmltqueryfield.html
-rw-r--r--      3241 2016-12-04 06:07 function.trader-cdldojistar.html
-rw-r--r--      1308 2016-12-04 06:08 bbcode.requirements.html
-rw-r--r--      9385 2016-12-04 06:07 sybase.configuration.html
-rw-r--r--      2360 2016-12-04 06:08 solrquery.getquery.html
-rw-r--r--      6695 2016-12-04 06:07 function.mb-strimwidth.html
-rw-r--r--      1342 2016-12-04 06:08 solr.configuration.html
-rw-r--r--      7983 2016-12-04 06:07 mysqlnduhconnection.selectdb.html
-rw-r--r--      1322 2016-12-04 06:07 memtrack.requirements.html
-rw-r--r--     19303 2016-12-04 06:07 oci8.installation.html
-rw-r--r--      2787 2016-12-04 06:07 function.ncurses-has-key.html
-rw-r--r--      6513 2016-12-04 06:07 class.mongodb-driver-writeconcern.html
-rw-r--r--      2168 2016-12-04 06:07 tag.getyear.html
-rw-r--r--      3117 2016-12-04 06:08 yaf-application.app.html
-rw-r--r--      6319 2016-12-04 06:08 reflectionfunction.invoke.html
-rw-r--r--      5242 2016-12-04 06:07 ref.pdo-4d.sql4d.html
-rw-r--r--     14864 2016-12-04 06:07 function.fwrite.html
-rw-r--r--      1349 2016-12-04 06:07 outcontrol.resources.html
-rw-r--r--      6770 2016-12-04 06:07 function.copy.html
-rw-r--r--      3135 2016-12-04 06:07 function.trader-bop.html
-rw-r--r--      6439 2016-12-04 06:08 function.passthru.html
-rw-r--r--      2788 2016-12-04 06:07 intlbreakiterator.next.html
-rw-r--r--      3931 2016-12-04 06:08 spldoublylinkedlist.setiteratormode.html
-rw-r--r--     10504 2016-12-04 06:07 function.maxdb-info.html
-rw-r--r--      2600 2016-12-04 06:08 function.pdf-fit-table.html
-rw-r--r--      2206 2016-12-04 06:08 function.pdf-define-layer.html
-rw-r--r--      6433 2016-12-04 06:08 reflectionfunctionabstract.getreturntype.html
-rw-r--r--      5173 2016-12-04 06:07 mcrypt.constants.html
-rw-r--r--      8363 2016-12-04 06:08 appenditerator.key.html
-rw-r--r--      2928 2016-12-04 06:08 haruoutline.setopened.html
-rw-r--r--      3920 2016-12-04 06:07 function.jewishtojd.html
-rw-r--r--      2631 2016-12-04 06:07 intltimezone.getrawoffset.html
-rw-r--r--      1497 2016-12-04 06:07 hash.setup.html
-rw-r--r--      3296 2016-12-04 06:07 harudoc.resetstream.html
-rw-r--r--      5379 2016-12-04 06:08 event.addtimer.html
-rw-r--r--      8095 2016-12-04 06:07 features.gc.collecting-cycles.html
-rw-r--r--      6612 2016-12-04 06:07 class.apcuiterator.html
-rw-r--r--      3165 2016-12-04 06:08 oauth.getlastresponseinfo.html
-rw-r--r--      5230 2016-12-04 06:08 solrdismaxquery.setuserfields.html
-rw-r--r--      2676 2016-12-04 06:08 solrquery.gettermsincludeupperbound.html
-rw-r--r--     17283 2016-12-04 06:08 streamwrapper.dir-readdir.html
-rw-r--r--     71295 2016-12-04 06:07 function.oci-fetch-array.html
-rw-r--r--      7453 2016-12-04 06:07 intlchar.totitle.html
-rw-r--r--      4349 2016-12-04 06:08 function.fann-set-output-scaling-params.html
-rw-r--r--      2443 2016-12-04 06:08 ui-window.error.html
-rw-r--r--      8404 2016-12-04 06:07 locale.getdisplayregion.html
-rw-r--r--      2539 2016-12-04 06:08 ui-draw-stroke.setjoin.html
-rw-r--r--      3690 2016-12-04 06:08 function.fann-get-rprop-delta-zero.html
-rw-r--r--      5834 2016-12-04 06:07 function.imagepsextendfont.html
-rw-r--r--      1239 2016-12-04 06:08 shmop.constants.html
-rw-r--r--     17606 2016-12-04 06:07 function.imagefilledarc.html
-rw-r--r--      3272 2016-12-04 06:07 trader.configuration.html
-rw-r--r--      1245 2016-12-04 06:07 stats.constants.html
-rw-r--r--      2487 2016-12-04 06:07 gmagickdraw.getfontstyle.html
-rw-r--r--      5411 2016-12-04 06:08 function.shmop-write.html
-rw-r--r--      4230 2016-12-04 06:08 snmp.geterror.html
-rw-r--r--      2361 2016-12-04 06:07 function.ncurses-getch.html
-rw-r--r--      4201 2016-12-04 06:08 solrdismaxquery.setqueryalt.html
-rw-r--r--      4471 2016-12-04 06:08 cond.signal.html
-rw-r--r--      5376 2016-12-04 06:08 domdocumentfragment.appendxml.html
-rw-r--r--      1684 2016-12-04 06:08 intro.bbcode.html
-rw-r--r--     10094 2016-12-04 06:08 class.evprepare.html
-rw-r--r--      2839 2016-12-04 06:08 solrquery.getfacetoffset.html
-rw-r--r--      2863 2016-12-04 06:07 function.newt-textbox-set-height.html
-rw-r--r--      4780 2016-12-04 06:07 intro.wincache.html
-rw-r--r--      2803 2016-12-04 06:07 function.ibase-gen-id.html
-rw-r--r--      1542 2016-12-04 06:07 ncurses.setup.html
-rw-r--r--     13025 2016-12-04 06:08 function.yaml-emit.html
-rw-r--r--      6570 2016-12-04 06:08 evchild.construct.html
-rw-r--r--      9310 2016-12-04 06:07 mysql.configuration.html
-rw-r--r--     30606 2016-12-04 06:07 pgsql.constants.html
-rw-r--r--      3691 2016-12-04 06:07 function.ibase-close.html
-rw-r--r--      2980 2016-12-04 06:08 internals2.opcodes.mul.html
-rw-r--r--      6183 2016-12-04 06:07 function.imagecreatefromxpm.html
-rw-r--r--      4614 2016-12-04 06:08 globiterator.count.html
-rw-r--r--      3370 2016-12-04 06:08 internals2.counter.function.counter-create.html
-rw-r--r--      4530 2016-12-04 06:07 mongo.tutorial.multi.query.html
-rw-r--r--      2242 2016-12-04 06:07 mysqlnd-ms.changes.html
-rw-r--r--      2140 2016-12-04 06:07 imagick.nextimage.html
-rw-r--r--      3220 2016-12-04 06:07 function.dba-close.html
-rw-r--r--      1288 2016-12-04 06:08 event.resources.html
-rw-r--r--      4330 2016-12-04 06:07 function.cairo-create.html
-rw-r--r--      4829 2016-12-04 06:07 function.pclose.html
-rw-r--r--      2403 2016-12-04 06:07 imagickdraw.getfillopacity.html
-rw-r--r--      3161 2016-12-04 06:08 harupage.gettransmatrix.html
-rw-r--r--      2247 2016-12-04 06:07 function.newt-bell.html
-rw-r--r--      1342 2016-12-04 06:08 sdodasrel.resources.html
-rw-r--r--      2346 2016-12-04 06:08 judy.memoryusage.html
-rw-r--r--      5811 2016-12-04 06:07 function.ob-list-handlers.html
-rw-r--r--      4934 2016-12-04 06:07 function.iconv-set-encoding.html
-rw-r--r--      5734 2016-12-04 06:07 function.cal-info.html
-rw-r--r--      2656 2016-12-04 06:07 imagickdraw.getstrokeantialias.html
-rw-r--r--      9697 2016-12-04 06:08 intro.sca.html
-rw-r--r--      6153 2016-12-04 06:07 function.mcrypt-get-key-size.html
-rw-r--r--      8642 2016-12-04 06:07 intlcalendar.isweekend.html
-rw-r--r--      3535 2016-12-04 06:08 function.fann-set-cascade-max-out-epochs.html
-rw-r--r--      7754 2016-12-04 06:07 imagickpixel.setcolor.html
-rw-r--r--      3395 2016-12-04 06:08 gearmantask.recvdata.html
-rw-r--r--      1470 2016-12-04 06:08 url.setup.html
-rw-r--r--      5016 2016-12-04 06:08 ds-set.diff.html
-rw-r--r--      3983 2016-12-04 06:08 function.ps-show-xy.html
-rw-r--r--      3146 2016-12-04 06:07 throwable.getcode.html
-rw-r--r--      5050 2016-12-04 06:08 ds-deque.merge.html
-rw-r--r--      2626 2016-12-04 06:07 imagick.drawimage.html
-rw-r--r--      1541 2016-12-04 06:07 enchant.setup.html
-rw-r--r--      2520 2016-12-04 06:08 solrinputdocument.toarray.html
-rw-r--r--      2020 2016-12-04 06:08 function.pdf-clip.html
-rw-r--r--      5872 2016-12-04 06:08 pthreads.modifiers.html
-rw-r--r--      2795 2016-12-04 06:08 yaf-view-simple.get.html
-rw-r--r--     10296 2016-12-04 06:07 function.mb-convert-case.html
-rw-r--r--      2066 2016-12-04 06:07 hrtime.installation.html
-rw-r--r--     27719 2016-12-04 06:08 class.evloop.html
-rw-r--r--      1636 2016-12-04 06:08 function.die.html
-rw-r--r--      3192 2016-12-04 06:08 splfixedarray.offsetget.html
-rw-r--r--      6377 2016-12-04 06:08 function.ctype-punct.html
-rw-r--r--      6786 2016-12-04 06:07 class.mongodb-driver-exception-unexpectedvalueexception.html
-rw-r--r--      5585 2016-12-04 06:08 function.pcntl-signal-dispatch.html
-rw-r--r--      5572 2016-12-04 06:08 function.ftp-delete.html
-rw-r--r--      2103 2016-12-04 06:07 function.date-create-immutable-from-format.html
-rw-r--r--      2990 2016-12-04 06:07 function.ncurses-define-key.html
-rw-r--r--      4064 2016-12-04 06:07 function.maxdb-stmt-close-long-data.html
-rw-r--r--      9719 2016-12-04 06:07 function.imagepalettetotruecolor.html
-rw-r--r--      5643 2016-12-04 06:08 function.ucfirst.html
-rw-r--r--      3811 2016-12-04 06:08 function.fann-set-cascade-output-stagnation-epochs.html
-rw-r--r--      5696 2016-12-04 06:08 splfileinfo.setfileclass.html
-rw-r--r--      1335 2016-12-04 06:07 vpopmail.resources.html
-rw-r--r--      1498 2016-12-04 06:07 ref.inclued.html
-rw-r--r--      3250 2016-12-04 06:08 harupage.setmiterlimit.html
-rw-r--r--      2784 2016-12-04 06:08 solrquery.getgroupfields.html
-rw-r--r--      6470 2016-12-04 06:08 gupnp.constants.html
-rw-r--r--      1484 2016-12-04 06:08 sdo.setup.html
-rw-r--r--      8870 2016-12-04 06:07 function.msql-fetch-array.html
-rw-r--r--      1508 2016-12-04 06:08 ldap.resources.html
-rw-r--r--      4372 2016-12-04 06:08 class.outeriterator.html
-rw-r--r--      4739 2016-12-04 06:08 regexp.reference.conditional.html
-rw-r--r--      1898 2016-12-04 06:08 ref.shmop.html
-rw-r--r--      2258 2016-12-04 06:07 weakmap.next.html
-rw-r--r--      2359 2016-12-04 06:07 weakmap.current.html
-rw-r--r--      7016 2016-12-04 06:07 function.ibase-pconnect.html
-rw-r--r--      5299 2016-12-04 06:07 imagick.thresholdimage.html
-rw-r--r--      7223 2016-12-04 06:08 function.snmp3-get.html
-rw-r--r--      5106 2016-12-04 06:08 ds-sequence.remove.html
-rw-r--r--      4335 2016-12-04 06:07 book.gnupg.html
-rw-r--r--      5647 2016-12-04 06:08 quickhashintstringhash.savetofile.html
-rw-r--r--      2662 2016-12-04 06:07 phar.creating.intro.html
-rw-r--r--     11991 2016-12-04 06:07 imagickdraw.composite.html
-rw-r--r--      6213 2016-12-04 06:07 class.cairofonttype.html
-rw-r--r--      6407 2016-12-04 06:07 function.imageaffinematrixconcat.html
-rw-r--r--      4459 2016-12-04 06:07 ref.runkit.html
-rw-r--r--      7693 2016-12-04 06:08 ds-set.sort.html
-rw-r--r--      2194 2016-12-04 06:08 function.iis-get-dir-security.html
-rw-r--r--      2623 2016-12-04 06:08 solrdocument.isset.html
-rw-r--r--      3671 2016-12-04 06:08 function.fann-set-cascade-num-candidate-groups.html
-rw-r--r--     15326 2016-12-04 06:08 reflectionmethod.construct.html
-rw-r--r--      7408 2016-12-04 06:07 calendar.constants.html
-rw-r--r--      4818 2016-12-04 06:07 function.linkinfo.html
-rw-r--r--     10434 2016-12-04 06:08 class.solrcollapsefunction.html
-rw-r--r--      4699 2016-12-04 06:07 function.closedir.html
-rw-r--r--      2925 2016-12-04 06:08 splfileobject.getchildren.html
-rw-r--r--      3778 2016-12-04 06:07 harudoc.setcompressionmode.html
-rw-r--r--      5034 2016-12-04 06:08 class.splint.html
-rw-r--r--      3253 2016-12-04 06:07 function.trader-cdlharami.html
-rw-r--r--      2361 2016-12-04 06:07 mongogridfsfile.getfilename.html
-rw-r--r--      5857 2016-12-04 06:08 function.ssh2-sftp-chmod.html
-rw-r--r--      8176 2016-12-04 06:08 class.variant.html
-rw-r--r--      9385 2016-12-04 06:07 function.php-uname.html
-rw-r--r--      4014 2016-12-04 06:08 oauth.setcapath.html
-rw-r--r--      7437 2016-12-04 06:08 function.ssh2-sftp-lstat.html
-rw-r--r--      9253 2016-12-04 06:08 example.xml-map-tags.html
-rw-r--r--      2074 2016-12-04 06:07 imagick.requirements.html
-rw-r--r--      6623 2016-12-04 06:07 fbsql.constants.html
-rw-r--r--      1551 2016-12-04 06:07 bcompiler.setup.html
-rw-r--r--     13198 2016-12-04 06:07 function.flock.html
-rw-r--r--      2068 2016-12-04 06:08 intro.swish.html
-rw-r--r--      6185 2016-12-04 06:08 function.ctype-xdigit.html
-rw-r--r--      5357 2016-12-04 06:07 function.putenv.html
-rw-r--r--     10495 2016-12-04 06:08 function.eio-symlink.html
-rw-r--r--      2912 2016-12-04 06:08 swfdisplayitem.setmatrix.html
-rw-r--r--      6179 2016-12-04 06:08 function.ps-shading.html
-rw-r--r--      2367 2016-12-04 06:08 ref.url.html
-rw-r--r--      1294 2016-12-04 06:08 misc.requirements.html
-rw-r--r--      1342 2016-12-04 06:08 ssh2.configuration.html
-rw-r--r--      2136 2016-12-04 06:07 function.ocisetprefetch.html
-rw-r--r--      1322 2016-12-04 06:08 classobj.requirements.html
-rw-r--r--     17634 2016-12-04 06:07 book.trader.html
-rw-r--r--      3681 2016-12-04 06:08 internals2.opcodes.is-identical.html
-rw-r--r--      2733 2016-12-04 06:07 function.ncurses-bkgdset.html
-rw-r--r--     17827 2016-12-04 06:07 mysqlnd.plugin.architecture.html
-rw-r--r--      4698 2016-12-04 06:08 filesystemiterator.next.html
-rw-r--r--      2607 2016-12-04 06:08 splheap.insert.html
-rw-r--r--      8290 2016-12-04 06:08 function.stripslashes.html
-rw-r--r--      9836 2016-12-04 06:07 function.idate.html
-rw-r--r--      1808 2016-12-04 06:08 regex.installation.html
-rw-r--r--      2517 2016-12-04 06:08 harupage.eofill.html
-rw-r--r--      1409 2016-12-04 06:08 intro.xsl.html
-rw-r--r--      2516 2016-12-04 06:08 swfsprite.startsound.html
-rw-r--r--      3247 2016-12-04 06:08 class.spltype.html
-rw-r--r--      9763 2016-12-04 06:07 runkit.constants.html
-rw-r--r--      1935 2016-12-04 06:08 zmq.requirements.html
-rw-r--r--     14498 2016-12-04 06:07 function.maxdb-stmt-result-metadata.html
-rw-r--r--      7202 2016-12-04 06:08 internals2.opcodes.catch.html
-rw-r--r--      5639 2016-12-04 06:07 function.odbc-specialcolumns.html
-rw-r--r--      1214 2016-12-04 06:07 haru.constants.html
-rw-r--r--     10174 2016-12-04 06:07 pharfileinfo.setuncompressed.html
-rw-r--r--      5232 2016-12-04 06:08 function.svn-cleanup.html
-rw-r--r--      3905 2016-12-04 06:08 function.xml-get-current-byte-index.html
-rw-r--r--      5231 2016-12-04 06:08 memcached.casbykey.html
-rw-r--r--      4675 2016-12-04 06:07 ref.radius.html
-rw-r--r--      9817 2016-12-04 06:08 class.v8jsexception.html
-rw-r--r--      6064 2016-12-04 06:07 function.ftell.html
-rw-r--r--     12901 2016-12-04 06:07 security.database.storage.html
-rw-r--r--      2454 2016-12-04 06:07 imagick.getimagevirtualpixelmethod.html
-rw-r--r--     14764 2016-12-04 06:08 class.spltempfileobject.html
-rw-r--r--      9960 2016-12-04 06:08 book.spl.html
-rw-r--r--      5159 2016-12-04 06:08 zookeeper.setdeterministicconnorder.html
-rw-r--r--      5626 2016-12-04 06:07 function.px-get-info.html
-rw-r--r--      6346 2016-12-04 06:08 limititerator.construct.html
-rw-r--r--      7778 2016-12-04 06:08 tidy.construct.html
-rw-r--r--      2619 2016-12-04 06:07 imagick.getimageindex.html
-rw-r--r--      8333 2016-12-04 06:08 function.array-uintersect-assoc.html
-rw-r--r--      9782 2016-12-04 06:07 function.db2-special-columns.html
-rw-r--r--      1874 2016-12-04 06:08 internals2.opcodes.fetch-unset.html
-rw-r--r--      2827 2016-12-04 06:08 eventlistener.enable.html
-rw-r--r--     11749 2016-12-04 06:07 mongodb-driver-bulkwrite.update.html
-rw-r--r--      6581 2016-12-04 06:07 imagick.orderedposterizeimage.html
-rw-r--r--      1698 2016-12-04 06:07 readline.installation.html
-rw-r--r--      2698 2016-12-04 06:08 migration5.cli-cgi.html
-rw-r--r--      1335 2016-12-04 06:08 spl.configuration.html
-rw-r--r--      3162 2016-12-04 06:07 function.enchant-broker-free.html
-rw-r--r--      4024 2016-12-04 06:07 function.ingres-num-fields.html
-rw-r--r--      3765 2016-12-04 06:07 function.readline-callback-handler-remove.html
-rw-r--r--      2734 2016-12-04 06:07 imagick.removeimageprofile.html
-rw-r--r--      5532 2016-12-04 06:07 function.openssl-pkcs12-read.html
-rw-r--r--      7584 2016-12-04 06:07 function.iconv.html
-rw-r--r--      4241 2016-12-04 06:08 refs.webservice.html
-rw-r--r--      5010 2016-12-04 06:08 function.snmp-set-enum-print.html
-rw-r--r--      5901 2016-12-04 06:08 splfileobject.getflags.html
-rw-r--r--      5752 2016-12-04 06:08 function.snmp2-getnext.html
-rw-r--r--      4940 2016-12-04 06:08 sphinxclient.query.html
-rw-r--r--      3003 2016-12-04 06:08 recursiveiteratoriterator.enditeration.html
-rw-r--r--     12308 2016-12-04 06:07 function.maxdb-fetch-row.html
-rw-r--r--      1531 2016-12-04 06:08 spl.installation.html
-rw-r--r--     39608 2016-12-04 06:07 function.db2-connect.html
-rw-r--r--      6151 2016-12-04 06:08 function.socket-create-listen.html
-rw-r--r--      3416 2016-12-04 06:08 internals2.counter.function.counter-get-meta.html
-rw-r--r--      2344 2016-12-04 06:07 security.cgi-bin.default.html
-rw-r--r--      4099 2016-12-04 06:08 function.yp-order.html
-rw-r--r--      6165 2016-12-04 06:08 quickhashintstringhash.delete.html
-rw-r--r--      3497 2016-12-04 06:07 function.enchant-dict-store-replacement.html
-rw-r--r--      2165 2016-12-04 06:08 taint.installation.html
-rw-r--r--     10810 2016-12-04 06:08 solrclient.adddocuments.html
-rw-r--r--      2891 2016-12-04 06:08 solrquery.settermssort.html
-rw-r--r--      2836 2016-12-04 06:07 function.ifx-create-char.html
-rw-r--r--     14499 2016-12-04 06:07 mysqli-stmt.data-seek.html
-rw-r--r--      3411 2016-12-04 06:07 function.ncurses-isendwin.html
-rw-r--r--      5251 2016-12-04 06:08 function.shmop-read.html
-rw-r--r--      2924 2016-12-04 06:08 sdo-das-changesummary.islogging.html
-rw-r--r--      2421 2016-12-04 06:07 weakmap.valid.html
-rw-r--r--      5255 2016-12-04 06:08 soapclient.getlastresponse.html
-rw-r--r--      2561 2016-12-04 06:07 mysqlnd-mux.sharing_connections.html
-rw-r--r--      2212 2016-12-04 06:08 ui-controls-grid.ispadded.html
-rw-r--r--      3397 2016-12-04 06:08 sdo-das-changesummary.getoldcontainer.html
-rw-r--r--      2540 2016-12-04 06:08 function.pdf-begin-pattern.html
-rw-r--r--      6930 2016-12-04 06:08 ds-sequence.get.html
-rw-r--r--      8149 2016-12-04 06:07 function.mysql-num-rows.html
-rw-r--r--      2818 2016-12-04 06:07 imagick.setimageinterlacescheme.html
-rw-r--r--      5087 2016-12-04 06:08 function.end.html
-rw-r--r--      6167 2016-12-04 06:08 class.outofrangeexception.html
-rw-r--r--      3267 2016-12-04 06:07 function.bind-textdomain-codeset.html
-rw-r--r--      3070 2016-12-04 06:07 security.database.html
-rw-r--r--      8465 2016-12-04 06:08 class.evfork.html
-rw-r--r--      5828 2016-12-04 06:08 class.ui-draw-brush-radialgradient.html
-rw-r--r--      7654 2016-12-04 06:07 mongodb-bson-unserializable.bsonunserialize.html
-rw-r--r--      4972 2016-12-04 06:08 reflectionfunction.tostring.html
-rw-r--r--      5833 2016-12-04 06:08 reference.pcre.pattern.posix.html
-rw-r--r--      2525 2016-12-04 06:08 yaf-loader.getlocalnamespace.html
-rw-r--r--      1673 2016-12-04 06:07 blenc.constants.html
-rw-r--r--      3796 2016-12-04 06:08 function.fann-descale-train.html
-rw-r--r--      3206 2016-12-04 06:07 function.trader-adx.html
-rw-r--r--      3651 2016-12-04 06:08 function.fann-num-input-train-data.html
-rw-r--r--     12035 2016-12-04 06:08 migration52.functions.html
-rw-r--r--      2968 2016-12-04 06:07 function.stats-dens-gamma.html
-rw-r--r--      3661 2016-12-04 06:08 function.yaz-element.html
-rw-r--r--      2079 2016-12-04 06:08 function.msession-destroy.html
-rw-r--r--     11475 2016-12-04 06:07 function.maxdb-fetch-lengths.html
-rw-r--r--     22360 2016-12-04 06:08 class.domnode.html
-rw-r--r--      1991 2016-12-04 06:08 hwapi.configuration.html
-rw-r--r--      7899 2016-12-04 06:08 ds-sequence.sort.html
-rw-r--r--      2754 2016-12-04 06:08 function.fann-destroy.html
-rw-r--r--      1314 2016-12-04 06:07 xdiff.resources.html
-rw-r--r--      2554 2016-12-04 06:07 imagickdraw.pushdefs.html
-rw-r--r--      6482 2016-12-04 06:08 varnish.example.admin.html
-rw-r--r--      1790 2016-12-04 06:08 json.installation.html
-rw-r--r--     15951 2016-12-04 06:07 function.exif-read-data.html
-rw-r--r--     24519 2016-12-04 06:07 function.mail.html
-rw-r--r--     13640 2016-12-04 06:07 dateperiod.construct.html
-rw-r--r--      4019 2016-12-04 06:07 function.fdf-set-flags.html
-rw-r--r--      3814 2016-12-04 06:07 gmp.constants.html
-rw-r--r--      3331 2016-12-04 06:07 gmagick.profileimage.html
-rw-r--r--      6254 2016-12-04 06:07 intro.mysqlnd-mux.html
-rw-r--r--      2614 2016-12-04 06:08 filteriterator.getinneriterator.html
-rw-r--r--      5665 2016-12-04 06:07 function.pspell-config-personal.html
-rw-r--r--     11803 2016-12-04 06:08 ref.array.html
-rw-r--r--      1307 2016-12-04 06:08 ssh2.resources.html
-rw-r--r--      3882 2016-12-04 06:08 function.fann-set-rprop-delta-zero.html
-rw-r--r--      3542 2016-12-04 06:07 function.stats-cdf-noncentral-chisquare.html
-rw-r--r--      3377 2016-12-04 06:07 gmagickdraw.line.html
-rw-r--r--      2289 2016-12-04 06:08 function.stream-bucket-append.html
-rw-r--r--      2178 2016-12-04 06:08 function.set-socket-blocking.html
-rw-r--r--      2888 2016-12-04 06:07 imagick.getresource.html
-rw-r--r--      3216 2016-12-04 06:08 harupage.getdash.html
-rw-r--r--      1300 2016-12-04 06:08 sam.resources.html
-rw-r--r--      4382 2016-12-04 06:07 function.mb-ereg-search-getregs.html
-rw-r--r--      2310 2016-12-04 06:08 solrpingresponse.construct.html
-rw-r--r--      4325 2016-12-04 06:08 function.fann-save.html
-rw-r--r--      2375 2016-12-04 06:08 swftextfield.setpadding.html
-rw-r--r--      8005 2016-12-04 06:07 rararchive.issolid.html
-rw-r--r--      9739 2016-12-04 06:08 reflectionclass.getmethods.html
-rw-r--r--      3526 2016-12-04 06:07 imagick.getimagechannelkurtosis.html
-rw-r--r--     13139 2016-12-04 06:08 refs.basic.other.html
-rw-r--r--     27580 2016-12-04 06:07 language.generators.syntax.html
-rw-r--r--      6575 2016-12-04 06:07 function.dbx-fetch-row.html
-rw-r--r--      4035 2016-12-04 06:08 splheap.compare.html
-rw-r--r--      3501 2016-12-04 06:08 harupage.setlinejoin.html
-rw-r--r--      5842 2016-12-04 06:08 directoryiterator.gettype.html
-rw-r--r--      6608 2016-12-04 06:08 arrayobject.exchangearray.html
-rw-r--r--      4042 2016-12-04 06:08 function.xmlwriter-end-comment.html
-rw-r--r--      2667 2016-12-04 06:07 ref.dir.html
-rw-r--r--      4811 2016-12-04 06:07 function.imap-rfc822-write-address.html
-rw-r--r--      9164 2016-12-04 06:08 fann.examples-1.html
-rw-r--r--      2427 2016-12-04 06:08 ui-controls-combo.setselected.html
-rw-r--r--     12366 2016-12-04 06:07 class.datetimeimmutable.html
-rw-r--r--      1580 2016-12-04 06:07 calendar.installation.html
-rw-r--r--      2764 2016-12-04 06:07 function.trader-add.html
-rw-r--r--      5302 2016-12-04 06:08 swish.query.html
-rw-r--r--      6397 2016-12-04 06:07 function.apcu-cache-info.html
-rw-r--r--      1482 2016-12-04 06:08 oauth.requirements.html
-rw-r--r--      4054 2016-12-04 06:08 event.settimer.html
-rw-r--r--      1509 2016-12-04 06:08 gupnp.requirements.html
-rw-r--r--      3298 2016-12-04 06:07 function.trader-cdlsticksandwich.html
-rw-r--r--      1699 2016-12-04 06:07 install.windows.tools.html
-rw-r--r--      9968 2016-12-04 06:07 mysqlnd.plugin.developing.html
-rw-r--r--      3698 2016-12-04 06:08 internals2.counter.counter-class.construct.html
-rw-r--r--      4681 2016-12-04 06:08 pthreads.constants.html
-rw-r--r--      6055 2016-12-04 06:08 arrayobject.setiteratorclass.html
-rw-r--r--      3403 2016-12-04 06:07 function.newt-checkbox.html
-rw-r--r--      3300 2016-12-04 06:07 function.ifx-update-char.html
-rw-r--r--      3323 2016-12-04 06:07 language.operators.string.html
-rw-r--r--      1537 2016-12-04 06:08 gearman.setup.html
-rw-r--r--      1334 2016-12-04 06:08 yaml.resources.html
-rw-r--r--      4428 2016-12-04 06:07 function.cairo-font-face-status.html
-rw-r--r--      4186 2016-12-04 06:07 function.xdiff-string-diff-binary.html
-rw-r--r--      4157 2016-12-04 06:08 sessionhandler.destroy.html
-rw-r--r--      3371 2016-12-04 06:07 function.sqlite-has-more.html
-rw-r--r--      5190 2016-12-04 06:08 function.ftp-get-option.html
-rw-r--r--      2706 2016-12-04 06:08 function.svn-fs-begin-txn2.html
-rw-r--r--      5960 2016-12-04 06:07 cairocontext.masksurface.html
-rw-r--r--      2266 2016-12-04 06:08 function.msession-set-array.html
-rw-r--r--      2571 2016-12-04 06:08 zmqcontext.ispersistent.html
-rw-r--r--      3933 2016-12-04 06:07 mysqli.set-local-infile-default.html
-rw-r--r--      8549 2016-12-04 06:07 function.pg-lo-create.html
-rw-r--r--      5348 2016-12-04 06:08 reflectionparameter.hastype.html
-rw-r--r--      2986 2016-12-04 06:07 gmagick.rollimage.html
-rw-r--r--      5606 2016-12-04 06:08 function.ftp-connect.html
-rw-r--r--      5142 2016-12-04 06:07 function.imagecolordeallocate.html
-rw-r--r--      1315 2016-12-04 06:08 iisfunc.requirements.html
-rw-r--r--      4242 2016-12-04 06:07 mongoinsertbatch.construct.html
-rw-r--r--      2900 2016-12-04 06:08 sphinxclient.getlastwarning.html
-rw-r--r--      1303 2016-12-04 06:08 svn.resources.html
-rw-r--r--      7998 2016-12-04 06:07 pdostatement.closecursor.html
-rw-r--r--      3779 2016-12-04 06:08 swfmovie.setbackground.html
-rw-r--r--      3895 2016-12-04 06:08 threaded.extend.html
-rw-r--r--      7373 2016-12-04 06:07 pharfileinfo.getcompressedsize.html
-rw-r--r--      8798 2016-12-04 06:07 function.imagepolygon.html
-rw-r--r--      2466 2016-12-04 06:07 function.stats-rand-gen-int.html
-rw-r--r--      3404 2016-12-04 06:08 gearmanworker.removeoptions.html
-rw-r--r--      5583 2016-12-04 06:08 solrdismaxquery.setbigramphrasefields.html
-rw-r--r--      2526 2016-12-04 06:08 swftext.getutf8width.html
-rw-r--r--      6048 2016-12-04 06:07 imagick.clutimage.html
-rw-r--r--      3811 2016-12-04 06:07 tokyotyranttable.add.html
-rw-r--r--      1279 2016-12-04 06:08 ftp.examples.html
-rw-r--r--      4681 2016-12-04 06:08 class.ui-draw-text-font.html
-rw-r--r--      6851 2016-12-04 06:07 function.pg-lo-close.html
-rw-r--r--     28543 2016-12-04 06:07 mongodb.command.html
-rw-r--r--     24845 2016-12-04 06:08 extensions.membership.html
-rw-r--r--      3460 2016-12-04 06:07 phar.fileformat.phar.html
-rw-r--r--      7350 2016-12-04 06:08 reflectionmethod.getmodifiers.html
-rw-r--r--      3273 2016-12-04 06:08 function.gupnp-control-point-new.html
-rw-r--r--      2475 2016-12-04 06:07 datetimeimmutable.settimestamp.html
-rw-r--r--      2818 2016-12-04 06:08 class.swffontchar.html
-rw-r--r--     27703 2016-12-04 06:07 mysqlnduhconnection.getstatistics.html
-rw-r--r--      7270 2016-12-04 06:08 quickhashintstringhash.update.html
-rw-r--r--      4412 2016-12-04 06:08 function.fann-get-cascade-activation-functions.html
-rw-r--r--      1374 2016-12-04 06:08 net-gopher.configuration.html
-rw-r--r--      7341 2016-12-04 06:08 ds-deque.slice.html
-rw-r--r--      2472 2016-12-04 06:07 mysqli-warning.next.html
-rw-r--r--      2650 2016-12-04 06:07 function.trader-ema.html
-rw-r--r--      8035 2016-12-04 06:08 quickhashstringinthash.loadfromstring.html
-rw-r--r--     16380 2016-12-04 06:07 function.mysql-real-escape-string.html
-rw-r--r--     11779 2016-12-04 06:07 mysqlnd-qc.pattern-based-caching.html
-rw-r--r--      2716 2016-12-04 06:08 gearmanworker.geterrno.html
-rw-r--r--      2519 2016-12-04 06:08 yaf-loader.clearlocalnamespace.html
-rw-r--r--      7203 2016-12-04 06:08 function.ignore-user-abort.html
-rw-r--r--      7952 2016-12-04 06:07 mongodb-driver-readconcern.bsonserialize.html
-rw-r--r--      1535 2016-12-04 06:08 intro.shmop.html
-rw-r--r--      7762 2016-12-04 06:08 snmp.constants.html
-rw-r--r--      4299 2016-12-04 06:07 function.px-update-record.html
-rw-r--r--      3928 2016-12-04 06:08 oauth.settoken.html
-rw-r--r--      8246 2016-12-04 06:07 function.sqlsrv-num-rows.html
-rw-r--r--      4073 2016-12-04 06:07 function.maxdb-real-query.html
-rw-r--r--      2628 2016-12-04 06:07 datetimeimmutable.settime.html
-rw-r--r--      4219 2016-12-04 06:08 swfbutton.addaction.html
-rw-r--r--      2969 2016-12-04 06:07 function.imap-qprint.html
-rw-r--r--      4285 2016-12-04 06:08 function.posix-ctermid.html
-rw-r--r--      3209 2016-12-04 06:08 evperiodic.set.html
-rw-r--r--      2358 2016-12-04 06:08 internals2.buildsys.html
-rw-r--r--      2404 2016-12-04 06:08 splfixedarray.rewind.html
-rw-r--r--      9072 2016-12-04 06:07 dba.installation.html
-rw-r--r--      1301 2016-12-04 06:08 array.requirements.html
-rw-r--r--      3655 2016-12-04 06:07 function.rad2deg.html
-rw-r--r--      7975 2016-12-04 06:08 book.eio.html
-rw-r--r--     12710 2016-12-04 06:08 eventhttpconnection.makerequest.html
-rw-r--r--      4702 2016-12-04 06:08 function.vsprintf.html
-rw-r--r--      2484 2016-12-04 06:07 language.references.unset.html
-rw-r--r--      1969 2016-12-04 06:08 intro.array.html
-rw-r--r--     12039 2016-12-04 06:08 session.upload-progress.html
-rw-r--r--      2780 2016-12-04 06:08 swftextfield.addchars.html
-rw-r--r--      5183 2016-12-04 06:08 soapclient.getfunctions.html
-rw-r--r--      1570 2016-12-04 06:08 simplexml.setup.html
-rw-r--r--      1525 2016-12-04 06:08 stomp.requirements.html
-rw-r--r--      4534 2016-12-04 06:08 sessionhandler.read.html
-rw-r--r--      4297 2016-12-04 06:08 internals2.opcodes.brk.html
-rw-r--r--      7868 2016-12-04 06:08 function.eio-statvfs.html
-rw-r--r--      2375 2016-12-04 06:08 ref.nis.html
-rw-r--r--      2364 2016-12-04 06:07 class.gmp.html
-rw-r--r--      4533 2016-12-04 06:07 datetimeimmutable.createfrommutable.html
-rw-r--r--      5123 2016-12-04 06:07 function.radius-create-request.html
-rw-r--r--     10921 2016-12-04 06:07 numberformatter.getattribute.html
-rw-r--r--      2891 2016-12-04 06:08 recursiveiteratoriterator.getinneriterator.html
-rw-r--r--     11459 2016-12-04 06:07 mongoresultexception.getdocument.html
-rw-r--r--      4869 2016-12-04 06:08 memcached.deletemulti.html
-rw-r--r--      5552 2016-12-04 06:08 class.ui-control.html
-rw-r--r--      2203 2016-12-04 06:08 function.ui-quit.html
-rw-r--r--      2412 2016-12-04 06:08 varnishadmin.getparams.html
-rw-r--r--      9543 2016-12-04 06:07 imagickdraw.polyline.html
-rw-r--r--     21139 2016-12-04 06:08 internals2.opcodes.html
-rw-r--r--      3316 2016-12-04 06:07 function.dbplus-restorepos.html
-rw-r--r--      2645 2016-12-04 06:08 reflector.export.html
-rw-r--r--      3499 2016-12-04 06:07 class.cairolinejoin.html
-rw-r--r--      5600 2016-12-04 06:07 function.mysqli-connect.html
-rw-r--r--      2661 2016-12-04 06:07 ref.kadm5.html
-rw-r--r--     12677 2016-12-04 06:08 quickhash.examples.html
-rw-r--r--      2418 2016-12-04 06:08 judy.offsetunset.html
-rw-r--r--      2567 2016-12-04 06:08 book.spl-types.html
-rw-r--r--     10026 2016-12-04 06:08 function.strspn.html
-rw-r--r--      7934 2016-12-04 06:08 sca.examples.proxies.html
-rw-r--r--      3077 2016-12-04 06:08 reflectionfunctionabstract.clone.html
-rw-r--r--      3328 2016-12-04 06:08 solrinputdocument.merge.html
-rw-r--r--      2265 2016-12-04 06:08 book.net-gopher.html
-rw-r--r--      3134 2016-12-04 06:07 gmagick.setsize.html
-rw-r--r--      5728 2016-12-04 06:07 mysqlinfo.terminology.html
-rw-r--r--      2383 2016-12-04 06:08 function.pdf-close-pdi.html
-rw-r--r--      9138 2016-12-04 06:08 yaf-controller-abstract.forward.html
-rw-r--r--      7382 2016-12-04 06:08 yaf-action-abstract.execute.html
-rw-r--r--     31014 2016-12-04 06:08 ref.sdo.html
-rw-r--r--      3185 2016-12-04 06:07 function.jdtojulian.html
-rw-r--r--      4939 2016-12-04 06:07 cairocontext.pushgroup.html
-rw-r--r--     11292 2016-12-04 06:07 mysqlinfo.concepts.charset.html
-rw-r--r--      2515 2016-12-04 06:07 function.newt-form-get-current.html
-rw-r--r--      1634 2016-12-04 06:07 intro.cyrus.html
-rw-r--r--      1340 2016-12-04 06:07 inotify.requirements.html
-rw-r--r--     10883 2016-12-04 06:07 imagickdraw.setviewbox.html
-rw-r--r--      2871 2016-12-04 06:08 sdo-das-setting.getpropertyindex.html
-rw-r--r--      1329 2016-12-04 06:08 tokenizer.requirements.html
-rw-r--r--      6118 2016-12-04 06:08 misc.configuration.html
-rw-r--r--      3510 2016-12-04 06:08 domelement.getattribute.html
-rw-r--r--      6612 2016-12-04 06:07 intlchar.isuuppercase.html
-rw-r--r--      6155 2016-12-04 06:08 class.outofboundsexception.html
-rw-r--r--      2200 2016-12-04 06:07 mysqlnd-qc.installation.html
-rw-r--r--      6559 2016-12-04 06:08 domdocument.createattributens.html
-rw-r--r--      3255 2016-12-04 06:07 function.trader-cdlpiercing.html
-rw-r--r--     11178 2016-12-04 06:07 function.mssql-result.html
-rw-r--r--      2552 2016-12-04 06:08 ui-menu.appendabout.html
-rw-r--r--      2632 2016-12-04 06:07 mysqlnd-ms.concepts.html
-rw-r--r--      5056 2016-12-04 06:08 domcomment.construct.html
-rw-r--r--      6388 2016-12-04 06:07 phar.getmetadata.html
-rw-r--r--      2252 2016-12-04 06:07 intro.mssql.html
-rw-r--r--      2474 2016-12-04 06:07 intliterator.current.html
-rw-r--r--     15570 2016-12-04 06:08 class.arrayobject.html
-rw-r--r--     15583 2016-12-04 06:08 function.call-user-func.html
-rw-r--r--      2991 2016-12-04 06:08 hwapi.link.html
-rw-r--r--      8761 2016-12-04 06:07 function.fbsql-fetch-array.html
-rw-r--r--      2444 2016-12-04 06:08 solrquery.getstatsfacets.html
-rw-r--r--      3204 2016-12-04 06:08 reflectionparameter.allowsnull.html
-rw-r--r--      2639 2016-12-04 06:08 ui-draw-color.construct.html
-rw-r--r--      3222 2016-12-04 06:08 hwapi.find.html
-rw-r--r--      2586 2016-12-04 06:08 harupage.getcurrentfontsize.html
-rw-r--r--      2401 2016-12-04 06:08 function.pdf-add-textflow.html
-rw-r--r--      1308 2016-12-04 06:07 openal.requirements.html
-rw-r--r--      2734 2016-12-04 06:08 yaf-view-simple.display.html
-rw-r--r--      8583 2016-12-04 06:07 intlcalendar.isequivalentto.html
-rw-r--r--      4228 2016-12-04 06:08 splfixedarray.toarray.html
-rw-r--r--      2552 2016-12-04 06:08 function.pdf-add-table-cell.html
-rw-r--r--      4106 2016-12-04 06:08 extensions.state.html
-rw-r--r--      3427 2016-12-04 06:07 function.zip-entry-compressionmethod.html
-rw-r--r--      4774 2016-12-04 06:08 eventbuffer.pullup.html
-rw-r--r--      3100 2016-12-04 06:08 solrquery.sethighlightusephrasehighlighter.html
-rw-r--r--      1841 2016-12-04 06:08 internals2.opcodes.user-opcode.html
-rw-r--r--      8129 2016-12-04 06:08 function.ftp-get.html
-rw-r--r--      1667 2016-12-04 06:08 rrd.installation.html
-rw-r--r--      5321 2016-12-04 06:07 function.fileowner.html
-rw-r--r--      9619 2016-12-04 06:08 function.yaz-scan.html
-rw-r--r--      1289 2016-12-04 06:07 msql.examples.html
-rw-r--r--     10434 2016-12-04 06:07 messageformatter.parsemessage.html
-rw-r--r--      2933 2016-12-04 06:07 function.mcrypt-enc-is-block-algorithm.html
-rw-r--r--      2269 2016-12-04 06:08 function.msession-uniq.html
-rw-r--r--      6149 2016-12-04 06:07 function.lchgrp.html
-rw-r--r--      3408 2016-12-04 06:08 filteriterator.construct.html
-rw-r--r--      7986 2016-12-04 06:07 imagickpixeliterator.setiteratorrow.html
-rw-r--r--      6586 2016-12-04 06:07 function.gmp-div-qr.html
-rw-r--r--      6635 2016-12-04 06:07 mongocursor.setreadpreference.html
-rw-r--r--      2650 2016-12-04 06:07 mongoid.getinc.html
-rw-r--r--      3426 2016-12-04 06:08 function.yaz-error.html
-rw-r--r--      2672 2016-12-04 06:08 ref.session-pgsql.html
-rw-r--r--      6936 2016-12-04 06:07 function.pg-field-type-oid.html
-rw-r--r--      9048 2016-12-04 06:08 book.sdo.html
-rw-r--r--      5375 2016-12-04 06:08 yaf-dispatcher.registerplugin.html
-rw-r--r--      3386 2016-12-04 06:08 oauth.disabledebug.html
-rw-r--r--      5350 2016-12-04 06:07 cairocontext.pushgroupwithcontent.html
-rw-r--r--      7233 2016-12-04 06:08 simplexmlelement.asxml.html
-rw-r--r--      3385 2016-12-04 06:08 reflectionproperty.isprivate.html
-rw-r--r--     18113 2016-12-04 06:08 function.array-column.html
-rw-r--r--      3853 2016-12-04 06:08 function.variant-not.html
-rw-r--r--      4502 2016-12-04 06:07 errorexception.getseverity.html
-rw-r--r--      3826 2016-12-04 06:07 mysqli.reap-async-query.html
-rw-r--r--      4754 2016-12-04 06:08 stomp.configuration.html
-rw-r--r--     37205 2016-12-04 06:07 apc.configuration.html
-rw-r--r--      3022 2016-12-04 06:08 class.yaf-exception-loadfailed-action.html
-rw-r--r--      3983 2016-12-04 06:08 domelement.setattributenodens.html
-rw-r--r--      3443 2016-12-04 06:07 function.stats-stat-noncentral-t.html
-rw-r--r--      5633 2016-12-04 06:07 function.gmp-scan1.html
-rw-r--r--      2040 2016-12-04 06:08 function.pdf-end-pattern.html
-rw-r--r--      2921 2016-12-04 06:07 mongoclient.connect.html
-rw-r--r--      4374 2016-12-04 06:08 yar-client.call.html
-rw-r--r--      2755 2016-12-04 06:08 recursiveiteratoriterator.valid.html
-rw-r--r--      2535 2016-12-04 06:08 ref.pcre.html
-rw-r--r--      3421 2016-12-04 06:08 internals2.opcodes.new.html
-rw-r--r--      2392 2016-12-04 06:08 cachingiterator.key.html
-rw-r--r--      4844 2016-12-04 06:07 paradox.constants.html
-rw-r--r--      3672 2016-12-04 06:08 domnode.issupported.html
-rw-r--r--      8977 2016-12-04 06:07 intlcalendar.getminimaldaysinfirstweek.html
-rw-r--r--      4850 2016-12-04 06:07 function.readline.html
-rw-r--r--      4093 2016-12-04 06:07 mongo.tutorial.insert.multiple.html
-rw-r--r--      9889 2016-12-04 06:07 function.mysqlnd-ms-get-last-used-connection.html
-rw-r--r--      1673 2016-12-04 06:08 intro.xmlreader.html
-rw-r--r--      3421 2016-12-04 06:08 function.yp-get-default-domain.html
-rw-r--r--      2657 2016-12-04 06:07 function.vpopmail-set-user-quota.html
-rw-r--r--      1490 2016-12-04 06:07 zip.setup.html
-rw-r--r--      3090 2016-12-04 06:08 migration52.errorrep.html
-rw-r--r--     22932 2016-12-04 06:07 mysqlnduhconnection.simplecommand.html
-rw-r--r--      3491 2016-12-04 06:08 function.pcntl-wifstopped.html
-rw-r--r--      2442 2016-12-04 06:08 solrobject.getpropertynames.html
-rw-r--r--      4072 2016-12-04 06:08 function.ldap-mod-del.html
-rw-r--r--      1375 2016-12-04 06:07 gmagick.configuration.html
-rw-r--r--      2318 2016-12-04 06:08 ui-controls-group.settitle.html
-rw-r--r--      4322 2016-12-04 06:08 book.misc.html
-rw-r--r--      7126 2016-12-04 06:07 datetimezone.listidentifiers.html
-rw-r--r--      2410 2016-12-04 06:08 yaf-session.wakeup.html
-rw-r--r--      2395 2016-12-04 06:08 migration51.html
-rw-r--r--      2995 2016-12-04 06:08 function.rrd-graph.html
-rw-r--r--      7924 2016-12-04 06:07 function.oci-num-fields.html
-rw-r--r--      2544 2016-12-04 06:08 taint.detail.untaint.html
-rw-r--r--      4456 2016-12-04 06:07 function.dbplus-rcreate.html
-rw-r--r--      3072 2016-12-04 06:08 splobserver.update.html
-rw-r--r--      7226 2016-12-04 06:08 quickhashinthash.loadfromstring.html
-rw-r--r--      6547 2016-12-04 06:07 function.dir.html
-rw-r--r--      6412 2016-12-04 06:08 function.ctype-upper.html
-rw-r--r--      2667 2016-12-04 06:08 solrclientexception.getinternalinfo.html
-rw-r--r--      8493 2016-12-04 06:08 ds-map.ksort.html
-rw-r--r--      2699 2016-12-04 06:08 solrquery.removefilterquery.html
-rw-r--r--      3067 2016-12-04 06:08 solrillegaloperationexception.getinternalinfo.html
-rw-r--r--      2379 2016-12-04 06:08 swfdisplayitem.getyscale.html
-rw-r--r--      2951 2016-12-04 06:08 var.configuration.html
-rw-r--r--     10218 2016-12-04 06:08 class.varnishadmin.html
-rw-r--r--      3606 2016-12-04 06:07 function.sybase-num-fields.html
-rw-r--r--      7223 2016-12-04 06:07 function.debug-print-backtrace.html
-rw-r--r--      3109 2016-12-04 06:08 domxpath.registernamespace.html
-rw-r--r--      3544 2016-12-04 06:08 eventbufferevent.enable.html
-rw-r--r--      3526 2016-12-04 06:07 sqlite3.escapestring.html
-rw-r--r--      6190 2016-12-04 06:07 function.ifx-affected-rows.html
-rw-r--r--      5612 2016-12-04 06:07 function.imagefontwidth.html
-rw-r--r--      7629 2016-12-04 06:08 function.geoip-record-by-name.html
-rw-r--r--      5984 2016-12-04 06:08 domdocument.load.html
-rw-r--r--      4345 2016-12-04 06:08 function.xmlwriter-set-indent-string.html
-rw-r--r--      5573 2016-12-04 06:08 quickhashinthash.update.html
-rw-r--r--      7759 2016-12-04 06:07 mongodb-driver-server.executecommand.html
-rw-r--r--      5401 2016-12-04 06:08 function.call-user-method.html
-rw-r--r--      2143 2016-12-04 06:08 function.pdf-setdashpattern.html
-rw-r--r--      2859 2016-12-04 06:07 weakref.valid.html
-rw-r--r--     30886 2016-12-04 06:08 migration56.new-features.html
-rw-r--r--      4717 2016-12-04 06:08 event.construct.html
-rw-r--r--      2599 2016-12-04 06:07 imagick.setfilename.html
-rw-r--r--      1518 2016-12-04 06:08 filter.setup.html
-rw-r--r--      5201 2016-12-04 06:07 mongodb-bson-binary.construct.html
-rw-r--r--      2776 2016-12-04 06:08 spldoublylinkedlist.pop.html
-rw-r--r--      2733 2016-12-04 06:08 function.pdf-set-border-color.html
-rw-r--r--      9913 2016-12-04 06:07 function.mysql-result.html
-rw-r--r--      4172 2016-12-04 06:07 imagick.despeckleimage.html
-rw-r--r--      4564 2016-12-04 06:07 imagick.blueshiftimage.html
-rw-r--r--      3191 2016-12-04 06:07 function.is-finite.html
-rw-r--r--      6958 2016-12-04 06:08 function.count-chars.html
-rw-r--r--     16516 2016-12-04 06:08 class.oauth.html
-rw-r--r--      3023 2016-12-04 06:08 recursiveiteratoriterator.beginiteration.html
-rw-r--r--      3060 2016-12-04 06:08 eventbuffer.freeze.html
-rw-r--r--      3528 2016-12-04 06:08 function.snmp-get-quick-print.html
-rw-r--r--      2118 2016-12-04 06:07 function.dba-list.html
-rw-r--r--      3611 2016-12-04 06:07 function.ibase-blob-cancel.html
-rw-r--r--      6705 2016-12-04 06:08 function.eio-fallocate.html
-rw-r--r--      2335 2016-12-04 06:07 book.spplus.html
-rw-r--r--      9077 2016-12-04 06:08 memcached.set.html
-rw-r--r--      2493 2016-12-04 06:08 solrresponse.getdigestedresponse.html
-rw-r--r--      2330 2016-12-04 06:07 function.radius-strerror.html
-rw-r--r--      2780 2016-12-04 06:07 function.vpopmail-passwd.html
-rw-r--r--      2516 2016-12-04 06:08 hwapi.object-count.html
-rw-r--r--      2834 2016-12-04 06:07 apcuiterator.rewind.html
-rw-r--r--      4599 2016-12-04 06:08 evembed.createstopped.html
-rw-r--r--      7226 2016-12-04 06:08 memcache.decrement.html
-rw-r--r--      4500 2016-12-04 06:08 xsltprocessor.construct.html
-rw-r--r--      2569 2016-12-04 06:08 sdo-das-xml-document.getrootelementname.html
-rw-r--r--      1939 2016-12-04 06:07 ref.fileinfo.html
-rw-r--r--      4791 2016-12-04 06:07 function.cairo-font-options-set-antialias.html
-rw-r--r--      2488 2016-12-04 06:08 expect.installation.html
-rw-r--r--      2449 2016-12-04 06:07 function.trader-ht-sine.html
-rw-r--r--      6451 2016-12-04 06:08 function.getservbyname.html
-rw-r--r--      6056 2016-12-04 06:08 ds-map.apply.html
-rw-r--r--      5063 2016-12-04 06:07 function.px-retrieve-record.html
-rw-r--r--      7573 2016-12-04 06:07 function.pg-escape-string.html
-rw-r--r--      4695 2016-12-04 06:07 function.cairo-pattern-set-matrix.html
-rw-r--r--      4027 2016-12-04 06:08 syncreaderwriter.readunlock.html
-rw-r--r--      5009 2016-12-04 06:07 cairocontext.glyphpath.html
-rw-r--r--      2337 2016-12-04 06:07 imagick.getimageheight.html
-rw-r--r--      3476 2016-12-04 06:08 arrayiterator.offsetget.html
-rw-r--r--      6730 2016-12-04 06:07 phar.setsignaturealgorithm.html
-rw-r--r--      5624 2016-12-04 06:08 function.snmpgetnext.html
-rw-r--r--      3677 2016-12-04 06:08 solrinputdocument.haschilddocuments.html
-rw-r--r--      2030 2016-12-04 06:08 tcpwrap.installation.html
-rw-r--r--      5161 2016-12-04 06:07 function.apd-set-session-trace-socket.html
-rw-r--r--      6389 2016-12-04 06:07 imagick.scaleimage.html
-rw-r--r--      3653 2016-12-04 06:08 reflectionextension.tostring.html
-rw-r--r--      2836 2016-12-04 06:07 function.newt-checkbox-tree-get-current.html
-rw-r--r--      3987 2016-12-04 06:07 pharfileinfo.hasmetadata.html
-rw-r--r--      3266 2016-12-04 06:07 apcuiterator.gettotalsize.html
-rw-r--r--      2574 2016-12-04 06:08 function.oauth-urlencode.html
-rw-r--r--      4910 2016-12-04 06:07 function.cairo-ps-surface-set-size.html
-rw-r--r--      3254 2016-12-04 06:08 reflectionparameter.ispassedbyreference.html
-rw-r--r--      3961 2016-12-04 06:07 harudoc.setpassword.html
-rw-r--r--      4480 2016-12-04 06:08 harufont.measuretext.html
-rw-r--r--      4652 2016-12-04 06:07 cairoimagesurface.getwidth.html
-rw-r--r--      2951 2016-12-04 06:07 function.ibase-commit.html
-rw-r--r--      6136 2016-12-04 06:08 ref.com.html
-rw-r--r--      1315 2016-12-04 06:07 filepro.requirements.html
-rw-r--r--      2789 2016-12-04 06:07 mongocursor.key.html
-rw-r--r--      1328 2016-12-04 06:08 session.resources.html
-rw-r--r--      2590 2016-12-04 06:08 yaf-response-abstract.construct.html
-rw-r--r--      7607 2016-12-04 06:07 cairosvgsurface.getversions.html
-rw-r--r--      1300 2016-12-04 06:08 sca.resources.html
-rw-r--r--      1973 2016-12-04 06:08 function.pdf-get-errmsg.html
-rw-r--r--      2116 2016-12-04 06:08 function.msession-unlock.html
-rw-r--r--      5486 2016-12-04 06:08 ds-deque.sum.html
-rw-r--r--      3360 2016-12-04 06:07 gmagick.embossimage.html
-rw-r--r--      1761 2016-12-04 06:08 function.is-integer.html
-rw-r--r--      1507 2016-12-04 06:08 curl.setup.html
-rw-r--r--     10809 2016-12-04 06:07 function.sqlsrv-errors.html
-rw-r--r--      2971 2016-12-04 06:07 function.unixtojd.html
-rw-r--r--      4928 2016-12-04 06:08 sca.examples.nonscascript.html
-rw-r--r--      6730 2016-12-04 06:07 imagick.adaptiveblurimage.html
-rw-r--r--      5478 2016-12-04 06:07 function.imap-getsubscribed.html
-rw-r--r--      2335 2016-12-04 06:07 mongo.trouble.html
-rw-r--r--      2981 2016-12-04 06:08 splfileobject.haschildren.html
-rw-r--r--      2402 2016-12-04 06:07 function.ncurses-standout.html
-rw-r--r--      7725 2016-12-04 06:07 function.touch.html
-rw-r--r--      3582 2016-12-04 06:07 function.msql-create-db.html
-rw-r--r--      2157 2016-12-04 06:07 directory.read.html
-rw-r--r--      5206 2016-12-04 06:08 splobjectstorage.addall.html
-rw-r--r--      3929 2016-12-04 06:07 function.mcrypt-ecb.html
-rw-r--r--      3688 2016-12-04 06:07 cairoscaledfont.getctm.html
-rw-r--r--      3120 2016-12-04 06:07 imagickdraw.settextencoding.html
-rw-r--r--     14324 2016-12-04 06:08 appendices.html
-rw-r--r--      1531 2016-12-04 06:08 expect.resources.html
-rw-r--r--      8971 2016-12-04 06:07 function.imagegrabwindow.html
-rw-r--r--      2410 2016-12-04 06:08 ui-controls-multilineentry.isreadonly.html
-rw-r--r--      1470 2016-12-04 06:08 fam.requirements.html
-rw-r--r--      1238 2016-12-04 06:08 apache.constants.html
-rw-r--r--      2870 2016-12-04 06:08 internals2.opcodes.assign-sub.html
-rw-r--r--      5641 2016-12-04 06:08 yaf-response-abstract.prependbody.html
-rw-r--r--      3870 2016-12-04 06:07 gmagick.shearimage.html
-rw-r--r--      5900 2016-12-04 06:08 win32service.examples.html
-rw-r--r--      9400 2016-12-04 06:07 mysqlnduhconnection.geterrornumber.html
-rw-r--r--      2257 2016-12-04 06:07 generator.current.html
-rw-r--r--      6880 2016-12-04 06:07 function.cubrid-save-to-glo.html
-rw-r--r--      8444 2016-12-04 06:07 locale.getdisplayvariant.html
-rw-r--r--      1738 2016-12-04 06:07 function.gzputs.html
-rw-r--r--      3318 2016-12-04 06:07 function.trader-cdlidentical3crows.html
-rw-r--r--      2198 2016-12-04 06:08 ui-draw-matrix.isinvertible.html
-rw-r--r--      3152 2016-12-04 06:08 hwapi.objectbyanchor.html
-rw-r--r--      1307 2016-12-04 06:08 tidy.resources.html
-rw-r--r--      8941 2016-12-04 06:08 domdocument.importnode.html
-rw-r--r--      2661 2016-12-04 06:07 mongocursorexception.gethost.html
-rw-r--r--      2509 2016-12-04 06:08 rrdgraph.save.html
-rw-r--r--      4387 2016-12-04 06:08 function.xmlwriter-write-cdata.html
-rw-r--r--      2367 2016-12-04 06:08 ui-window.setsize.html
-rw-r--r--      2164 2016-12-04 06:07 function.maxdb-disable-rpl-parse.html
-rw-r--r--      5634 2016-12-04 06:08 function.variant-imp.html
-rw-r--r--      4611 2016-12-04 06:07 mysqli-stmt.next-result.html
-rw-r--r--     15259 2016-12-04 06:08 solrinputdocument.addchilddocuments.html
-rw-r--r--      4539 2016-12-04 06:08 book.pcntl.html
-rw-r--r--     11245 2016-12-04 06:08 class.quickhashstringinthash.html
-rw-r--r--      4379 2016-12-04 06:07 function.gnupg-cleardecryptkeys.html
-rw-r--r--      2469 2016-12-04 06:07 id3v2tag.addframe.html
-rw-r--r--      2913 2016-12-04 06:08 mqseries.configure.html
-rw-r--r--      7095 2016-12-04 06:08 function.udm-cat-path.html
-rw-r--r--      8785 2016-12-04 06:07 imagickdraw.push.html
-rw-r--r--      3534 2016-12-04 06:07 function.apc-compile-file.html
-rw-r--r--      3073 2016-12-04 06:08 sphinxclient.setconnecttimeout.html
-rw-r--r--      2653 2016-12-04 06:08 hwapi.object-attreditable.html
-rw-r--r--      6360 2016-12-04 06:08 solrdismaxquery.removetrigramphrasefield.html
-rw-r--r--      6947 2016-12-04 06:08 class.snmpexception.html
-rw-r--r--     11891 2016-12-04 06:08 class.evio.html
-rw-r--r--      6793 2016-12-04 06:08 migration52.classes.html
-rw-r--r--      6236 2016-12-04 06:08 function.time-sleep-until.html
-rw-r--r--     12341 2016-12-04 06:07 mysqli-stmt.num-rows.html
-rw-r--r--      2564 2016-12-04 06:08 taint.detail.basic.html
-rw-r--r--      1367 2016-12-04 06:08 parsekit.configuration.html
-rw-r--r--      6953 2016-12-04 06:08 reflectionclass.innamespace.html
-rw-r--r--      5885 2016-12-04 06:07 function.fbsql-next-result.html
-rw-r--r--      4218 2016-12-04 06:08 ds-vector.reversed.html
-rw-r--r--      7111 2016-12-04 06:08 com.configuration.html
-rw-r--r--      3636 2016-12-04 06:08 splpriorityqueue.compare.html
-rw-r--r--      2956 2016-12-04 06:07 phar.getversion.html
-rw-r--r--      4958 2016-12-04 06:08 reflectionclass.getextension.html
-rw-r--r--      2261 2016-12-04 06:08 function.pdf-get-minorversion.html
-rw-r--r--      2594 2016-12-04 06:07 function.mysqli-master-query.html
-rw-r--r--      6179 2016-12-04 06:07 function.dbase-numrecords.html
-rw-r--r--      2715 2016-12-04 06:08 harupage.getcurrentpos.html
-rw-r--r--      4517 2016-12-04 06:07 function.inotify-read.html
-rw-r--r--      3619 2016-12-04 06:08 xmlreader.movetofirstattribute.html
-rw-r--r--      2615 2016-12-04 06:08 soapvar.construct.html
-rw-r--r--      4779 2016-12-04 06:08 splfileobject.getmaxlinelen.html
-rw-r--r--      9283 2016-12-04 06:08 class.evidle.html
-rw-r--r--     10096 2016-12-04 06:07 phardata.converttodata.html
-rw-r--r--      1273 2016-12-04 06:07 blenc.resources.html
-rw-r--r--      4829 2016-12-04 06:08 function.eio-unlink.html
-rw-r--r--      1314 2016-12-04 06:07 iconv.resources.html
-rw-r--r--      1537 2016-12-04 06:08 hwapi.setup.html
-rw-r--r--      5486 2016-12-04 06:08 domattr.construct.html
-rw-r--r--      5408 2016-12-04 06:08 ds-sequence.apply.html
-rw-r--r--      2395 2016-12-04 06:08 ui-control.gettoplevel.html
-rw-r--r--      2026 2016-12-04 06:07 function.date-create-immutable.html
-rw-r--r--      4249 2016-12-04 06:08 soapserver.setclass.html
-rw-r--r--      5927 2016-12-04 06:07 intro.mysqlnd-memcache.html
-rw-r--r--     48510 2016-12-04 06:08 parsekit.constants.html
-rw-r--r--     39768 2016-12-04 06:08 class.domdocument.html
-rw-r--r--      1271 2016-12-04 06:07 bcompiler.constants.html
-rw-r--r--     13135 2016-12-04 06:08 function.strpos.html
-rw-r--r--      6478 2016-12-04 06:08 memcache.delete.html
-rw-r--r--      3759 2016-12-04 06:07 security.hiding.html
-rw-r--r--     17758 2016-12-04 06:07 mysqli-stmt.get-result.html
-rw-r--r--      7150 2016-12-04 06:08 oauthprovider.construct.html
-rw-r--r--      2907 2016-12-04 06:07 mongogridfscursor.key.html
-rw-r--r--      2747 2016-12-04 06:07 function.trader-kama.html
-rw-r--r--      3404 2016-12-04 06:08 recursivetreeiterator.setprefixpart.html
-rw-r--r--      3472 2016-12-04 06:08 xmlreader.setparserproperty.html
-rw-r--r--      3720 2016-12-04 06:07 configuration.changes.modes.html
-rw-r--r--      7457 2016-12-04 06:07 function.imagecolorresolvealpha.html
-rw-r--r--      2951 2016-12-04 06:08 quickhashintstringhash.exists.html
-rw-r--r--     12867 2016-12-04 06:08 class.seekableiterator.html
-rw-r--r--      3890 2016-12-04 06:08 sca.examples.structure.html
-rw-r--r--      5087 2016-12-04 06:08 stomp.send.html
-rw-r--r--      6366 2016-12-04 06:07 imagick.adaptivesharpenimage.html
-rw-r--r--      2138 2016-12-04 06:07 function.newt-cursor-on.html
-rw-r--r--      5194 2016-12-04 06:07 function.intl-error-name.html
-rw-r--r--      3583 2016-12-04 06:07 ref.xdiff.html
-rw-r--r--      1363 2016-12-04 06:07 enchant.configuration.html
-rw-r--r--      1517 2016-12-04 06:07 uodbc.setup.html
-rw-r--r--      2731 2016-12-04 06:08 function.fann-get-network-type.html
-rw-r--r--      5486 2016-12-04 06:07 function.cubrid-error-msg.html
-rw-r--r--      3298 2016-12-04 06:08 ui-draw-path.bezierto.html
-rw-r--r--      5516 2016-12-04 06:07 function.mb-substr-count.html
-rw-r--r--      1503 2016-12-04 06:07 ncurses.requirements.html
-rw-r--r--      3326 2016-12-04 06:08 class.yar-server.html
-rw-r--r--      5624 2016-12-04 06:07 mongoclient.getwriteconcern.html
-rw-r--r--      9761 2016-12-04 06:07 language.oop5.cloning.html
-rw-r--r--      5928 2016-12-04 06:08 function.fann-set-activation-steepness.html
-rw-r--r--      5193 2016-12-04 06:08 soapclient.setlocation.html
-rw-r--r--      2470 2016-12-04 06:08 yaf-config-ini.rewind.html
-rw-r--r--      1557 2016-12-04 06:07 readline.setup.html
-rw-r--r--      8662 2016-12-04 06:08 recursivedirectoryiterator.construct.html
-rw-r--r--      2626 2016-12-04 06:07 mongocollection.validate.html
-rw-r--r--      1468 2016-12-04 06:08 svm.setup.html
-rw-r--r--      5400 2016-12-04 06:07 function.imap-listscan.html
-rw-r--r--      5345 2016-12-04 06:07 cairocontext.setscaledfont.html
-rw-r--r--      3034 2016-12-04 06:08 eventhttprequest.gethost.html
-rw-r--r--      2857 2016-12-04 06:07 rarentry.getcrc.html
-rw-r--r--      3038 2016-12-04 06:07 imagick.setimageblueprimary.html
-rw-r--r--      3326 2016-12-04 06:08 class.swfmorph.html
-rw-r--r--      3243 2016-12-04 06:08 sdo-model-type.getbasetype.html
-rw-r--r--      2570 2016-12-04 06:08 function.rrd-lastupdate.html
-rw-r--r--     15612 2016-12-04 06:08 function.proc-open.html
-rw-r--r--     11751 2016-12-04 06:08 yaf-router.addroute.html
-rw-r--r--      2092 2016-12-04 06:07 function.ocicollsize.html
-rw-r--r--      3542 2016-12-04 06:08 function.fann-set-rprop-decrease-factor.html
-rw-r--r--      5985 2016-12-04 06:08 class.harudestination.html
-rw-r--r--     16945 2016-12-04 06:07 function.imagettftext.html
-rw-r--r--      6219 2016-12-04 06:08 splobjectstorage.offsetunset.html
-rw-r--r--      2911 2016-12-04 06:08 harupage.getwordspace.html
-rw-r--r--      2489 2016-12-04 06:08 collectable.isgarbage.html
-rw-r--r--      8922 2016-12-04 06:08 book.quickhash.html
-rw-r--r--      1398 2016-12-04 06:08 win32service.configuration.html
-rw-r--r--      1715 2016-12-04 06:07 htscanner.installation.html
-rw-r--r--      1321 2016-12-04 06:08 libxml.resources.html
-rw-r--r--      3504 2016-12-04 06:07 reserved.variables.phperrormsg.html
-rw-r--r--      5569 2016-12-04 06:08 streamwrapper.stream-seek.html
-rw-r--r--      2676 2016-12-04 06:08 function.eio-npending.html
-rw-r--r--     15359 2016-12-04 06:07 function.cubrid-connect-with-url.html
-rw-r--r--      7510 2016-12-04 06:08 recursiveregexiterator.getchildren.html
-rw-r--r--      2996 2016-12-04 06:07 function.cyrus-connect.html
-rw-r--r--      1906 2016-12-04 06:07 function.require.html
-rw-r--r--      5069 2016-12-04 06:08 gupnp-service-proxy-send-action.html
-rw-r--r--      6028 2016-12-04 06:08 class.yaf-route-simple.html
-rw-r--r--     11113 2016-12-04 06:07 function.mysqlnd-memcache-set.html
-rw-r--r--      5523 2016-12-04 06:07 cairocontext.relmoveto.html
-rw-r--r--      4952 2016-12-04 06:07 function.gmp-mod.html
-rw-r--r--      2785 2016-12-04 06:07 function.stats-stat-powersum.html
-rw-r--r--      3654 2016-12-04 06:07 function.trader-mavp.html
-rw-r--r--     10642 2016-12-04 06:08 function.eio-mknod.html
-rw-r--r--      4905 2016-12-04 06:07 function.cairo-ps-surface-create.html
-rw-r--r--      2746 2016-12-04 06:08 swftextfield.setrightmargin.html
-rw-r--r--      2951 2016-12-04 06:07 function.m-setssl-cafile.html
-rw-r--r--      7514 2016-12-04 06:07 imagick.setimageartifact.html
-rw-r--r--      8658 2016-12-04 06:07 function.cubrid-col-get.html
-rw-r--r--      2389 2016-12-04 06:07 imagickdraw.resetvectorgraphics.html
-rw-r--r--     16756 2016-12-04 06:08 function.eio-readdir.html
-rw-r--r--      3262 2016-12-04 06:08 solrquery.sethighlightfragmenter.html
-rw-r--r--      8895 2016-12-04 06:07 intldateformatter.gettimezoneid.html
-rw-r--r--      2226 2016-12-04 06:08 function.msession-find.html
-rw-r--r--      7752 2016-12-04 06:08 gearmanworker.addfunction.html
-rw-r--r--      2634 2016-12-04 06:07 ref.pdo-dblib.html
-rw-r--r--      3487 2016-12-04 06:07 transliterator.construct.html
-rw-r--r--      5115 2016-12-04 06:08 memcached.callbacks.result.html
-rw-r--r--      2795 2016-12-04 06:08 spldoublylinkedlist.top.html
-rw-r--r--      2692 2016-12-04 06:07 imagick.setgravity.html
-rw-r--r--      2495 2016-12-04 06:07 imagickdraw.gettextinterlinespacing.html
-rw-r--r--      4875 2016-12-04 06:08 book.xmlreader.html
-rw-r--r--      7386 2016-12-04 06:07 function.mysql-close.html
-rw-r--r--      3575 2016-12-04 06:07 function.dbplus-flush.html
-rw-r--r--      2858 2016-12-04 06:07 mongogridfsfile.construct.html
-rw-r--r--      2813 2016-12-04 06:08 xmldiff-memory.diff.html
-rw-r--r--      9963 2016-12-04 06:07 pdo.query.html
-rw-r--r--      6363 2016-12-04 06:07 image.examples-watermark.html
-rw-r--r--     17391 2016-12-04 06:07 pdo.prepared-statements.html
-rw-r--r--      1455 2016-12-04 06:07 phar.creating.html
-rw-r--r--      1287 2016-12-04 06:07 pdo.requirements.html
-rw-r--r--      8655 2016-12-04 06:08 ds-hashable.hash.html
-rw-r--r--     12220 2016-12-04 06:08 session.security.ini.html
-rw-r--r--      2199 2016-12-04 06:07 bcompiler.installation.html
-rw-r--r--     16270 2016-12-04 06:07 datetime.construct.html
-rw-r--r--      6794 2016-12-04 06:07 function.ibase-num-fields.html
-rw-r--r--      2538 2016-12-04 06:08 function.pdf-fill-textblock.html
-rw-r--r--      3817 2016-12-04 06:07 mbstring.ja-basic.html
-rw-r--r--      3013 2016-12-04 06:08 function.fann-copy.html
-rw-r--r--      2336 2016-12-04 06:07 function.maxdb-thread-safe.html
-rw-r--r--      7683 2016-12-04 06:07 dateperiod.getenddate.html
-rw-r--r--      2916 2016-12-04 06:08 ev.stop.html
-rw-r--r--     10166 2016-12-04 06:08 function.strtok.html
-rw-r--r--      6360 2016-12-04 06:07 cairofontface.status.html
-rw-r--r--      7504 2016-12-04 06:07 function.cubrid-is-instance.html
-rw-r--r--      6906 2016-12-04 06:08 function.session-set-cookie-params.html
-rw-r--r--      6374 2016-12-04 06:08 function.proc-get-status.html
-rw-r--r--      4460 2016-12-04 06:07 function.id3-get-frame-short-name.html
-rw-r--r--      2509 2016-12-04 06:08 ui-draw-matrix.rotate.html
-rw-r--r--      4844 2016-12-04 06:07 mongodb-bson-binary.getdata.html
-rw-r--r--      2683 2016-12-04 06:07 function.m-transinqueue.html
-rw-r--r--      2995 2016-12-04 06:07 function.oci-free-descriptor.html
-rw-r--r--      1901 2016-12-04 06:07 function.date-date-set.html
-rw-r--r--      3627 2016-12-04 06:07 function.ncurses-getmaxyx.html
-rw-r--r--      2330 2016-12-04 06:07 imagick.clipimage.html
-rw-r--r--      2871 2016-12-04 06:08 internals2.opcodes.pre-dec.html
-rw-r--r--      3246 2016-12-04 06:07 function.mcrypt-module-get-algo-key-size.html
-rw-r--r--      6667 2016-12-04 06:07 mysqli-stmt.attr-set.html
-rw-r--r--     62341 2016-12-04 06:08 migration70.incompatible.html
-rw-r--r--      6760 2016-12-04 06:08 zookeeper.getacl.html
-rw-r--r--      3223 2016-12-04 06:07 cubrid.resources.html
-rw-r--r--      4785 2016-12-04 06:08 function.posix-getgid.html
-rw-r--r--      3972 2016-12-04 06:07 function.fbsql-stop-db.html
-rw-r--r--      2905 2016-12-04 06:08 harupage.getlinewidth.html
-rw-r--r--      5498 2016-12-04 06:08 function.yaz-sort.html
-rw-r--r--      7089 2016-12-04 06:08 swish.constants.html
-rw-r--r--      2202 2016-12-04 06:08 ui-draw-pen.clip.html
-rw-r--r--      5897 2016-12-04 06:07 function.date-sun-info.html
-rw-r--r--      7341 2016-12-04 06:08 zookeeper.setacl.html
-rw-r--r--      5401 2016-12-04 06:08 harupage.textrect.html
-rw-r--r--     42087 2016-12-04 06:07 sqlsrv.constants.html
-rw-r--r--      4165 2016-12-04 06:08 sdo-list.insert.html
-rw-r--r--      1516 2016-12-04 06:07 dbplus.constants.html
-rw-r--r--      7071 2016-12-04 06:08 function.crc32.html
-rw-r--r--      5033 2016-12-04 06:07 function.gnupg-export.html
-rw-r--r--      3249 2016-12-04 06:07 function.trader-cdlhammer.html
-rw-r--r--     11253 2016-12-04 06:08 function.eio-fstat.html
-rw-r--r--      1585 2016-12-04 06:07 mysqlnd-memcache.setup.html
-rw-r--r--      3305 2016-12-04 06:08 class.reflectiontype.html
-rw-r--r--      3254 2016-12-04 06:08 sdo-das-datafactory.getdatafactory.html
-rw-r--r--      3307 2016-12-04 06:07 function.ncurses-clrtoeol.html
-rw-r--r--      1517 2016-12-04 06:08 nsapi.setup.html
-rw-r--r--      6242 2016-12-04 06:08 function.rsort.html
-rw-r--r--      3428 2016-12-04 06:07 harudoc.getstreamsize.html
-rw-r--r--      2542 2016-12-04 06:08 yaf-application.run.html
-rw-r--r--      3744 2016-12-04 06:08 function.session-save-path.html
-rw-r--r--      2922 2016-12-04 06:08 harupage.getgraystroke.html
-rw-r--r--      1689 2016-12-04 06:07 xhprof.installation.html
-rw-r--r--      2783 2016-12-04 06:08 yaf-loader.setlibrarypath.html
-rw-r--r--      2114 2016-12-04 06:07 intro.mhash.html
-rw-r--r--      8856 2016-12-04 06:07 class.cairofontoptions.html
-rw-r--r--      2507 2016-12-04 06:08 function.pdf-begin-page.html
-rw-r--r--      2879 2016-12-04 06:08 function.svn-repos-create.html
-rw-r--r--     19947 2016-12-04 06:07 class.gmagickdraw.html
-rw-r--r--      9468 2016-12-04 06:07 mongodb-driver-writeconcern.construct.html
-rw-r--r--      2985 2016-12-04 06:07 datetime.wakeup.html
-rw-r--r--      3061 2016-12-04 06:08 solrutils.escapequerychars.html
-rw-r--r--      1342 2016-12-04 06:08 zookeeper.resources.html
-rw-r--r--      2669 2016-12-04 06:08 yaf-dispatcher.setdefaultaction.html
-rw-r--r--      1335 2016-12-04 06:08 nis.configuration.html
-rw-r--r--      1523 2016-12-04 06:08 exec.setup.html
-rw-r--r--      4416 2016-12-04 06:07 function.cairo-surface-show-page.html
-rw-r--r--      7900 2016-12-04 06:07 dateinterval.construct.html
-rw-r--r--      1424 2016-12-04 06:08 mqseries.ini.html
-rw-r--r--      5056 2016-12-04 06:07 mongoclient.listdbs.html
-rw-r--r--      3123 2016-12-04 06:07 function.px-get-field.html
-rw-r--r--      4620 2016-12-04 06:08 domelement.setidattribute.html
-rw-r--r--      2949 2016-12-04 06:08 swffill.moveto.html
-rw-r--r--      5601 2016-12-04 06:07 imagick.trimimage.html
-rw-r--r--      6603 2016-12-04 06:07 function.hash-equals.html
-rw-r--r--      1469 2016-12-04 06:07 intro.id3.html
-rw-r--r--      4689 2016-12-04 06:08 threaded.unlock.html
-rw-r--r--      1315 2016-12-04 06:08 sockets.requirements.html
-rw-r--r--     14953 2016-12-04 06:07 info.constants.html
-rw-r--r--      4295 2016-12-04 06:08 sphinxclient.setmatchmode.html
-rw-r--r--      4542 2016-12-04 06:07 function.recode-string.html
-rw-r--r--      6552 2016-12-04 06:07 imagick.normalizeimage.html
-rw-r--r--     12340 2016-12-04 06:07 mysqli-result.lengths.html
-rw-r--r--      4552 2016-12-04 06:08 evloop.defaultloop.html
-rw-r--r--      6049 2016-12-04 06:07 locale.getdefault.html
-rw-r--r--      1511 2016-12-04 06:08 xml.examples.html
-rw-r--r--      2371 2016-12-04 06:07 reserved.variables.httprawpostdata.html
-rw-r--r--     16114 2016-12-04 06:07 function.mcrypt-encrypt.html
-rw-r--r--      9652 2016-12-04 06:07 ref.pdo-odbc.html
-rw-r--r--      7290 2016-12-04 06:07 phar.copy.html
-rw-r--r--      3942 2016-12-04 06:08 function.xmlwriter-end-pi.html
-rw-r--r--      6286 2016-12-04 06:08 function.posix-getgrnam.html
-rw-r--r--      2060 2016-12-04 06:07 openssl.constants.html
-rw-r--r--     13420 2016-12-04 06:07 language.types.callable.html
-rw-r--r--      4690 2016-12-04 06:07 sqlite.installation.html
-rw-r--r--      2090 2016-12-04 06:07 ref.opcache.html
-rw-r--r--      5781 2016-12-04 06:08 reflectionclass.tostring.html
-rw-r--r--      4326 2016-12-04 06:07 function.gnupg-clearsignkeys.html
-rw-r--r--      1489 2016-12-04 06:08 pdf.setup.html
-rw-r--r--      4601 2016-12-04 06:07 function.cairo-matrix-rotate.html
-rw-r--r--      1408 2016-12-04 06:07 ref.rar.html
-rw-r--r--      3340 2016-12-04 06:08 swfdisplayitem.setdepth.html
-rw-r--r--      3776 2016-12-04 06:07 function.uopz-overload.html
-rw-r--r--      4172 2016-12-04 06:07 phardata.setstub.html
-rw-r--r--      4263 2016-12-04 06:08 function.convert-uuencode.html
-rw-r--r--      3120 2016-12-04 06:08 solrquery.sethighlightmaxanalyzedchars.html
-rw-r--r--      3081 2016-12-04 06:07 function.newt-listbox-set-entry.html
-rw-r--r--      6880 2016-12-04 06:08 memcache.add.html
-rw-r--r--      2866 2016-12-04 06:08 internals2.opcodes.pre-inc.html
-rw-r--r--      3062 2016-12-04 06:07 function.stats-dens-negative-binomial.html
-rw-r--r--      4573 2016-12-04 06:08 domcharacterdata.insertdata.html
-rw-r--r--      1789 2016-12-04 06:08 internals2.opcodes.ext-nop.html
-rw-r--r--      3277 2016-12-04 06:07 oci-collection.assign.html
-rw-r--r--      7071 2016-12-04 06:07 function.enchant-dict-quick-check.html
-rw-r--r--      5258 2016-12-04 06:08 class.haruencoder.html
-rw-r--r--      6275 2016-12-04 06:08 swishresults.seekresult.html
-rw-r--r--      7307 2016-12-04 06:07 function.ingres-fetch-row.html
-rw-r--r--      2652 2016-12-04 06:08 harupage.getcmykstroke.html
-rw-r--r--      3022 2016-12-04 06:07 function.openssl-dh-compute-key.html
-rw-r--r--      1934 2016-12-04 06:07 ref.cyrus.html
-rw-r--r--      2049 2016-12-04 06:07 function.ocierror.html
-rw-r--r--      3766 2016-12-04 06:08 function.fann-set-sarprop-step-error-threshold-factor.html
-rw-r--r--      8661 2016-12-04 06:07 class.mongodb-driver-exception-writeexception.html
-rw-r--r--      2982 2016-12-04 06:08 solrquery.setmltmintermfrequency.html
-rw-r--r--      1255 2016-12-04 06:08 zookeeper.constants.html
-rw-r--r--      6155 2016-12-04 06:07 function.trader-sarext.html
-rw-r--r--      2607 2016-12-04 06:07 function.readline-write-history.html
-rw-r--r--     18447 2016-12-04 06:07 zip.examples.html
-rw-r--r--      3086 2016-12-04 06:07 function.enchant-dict-check.html
-rw-r--r--      2710 2016-12-04 06:07 function.ncurses-attrset.html
-rw-r--r--      5853 2016-12-04 06:08 directoryiterator.getatime.html
-rw-r--r--      4646 2016-12-04 06:08 function.expect-popen.html
-rw-r--r--      6801 2016-12-04 06:08 function.socket-read.html
-rw-r--r--      4602 2016-12-04 06:08 splfileinfo.tostring.html
-rw-r--r--      5365 2016-12-04 06:07 function.mt-getrandmax.html
-rw-r--r--      2794 2016-12-04 06:08 swftextfield.setleftmargin.html
-rw-r--r--      8439 2016-12-04 06:07 configuration.changes.html
-rw-r--r--      5432 2016-12-04 06:07 cairocontext.infill.html
-rw-r--r--      5623 2016-12-04 06:08 function.ssh2-sftp-symlink.html
-rw-r--r--     11551 2016-12-04 06:08 function.array-walk.html
-rw-r--r--      4113 2016-12-04 06:08 reflectionextension.getversion.html
-rw-r--r--      2630 2016-12-04 06:08 function.ming-setswfcompression.html
-rw-r--r--      9209 2016-12-04 06:08 function.property-exists.html
-rw-r--r--      3512 2016-12-04 06:07 security.html
-rw-r--r--      3606 2016-12-04 06:07 function.zip-read.html
-rw-r--r--      4556 2016-12-04 06:07 imagick.transposeimage.html
-rw-r--r--      4941 2016-12-04 06:08 class.xmldiff-memory.html
-rw-r--r--      3067 2016-12-04 06:08 function.event-priority-set.html
-rw-r--r--      2634 2016-12-04 06:07 function.filepro-fieldcount.html
-rw-r--r--      2958 2016-12-04 06:07 gmagick.medianfilterimage.html
-rw-r--r--      4844 2016-12-04 06:08 gearmanclient.setcompletecallback.html
-rw-r--r--     13810 2016-12-04 06:07 function.oci-password-change.html
-rw-r--r--      2847 2016-12-04 06:08 yaf-session.offsetset.html
-rw-r--r--      6295 2016-12-04 06:08 function.array-rand.html
-rw-r--r--      6864 2016-12-04 06:08 function.inet-ntop.html
-rw-r--r--      4244 2016-12-04 06:08 function.ps-symbol-width.html
-rw-r--r--      1964 2016-12-04 06:08 history.php.publications.html
-rw-r--r--      3004 2016-12-04 06:07 book.fileinfo.html
-rw-r--r--      2393 2016-12-04 06:07 imagickpixel.clear.html
-rw-r--r--      4250 2016-12-04 06:07 imagick.painttransparentimage.html
-rw-r--r--      5528 2016-12-04 06:08 internals2.opcodes.fe-reset.html
-rw-r--r--      6800 2016-12-04 06:08 varnish.constants.html
-rw-r--r--      2959 2016-12-04 06:07 function.m-getcommadelimited.html
-rw-r--r--      7613 2016-12-04 06:08 function.get-browser.html
-rw-r--r--      3827 2016-12-04 06:07 function.cubrid-lob2-new.html
-rw-r--r--      7558 2016-12-04 06:07 mysqli-stmt.send-long-data.html
-rw-r--r--      2866 2016-12-04 06:08 cachingiterator.offsetexists.html
-rw-r--r--      2490 2016-12-04 06:08 swffont.getutf8width.html
-rw-r--r--    107062 2016-12-04 06:08 doc.changelog.html
-rw-r--r--      4652 2016-12-04 06:08 ds-sequence.allocate.html
-rw-r--r--      5403 2016-12-04 06:07 function.disk-free-space.html
-rw-r--r--      7768 2016-12-04 06:07 haru.builtin.encodings.html
-rw-r--r--      2403 2016-12-04 06:08 ev.verify.html
-rw-r--r--     57342 2016-12-04 06:07 function.strftime.html
-rw-r--r--      3741 2016-12-04 06:07 function.imap-bodystruct.html
-rw-r--r--      8804 2016-12-04 06:07 function.imageloadfont.html
-rw-r--r--      4603 2016-12-04 06:08 function.ps-curveto.html
-rw-r--r--      7007 2016-12-04 06:07 phardata.copy.html
-rw-r--r--      2874 2016-12-04 06:07 gmagick.setimagedispose.html
-rw-r--r--      3684 2016-12-04 06:08 gearmanjob.exception.html
-rw-r--r--      4739 2016-12-04 06:08 reflectionclass.getdoccomment.html
-rw-r--r--      4306 2016-12-04 06:08 function.fann-test-data.html
-rw-r--r--      3092 2016-12-04 06:08 multipleiterator.valid.html
-rw-r--r--      2633 2016-12-04 06:08 ui-menu.appendpreferences.html
-rw-r--r--     22183 2016-12-04 06:07 mongocollection.createindex.html
-rw-r--r--     12533 2016-12-04 06:07 function.db2-client-info.html
-rw-r--r--      1314 2016-12-04 06:08 hwapi.resources.html
-rw-r--r--      3407 2016-12-04 06:07 function.ifxus-create-slob.html
-rw-r--r--      1339 2016-12-04 06:08 debugger.html
-rw-r--r--      1323 2016-12-04 06:08 json.requirements.html
-rw-r--r--      2301 2016-12-04 06:08 ldap.using.html
-rw-r--r--      6118 2016-12-04 06:07 book.ingres.html
-rw-r--r--     20960 2016-12-04 06:07 wincache.configuration.html
-rw-r--r--      4469 2016-12-04 06:08 internals2.opcodes.fetch-dim-w.html
-rw-r--r--      2214 2016-12-04 06:08 ui-menuitem.setchecked.html
-rw-r--r--      3309 2016-12-04 06:07 function.trader-cdlhomingpigeon.html
-rw-r--r--      2976 2016-12-04 06:07 mongodb-driver-cursorid.construct.html
-rw-r--r--      2658 2016-12-04 06:08 eventdnsbase.addsearch.html
-rw-r--r--      1496 2016-12-04 06:07 intro.fileinfo.html
-rw-r--r--      3072 2016-12-04 06:07 security.database.design.html
-rw-r--r--      2260 2016-12-04 06:08 function.pdf-get-parameter.html
-rw-r--r--      2782 2016-12-04 06:08 eventbuffer.expand.html
-rw-r--r--      6742 2016-12-04 06:08 ds-set.get.html
-rw-r--r--      3731 2016-12-04 06:07 function.runkit-constant-redefine.html
-rw-r--r--      3169 2016-12-04 06:07 oci-lob.save.html
-rw-r--r--      1431 2016-12-04 06:07 hash.resources.html
-rw-r--r--      5180 2016-12-04 06:08 class.xmldiff-dom.html
-rw-r--r--      1609 2016-12-04 06:08 pcre.pattern.html
-rw-r--r--     12209 2016-12-04 06:07 imagickdraw.pathcurvetoquadraticbezierabsolute.html
-rw-r--r--      9549 2016-12-04 06:08 class.tidynode.html
-rw-r--r--    353041 2016-12-04 06:07 class.intlchar.html
-rw-r--r--      6171 2016-12-04 06:08 solrdismaxquery.removeuserfield.html
-rw-r--r--      2547 2016-12-04 06:08 yaf-request-simple.get.html
-rw-r--r--      6091 2016-12-04 06:08 function.md5.html
-rw-r--r--      8669 2016-12-04 06:07 function.runkit-method-redefine.html
-rw-r--r--      3405 2016-12-04 06:08 function.fann-get-cascade-max-out-epochs.html
-rw-r--r--      2686 2016-12-04 06:08 lua.include.html
-rw-r--r--      1663 2016-12-04 06:07 intro.pgsql.html
-rw-r--r--      7122 2016-12-04 06:08 ev.embeddablebackends.html
-rw-r--r--      3002 2016-12-04 06:07 function.ncurses-has-ic.html
-rw-r--r--      4252 2016-12-04 06:07 ref.sybase.html
-rw-r--r--      5129 2016-12-04 06:08 function.mqseries-put1.html
-rw-r--r--      7828 2016-12-04 06:07 function.db2-column-privileges.html
-rw-r--r--      2262 2016-12-04 06:08 curlfile.getpostfilename.html
-rw-r--r--      3391 2016-12-04 06:07 function.stats-rand-gen-ibinomial-negative.html
-rw-r--r--      8102 2016-12-04 06:07 cairocontext.getantialias.html
-rw-r--r--      3056 2016-12-04 06:07 function.newt-grid-v-stacked.html
-rw-r--r--      5536 2016-12-04 06:08 reflectiongenerator.getfunction.html
-rw-r--r--      2668 2016-12-04 06:07 rarentry.tostring.html
-rw-r--r--      2778 2016-12-04 06:07 gmagick.getimagewhitepoint.html
-rw-r--r--      2754 2016-12-04 06:08 internals2.opcodes.echo.html
-rw-r--r--      2468 2016-12-04 06:08 gearmantask.isrunning.html
-rw-r--r--      5244 2016-12-04 06:07 function.imap-check.html
-rw-r--r--      5142 2016-12-04 06:07 function.gnupg-adddecryptkey.html
-rw-r--r--     11070 2016-12-04 06:07 class.imagickpixel.html
-rw-r--r--      2481 2016-12-04 06:08 hwapi.object-title.html
-rw-r--r--      2314 2016-12-04 06:07 imagick.getfilename.html
-rw-r--r--     13696 2016-12-04 06:08 function.trim.html
-rw-r--r--     11550 2016-12-04 06:07 function.sqlsrv-rollback.html
-rw-r--r--      2216 2016-12-04 06:08 ui-menu.construct.html
-rw-r--r--      4495 2016-12-04 06:07 ingres.installation.html
-rw-r--r--      5305 2016-12-04 06:07 cairocontext.setantialias.html
-rw-r--r--      4889 2016-12-04 06:07 cairocontext.popgroup.html
-rw-r--r--      5008 2016-12-04 06:07 cairosurface.getfontoptions.html
-rw-r--r--      4289 2016-12-04 06:08 eventhttprequest.sendreplystart.html
-rw-r--r--      3156 2016-12-04 06:08 arrayiterator.unserialize.html
-rw-r--r--      2827 2016-12-04 06:07 function.px-numfields.html
-rw-r--r--     14394 2016-12-04 06:07 function.cubrid-fetch-field.html
-rw-r--r--      1521 2016-12-04 06:07 crack.setup.html
-rw-r--r--      1501 2016-12-04 06:07 dio.setup.html
-rw-r--r--      3148 2016-12-04 06:07 function.mysqlnd-qc-clear-cache.html
-rw-r--r--      7512 2016-12-04 06:08 ds-sequence.slice.html
-rw-r--r--     16546 2016-12-04 06:07 function.file-get-contents.html
-rw-r--r--      3587 2016-12-04 06:07 function.filepro-retrieve.html
-rw-r--r--      2644 2016-12-04 06:07 function.trader-sma.html
-rw-r--r--      4918 2016-12-04 06:07 cubridmysql.cubrid.html
-rw-r--r--      7347 2016-12-04 06:07 function.cubrid-lob-close.html
-rw-r--r--      3949 2016-12-04 06:08 sphinxclient.setfilter.html
-rw-r--r--      1913 2016-12-04 06:07 class.cairopath.html
-rw-r--r--      3083 2016-12-04 06:07 function.mcrypt-module-close.html
-rw-r--r--      2739 2016-12-04 06:08 reflectionzendextension.construct.html
-rw-r--r--      3546 2016-12-04 06:07 class.mongoexecutiontimeoutexception.html
-rw-r--r--      3837 2016-12-04 06:08 function.fann-scale-output.html
-rw-r--r--      7200 2016-12-04 06:08 syncsharedmemory.write.html
-rw-r--r--      6268 2016-12-04 06:08 function.curl-strerror.html
-rw-r--r--      4047 2016-12-04 06:08 yar-client.construct.html
-rw-r--r--      3234 2016-12-04 06:08 swfshape.drawline.html
-rw-r--r--      2739 2016-12-04 06:08 cachingiterator.offsetget.html
-rw-r--r--      2582 2016-12-04 06:07 imagickdraw.getstrokedasharray.html
-rw-r--r--      3362 2016-12-04 06:07 gmagick.setimagechanneldepth.html
-rw-r--r--      1930 2016-12-04 06:07 sqlsrv.resources.html
-rw-r--r--      4945 2016-12-04 06:07 mongodb-bson-utcdatetime.construct.html
-rw-r--r--      4821 2016-12-04 06:08 gearmanclient.setfailcallback.html
-rw-r--r--      4711 2016-12-04 06:08 ds-priorityqueue.copy.html
-rw-r--r--      2980 2016-12-04 06:08 evloop.now.html
-rw-r--r--     47281 2016-12-04 06:08 internals2.pdo.implementing.html
-rw-r--r--      4738 2016-12-04 06:08 varnishadmin.construct.html
-rw-r--r--      5449 2016-12-04 06:08 book.zmq.html
-rw-r--r--      3892 2016-12-04 06:08 domelement.getattributenodens.html
-rw-r--r--      2932 2016-12-04 06:08 recursiveiteratoriterator.callhaschildren.html
-rw-r--r--      2551 2016-12-04 06:08 cachingiterator.rewind.html
-rw-r--r--      6959 2016-12-04 06:08 memcached.setoptions.html
-rw-r--r--      7162 2016-12-04 06:08 reflectionmethod.invoke.html
-rw-r--r--      7800 2016-12-04 06:08 function.prev.html
-rw-r--r--      7023 2016-12-04 06:08 streamwrapper.stream-open.html
-rw-r--r--     15496 2016-12-04 06:07 function.maxdb-prepare.html
-rw-r--r--      9712 2016-12-04 06:07 function.imap-status.html
-rw-r--r--      9430 2016-12-04 06:08 function.ps-set-text-pos.html
-rw-r--r--      3853 2016-12-04 06:08 evloop.periodic.html
-rw-r--r--      6011 2016-12-04 06:07 control-structures.break.html
-rw-r--r--      5603 2016-12-04 06:07 mongodbref.get.html
-rw-r--r--      2010 2016-12-04 06:07 function.mysqli-set-opt.html
-rw-r--r--      5959 2016-12-04 06:07 function.gmp-div-r.html
-rw-r--r--      3532 2016-12-04 06:07 security.general.html
-rw-r--r--      2187 2016-12-04 06:08 intro.fam.html
-rw-r--r--      3094 2016-12-04 06:07 harudoc.save.html
-rw-r--r--      4761 2016-12-04 06:08 memcache.constants.html
-rw-r--r--      4040 2016-12-04 06:08 ds-set.capacity.html
-rw-r--r--      7763 2016-12-04 06:08 function.ftp-put.html
-rw-r--r--      2511 2016-12-04 06:08 ui-controls-colorbutton.getcolor.html
-rw-r--r--      2425 2016-12-04 06:08 function.pdf-setgray-fill.html
-rw-r--r--      4889 2016-12-04 06:07 cairosurface.showpage.html
-rw-r--r--      2443 2016-12-04 06:08 function.pdf-setfont.html
-rw-r--r--      1533 2016-12-04 06:07 intro.exif.html
-rw-r--r--      2108 2016-12-04 06:07 copyright.html
-rw-r--r--      2328 2016-12-04 06:07 intro.pdo.html
-rw-r--r--      4078 2016-12-04 06:08 zmqdevice.settimercallback.html
-rw-r--r--      9204 2016-12-04 06:07 imagickdraw.circle.html
-rw-r--r--      4776 2016-12-04 06:07 cairo.versionstring.html
-rw-r--r--      2682 2016-12-04 06:08 sdo-das-changesummary.beginlogging.html
-rw-r--r--      1308 2016-12-04 06:07 opcache.resources.html
-rw-r--r--      3991 2016-12-04 06:07 function.sqlite-fetch-object.html
-rw-r--r--      2306 2016-12-04 06:08 function.pdf-info-matchbox.html
-rw-r--r--      3512 2016-12-04 06:08 class.domnodelist.html
-rw-r--r--      3839 2016-12-04 06:08 evcheck.construct.html
-rw-r--r--      2648 2016-12-04 06:07 intlbreakiterator.construct.html
-rw-r--r--      3474 2016-12-04 06:08 limititerator.next.html
-rw-r--r--      3990 2016-12-04 06:07 mongocursor.immortal.html
-rw-r--r--      3033 2016-12-04 06:08 ui-draw-brush-radialgradient.construct.html
-rw-r--r--      3719 2016-12-04 06:08 recursivefilteriterator.getchildren.html
-rw-r--r--      3364 2016-12-04 06:07 serializable.unserialize.html
-rw-r--r--      2785 2016-12-04 06:07 function.ncurses-timeout.html
-rw-r--r--      4650 2016-12-04 06:08 lua.assign.html
-rw-r--r--      1479 2016-12-04 06:08 intro.yaml.html
-rw-r--r--      8134 2016-12-04 06:07 rararchive.isbroken.html
-rw-r--r--      3111 2016-12-04 06:07 gmagick.reducenoiseimage.html
-rw-r--r--      2734 2016-12-04 06:08 function.yp-cat.html
-rw-r--r--      3668 2016-12-04 06:08 streamwrapper.stream-cast.html
-rw-r--r--      7206 2016-12-04 06:07 intlcalendar.gettimezone.html
-rw-r--r--      2940 2016-12-04 06:08 internals2.opcodes.assign-concat.html
-rw-r--r--      2708 2016-12-04 06:07 function.openssl-x509-free.html
-rw-r--r--      1964 2016-12-04 06:08 intro.xmlrpc.html
-rw-r--r--      7873 2016-12-04 06:08 domxpath.evaluate.html
-rw-r--r--      3670 2016-12-04 06:08 migration70.classes.html
-rw-r--r--      2956 2016-12-04 06:07 function.trader-plus-dm.html
-rw-r--r--      3040 2016-12-04 06:07 function.dbplus-undo.html
-rw-r--r--      3344 2016-12-04 06:08 eventutil.getsocketfd.html
-rw-r--r--      2514 2016-12-04 06:07 imagickdraw.pathclose.html
-rw-r--r--      7212 2016-12-04 06:08 function.stream-copy-to-stream.html
-rw-r--r--      2870 2016-12-04 06:08 yaf-dispatcher.flushinstantly.html
-rw-r--r--      4383 2016-12-04 06:08 arrayobject.offsetunset.html
-rw-r--r--      1510 2016-12-04 06:07 kadm5.setup.html
-rw-r--r--      5461 2016-12-04 06:07 cairocontext.scale.html
-rw-r--r--      5425 2016-12-04 06:08 function.ssh2-sftp-readlink.html
-rw-r--r--      8712 2016-12-04 06:07 lapack.solvelinearequation.html
-rw-r--r--      2336 2016-12-04 06:07 imagickdraw.getfont.html
-rw-r--r--      5672 2016-12-04 06:08 function.ssh2-sftp-realpath.html
-rw-r--r--      9443 2016-12-04 06:07 mysqlnd-ms.changes-one-six.html
-rw-r--r--      4107 2016-12-04 06:07 mongo.tutorial.cursor.html
-rw-r--r--      3975 2016-12-04 06:07 cairosurfacepattern.setextend.html
-rw-r--r--      4401 2016-12-04 06:07 function.cairo-surface-get-type.html
-rw-r--r--      3008 2016-12-04 06:07 mongoint32.construct.html
-rw-r--r--      6007 2016-12-04 06:07 function.kadm5-get-principal.html
-rw-r--r--      2431 2016-12-04 06:07 imagick.getimagefilename.html
-rw-r--r--     15088 2016-12-04 06:07 function.maxdb-fetch-field-direct.html
-rw-r--r--      5253 2016-12-04 06:08 yaml.callbacks.parse.html
-rw-r--r--      3455 2016-12-04 06:08 recursivedirectoryiterator.getsubpath.html
-rw-r--r--      3586 2016-12-04 06:08 function.fann-get-train-stop-function.html
-rw-r--r--      3925 2016-12-04 06:07 function.sqlite-libencoding.html
-rw-r--r--      5117 2016-12-04 06:08 reflectionclass.isfinal.html
-rw-r--r--      2713 2016-12-04 06:07 gmagickdraw.polyline.html
-rw-r--r--     10867 2016-12-04 06:08 appenditerator.construct.html
-rw-r--r--      2975 2016-12-04 06:08 swffill.scaleto.html
-rw-r--r--      2668 2016-12-04 06:08 swfsprite.setframes.html
-rw-r--r--      4339 2016-12-04 06:07 exception.tostring.html
-rw-r--r--      2780 2016-12-04 06:08 function.xmlrpc-server-register-introspection-callback.html
-rw-r--r--      4217 2016-12-04 06:08 ds-pair.isempty.html
-rw-r--r--      2003 2016-12-04 06:07 reserved.interfaces.html
-rw-r--r--      4491 2016-12-04 06:08 ds-map.pairs.html
-rw-r--r--      3118 2016-12-04 06:07 function.dbplus-xunlockrel.html
-rw-r--r--      3469 2016-12-04 06:08 evloop.child.html
-rw-r--r--      4114 2016-12-04 06:08 ev.watcher-callbacks.html
-rw-r--r--      5772 2016-12-04 06:08 function.gupnp-context-host-path.html
-rw-r--r--      3372 2016-12-04 06:08 ev.depth.html
-rw-r--r--      3072 2016-12-04 06:08 migration52.other.html
-rw-r--r--      3213 2016-12-04 06:08 swfsprite.add.html
-rw-r--r--      3521 2016-12-04 06:08 reflectionfunctionabstract.getnumberofrequiredparameters.html
-rw-r--r--      2708 2016-12-04 06:08 gearmanworker.error.html
-rw-r--r--      1426 2016-12-04 06:07 ncurses.errconsts.html
-rw-r--r--      3709 2016-12-04 06:08 harupage.curveto2.html
-rw-r--r--      2756 2016-12-04 06:07 sqlite3stmt.readonly.html
-rw-r--r--      1335 2016-12-04 06:08 sdo.configuration.html
-rw-r--r--      2157 2016-12-04 06:07 intro.paradox.html
-rw-r--r--     21375 2016-12-04 06:07 mongo.queries.html
-rw-r--r--      2046 2016-12-04 06:07 intro.readline.html
-rw-r--r--      2448 2016-12-04 06:07 function.ncurses-hide-panel.html
-rw-r--r--      2409 2016-12-04 06:08 ui-controls-box.construct.html
-rw-r--r--      2211 2016-12-04 06:07 datetime.installation.html
-rw-r--r--      8057 2016-12-04 06:08 function.stream-filter-prepend.html
-rw-r--r--      3772 2016-12-04 06:08 function.fann-set-cascade-candidate-change-fraction.html
-rw-r--r--     21306 2016-12-04 06:07 info.configuration.html
-rw-r--r--      7829 2016-12-04 06:08 function.pcntl-wait.html
-rw-r--r--      3766 2016-12-04 06:08 function.pdf-begin-page-ext.html
-rw-r--r--      3040 2016-12-04 06:08 hwapi.copy.html
-rw-r--r--      4153 2016-12-04 06:08 sphinxclient.setlimits.html
-rw-r--r--      3132 2016-12-04 06:07 function.trader-ad.html
-rw-r--r--      4347 2016-12-04 06:08 solrquery.setexpandrows.html
-rw-r--r--      7327 2016-12-04 06:07 mysqli.connect-errno.html
-rw-r--r--      7011 2016-12-04 06:07 ref.pdo-sqlsrv.connection.html
-rw-r--r--      3171 2016-12-04 06:08 haruencoder.gettype.html
-rw-r--r--      1530 2016-12-04 06:08 sdo-das-xml.installation.html
-rw-r--r--      1720 2016-12-04 06:08 quickhash.installation.html
-rw-r--r--      4577 2016-12-04 06:07 function.dbx-close.html
-rw-r--r--      2254 2016-12-04 06:08 pcre.examples.html
-rw-r--r--      3031 2016-12-04 06:08 function.svn-fs-copy.html
-rw-r--r--      2988 2016-12-04 06:08 sdo-das-dataobject.getchangesummary.html
-rw-r--r--      7817 2016-12-04 06:08 class.splheap.html
-rw-r--r--      3561 2016-12-04 06:07 mongo.getslaveokay.html
-rw-r--r--      3700 2016-12-04 06:08 haruannotation.sethighlightmode.html
-rw-r--r--      6422 2016-12-04 06:07 ref.mcrypt.html
-rw-r--r--      4441 2016-12-04 06:08 oauthprovider.is2leggedendpoint.html
-rw-r--r--      5400 2016-12-04 06:08 directoryiterator.getpathname.html
-rw-r--r--      3268 2016-12-04 06:08 zmqsocket.send.html
-rw-r--r--      2852 2016-12-04 06:08 reflector.tostring.html
-rw-r--r--     21146 2016-12-04 06:08 cc.license.html
-rw-r--r--      3481 2016-12-04 06:07 function.imap-msgno.html
-rw-r--r--      1379 2016-12-04 06:07 zip.requirements.html
-rw-r--r--      5400 2016-12-04 06:08 ds-sequence.rotate.html
-rw-r--r--      3580 2016-12-04 06:08 harupage.rectangle.html
-rw-r--r--      1397 2016-12-04 06:07 introduction.html
-rw-r--r--      4568 2016-12-04 06:07 function.cairo-pattern-create-for-surface.html
-rw-r--r--     11588 2016-12-04 06:08 libxml.constants.html
-rw-r--r--      1994 2016-12-04 06:07 intro.mysqlnd.html
-rw-r--r--      4444 2016-12-04 06:07 mongocommandcursor.batchsize.html
-rw-r--r--      2147 2016-12-04 06:08 yar.installation.html
-rw-r--r--      1437 2016-12-04 06:08 ref.judy.html
-rw-r--r--      4740 2016-12-04 06:08 recursivetreeiterator.construct.html
-rw-r--r--      2781 2016-12-04 06:07 function.stats-rand-gen-ipoisson.html
-rw-r--r--      4769 2016-12-04 06:07 function.mcrypt-enc-get-supported-key-sizes.html
-rw-r--r--      2340 2016-12-04 06:08 intro.chdb.html
-rw-r--r--      3260 2016-12-04 06:08 eventhttprequest.sendreplyend.html
-rw-r--r--      6709 2016-12-04 06:08 soapserver.addfunction.html
-rw-r--r--     16651 2016-12-04 06:07 function.parse-ini-file.html
-rw-r--r--      3662 2016-12-04 06:08 sdo-datafactory.create.html
-rw-r--r--      3301 2016-12-04 06:07 function.newt-form-destroy.html
-rw-r--r--      4358 2016-12-04 06:08 solrquery.addexpandfilterquery.html
-rw-r--r--      4969 2016-12-04 06:07 imagickpixel.getcolorcount.html
-rw-r--r--      6365 2016-12-04 06:07 function.output-reset-rewrite-vars.html
-rw-r--r--     10348 2016-12-04 06:08 function.snmp-set-valueretrieval.html
-rw-r--r--      1391 2016-12-04 06:07 ibm-db2.resources.html
-rw-r--r--      3356 2016-12-04 06:07 gmagick.scaleimage.html
-rw-r--r--      2844 2016-12-04 06:08 evloop.backend.html
-rw-r--r--      9904 2016-12-04 06:07 function.oci-set-edition.html
-rw-r--r--      4685 2016-12-04 06:07 ziparchive.deletename.html
-rw-r--r--      5068 2016-12-04 06:07 function.cubrid-get-charset.html
-rw-r--r--      3302 2016-12-04 06:08 eventbase.dispatch.html
-rw-r--r--      2675 2016-12-04 06:07 function.readline-read-history.html
-rw-r--r--      7650 2016-12-04 06:07 class.mongoexception.html
-rw-r--r--      2626 2016-12-04 06:07 rarentry.isencrypted.html
-rw-r--r--      4074 2016-12-04 06:07 function.memory-get-peak-usage.html
-rw-r--r--      4848 2016-12-04 06:07 cairocontext.getlinecap.html
-rw-r--r--      5689 2016-12-04 06:07 mongoclient.gethosts.html
-rw-r--r--      7157 2016-12-04 06:08 ds-map.remove.html
-rw-r--r--      2409 2016-12-04 06:08 judy.gettype.html
-rw-r--r--      5557 2016-12-04 06:08 function.variant-idiv.html
-rw-r--r--      1340 2016-12-04 06:08 rpmreader.examples.html
-rw-r--r--      3706 2016-12-04 06:08 oauthprovider.isrequesttokenendpoint.html
-rw-r--r--     11464 2016-12-04 06:08 faq.com.html
-rw-r--r--      3707 2016-12-04 06:08 function.xmlwriter-text.html
-rw-r--r--      2433 2016-12-04 06:07 function.radius-demangle.html
-rw-r--r--      1988 2016-12-04 06:07 function.timezone-transitions-get.html
-rw-r--r--      3713 2016-12-04 06:08 function.ps-close.html
-rw-r--r--      2747 2016-12-04 06:08 evloop.verify.html
-rw-r--r--      5607 2016-12-04 06:08 class.splbool.html
-rw-r--r--      7178 2016-12-04 06:07 timezones.america.html
-rw-r--r--      4212 2016-12-04 06:07 function.msql-data-seek.html
-rw-r--r--      1812 2016-12-04 06:07 function.imap-listmailbox.html
-rw-r--r--      3205 2016-12-04 06:07 oci-collection.getelem.html
-rw-r--r--      2540 2016-12-04 06:08 solrinputdocument.clear.html
-rw-r--r--      8076 2016-12-04 06:08 tidy.repairfile.html
-rw-r--r--      2674 2016-12-04 06:08 solrinputdocument.getfieldnames.html
-rw-r--r--      4794 2016-12-04 06:08 function.fann-create-sparse-array.html
-rw-r--r--     10492 2016-12-04 06:07 tokyotyrantquery.addcond.html
-rw-r--r--      1356 2016-12-04 06:08 xmlrpc.configuration.html
-rw-r--r--      3316 2016-12-04 06:08 harupage.sethorizontalscaling.html
-rw-r--r--      3211 2016-12-04 06:07 function.newt-checkbox-tree.html
-rw-r--r--      5521 2016-12-04 06:07 rarentry.getunpackedsize.html
-rw-r--r--      2781 2016-12-04 06:08 ui-area.onkey.html
-rw-r--r--      6657 2016-12-04 06:08 sdo-das-relational.applychanges.html
-rw-r--r--      1725 2016-12-04 06:08 solr.requirements.html
-rw-r--r--      6689 2016-12-04 06:08 class.swfbutton.html
-rw-r--r--      6646 2016-12-04 06:08 class.lua.html
-rw-r--r--     22705 2016-12-04 06:08 sdodasrel.examples.two-table.html
-rw-r--r--      2649 2016-12-04 06:08 arrayiterator.seek.html
-rw-r--r--      9895 2016-12-04 06:08 class.limititerator.html
-rw-r--r--      1355 2016-12-04 06:08 ds.setup.html
-rw-r--r--      9608 2016-12-04 06:08 function.session-destroy.html
-rw-r--r--      6315 2016-12-04 06:07 datetime.gettimestamp.html
-rw-r--r--      6730 2016-12-04 06:07 book.dbplus.html
-rw-r--r--      6360 2016-12-04 06:07 function.bcpowmod.html
-rw-r--r--      2288 2016-12-04 06:07 mongocursor.getnext.html
-rw-r--r--     28089 2016-12-04 06:08 book.ui.html
-rw-r--r--      6399 2016-12-04 06:07 book.sqlite3.html
-rw-r--r--      2759 2016-12-04 06:08 splfixedarray.current.html
-rw-r--r--      2949 2016-12-04 06:08 harupage.getmiterlimit.html
-rw-r--r--      4697 2016-12-04 06:08 function.pcntl-sigtimedwait.html
-rw-r--r--      3463 2016-12-04 06:08 harupage.setdash.html
-rw-r--r--      4805 2016-12-04 06:08 reflectionclass.getinterfacenames.html
-rw-r--r--      2611 2016-12-04 06:07 gmagick.getversion.html
-rw-r--r--      8649 2016-12-04 06:07 function.imagesetbrush.html
-rw-r--r--      2311 2016-12-04 06:07 imagickdraw.getfillrule.html
-rw-r--r--      2696 2016-12-04 06:08 recursivetreeiterator.key.html
-rw-r--r--      7592 2016-12-04 06:07 imagick.exportimagepixels.html
-rw-r--r--      4439 2016-12-04 06:07 function.cubrid-lob2-tell.html
-rw-r--r--      4484 2016-12-04 06:07 function.cairo-image-surface-get-stride.html
-rw-r--r--      4538 2016-12-04 06:08 solrparams.setparam.html
-rw-r--r--      2653 2016-12-04 06:08 recursivedirectoryiterator.next.html
-rw-r--r--      5784 2016-12-04 06:08 ds-map.diff.html
-rw-r--r--      4001 2016-12-04 06:07 function.sqlite-last-error.html
-rw-r--r--      2777 2016-12-04 06:08 sdo-das-xml-document.setencoding.html
-rw-r--r--     10501 2016-12-04 06:07 phar.converttodata.html
-rw-r--r--      2984 2016-12-04 06:07 function.m-parsecommadelimited.html
-rw-r--r--      2618 2016-12-04 06:07 mpegfile.getid3v2tag.html
-rw-r--r--      4078 2016-12-04 06:07 harudoc.setinfoattr.html
-rw-r--r--      3038 2016-12-04 06:08 harupage.fillstroke.html
-rw-r--r--      1335 2016-12-04 06:08 funchand.resources.html
-rw-r--r--      2592 2016-12-04 06:08 yaf-request-abstract.ispost.html
-rw-r--r--      1509 2016-12-04 06:08 stream.setup.html
-rw-r--r--      4745 2016-12-04 06:08 xmlreader.open.html
-rw-r--r--     12051 2016-12-04 06:07 intldateformatter.parse.html
-rw-r--r--      2999 2016-12-04 06:07 function.newt-form-watch-fd.html
-rw-r--r--      2716 2016-12-04 06:07 function.trader-get-unstable-period.html
-rw-r--r--      2931 2016-12-04 06:08 haruimage.getcolorspace.html
-rw-r--r--      6695 2016-12-04 06:08 class.ui-controls-combo.html
-rw-r--r--      2904 2016-12-04 06:08 domdocument.normalizedocument.html
-rw-r--r--      4676 2016-12-04 06:07 class.mongodb-bson-persistable.html
-rw-r--r--      2478 2016-12-04 06:07 imagickdraw.getstrokewidth.html
-rw-r--r--      1315 2016-12-04 06:07 hrtime.setup.html
-rw-r--r--     10290 2016-12-04 06:08 function.eio-custom.html
-rw-r--r--      7137 2016-12-04 06:07 imagickdraw.point.html
-rw-r--r--      2682 2016-12-04 06:07 intltimezone.getdstsavings.html
-rw-r--r--      9802 2016-12-04 06:08 array.constants.html
-rw-r--r--      5309 2016-12-04 06:07 function.xdiff-string-bdiff-size.html
-rw-r--r--      9198 2016-12-04 06:08 function.fprintf.html
-rw-r--r--      6004 2016-12-04 06:07 cairocontext.fillpreserve.html
-rw-r--r--      2681 2016-12-04 06:07 mongo.tutorial.counting.html
-rw-r--r--      2905 2016-12-04 06:08 function.connection-aborted.html
-rw-r--r--      7213 2016-12-04 06:08 function.import-request-variables.html
-rw-r--r--      1332 2016-12-04 06:07 rar.configuration.html
-rw-r--r--      1707 2016-12-04 06:07 ref.xhprof.html
-rw-r--r--      2357 2016-12-04 06:08 intro.ev.html
-rw-r--r--      3383 2016-12-04 06:07 imagick.setimagepage.html
-rw-r--r--      1301 2016-12-04 06:07 cyrus.requirements.html
-rw-r--r--      1907 2016-12-04 06:07 function.date-offset-get.html
-rw-r--r--      2789 2016-12-04 06:07 function.newt-grid-free.html
-rw-r--r--      2738 2016-12-04 06:07 function.enchant-broker-get-error.html
-rw-r--r--      7791 2016-12-04 06:07 function.dirname.html
-rw-r--r--      2977 2016-12-04 06:07 function.ncurses-instr.html
-rw-r--r--      8650 2016-12-04 06:07 numberformatter.format.html
-rw-r--r--      1506 2016-12-04 06:08 stomp.setup.html
-rw-r--r--      6016 2016-12-04 06:08 quickhashintstringhash.construct.html
-rw-r--r--      5589 2016-12-04 06:07 intlchar.isualphabetic.html
-rw-r--r--      3985 2016-12-04 06:07 intlcalendar.before.html
-rw-r--r--      4941 2016-12-04 06:08 function.php-strip-whitespace.html
-rw-r--r--      9139 2016-12-04 06:08 migration55.incompatible.html
-rw-r--r--      2673 2016-12-04 06:08 yaf-dispatcher.setdefaultmodule.html
-rw-r--r--      2778 2016-12-04 06:07 function.trader-mult.html
-rw-r--r--     84718 2016-12-04 06:07 language.types.array.html
-rw-r--r--      1658 2016-12-04 06:07 configuration.html
-rw-r--r--      2302 2016-12-04 06:08 function.stream-bucket-new.html
-rw-r--r--      1916 2016-12-04 06:08 internals2.opcodes.init-ns-fcall-by-name.html
-rw-r--r--      1308 2016-12-04 06:08 stream.requirements.html
-rw-r--r--      3696 2016-12-04 06:07 gmagick.motionblurimage.html
-rw-r--r--      2830 2016-12-04 06:08 function.pdf-place-pdi-page.html
-rw-r--r--      4824 2016-12-04 06:07 pharfileinfo.getpharflags.html
-rw-r--r--      2494 2016-12-04 06:07 imagickpixel.destroy.html
-rw-r--r--     15336 2016-12-04 06:08 class.reflectionfunctionabstract.html
-rw-r--r--      2633 2016-12-04 06:08 function.svn-repos-recover.html
-rw-r--r--      4010 2016-12-04 06:07 book.calendar.html
-rw-r--r--      1834 2016-12-04 06:07 ref.password.html
-rw-r--r--     10254 2016-12-04 06:08 migration53.deprecated.html
-rw-r--r--      8030 2016-12-04 06:08 function.shmop-open.html
-rw-r--r--      3210 2016-12-04 06:07 phar.getsupportedsignatures.html
-rw-r--r--      5932 2016-12-04 06:07 function.hexdec.html
-rw-r--r--      4234 2016-12-04 06:07 mongodb.getgridfs.html
-rw-r--r--     10604 2016-12-04 06:07 mysqlnduhconnection.changeuser.html
-rw-r--r--      2462 2016-12-04 06:08 solrresponse.success.html
-rw-r--r--      9711 2016-12-04 06:07 function.ibase-connect.html
-rw-r--r--      2025 2016-12-04 06:07 function.ocilogoff.html
-rw-r--r--      2346 2016-12-04 06:08 ui-controls-label.construct.html
-rw-r--r--      2196 2016-12-04 06:08 function.pdf-create-textflow.html
-rw-r--r--     16084 2016-12-04 06:08 function.call-user-func-array.html
-rw-r--r--      1893 2016-12-04 06:08 function.pdf-setpolydash.html
-rw-r--r--      8169 2016-12-04 06:07 radius.constants.packets.html
-rw-r--r--      6218 2016-12-04 06:08 function.gupnp-service-proxy-action-set.html
-rw-r--r--     11375 2016-12-04 06:07 imagickdraw.setgravity.html
-rw-r--r--      2081 2016-12-04 06:07 imagick.gethomeurl.html
-rw-r--r--      3411 2016-12-04 06:08 function.socket-cmsg-space.html
-rw-r--r--      2974 2016-12-04 06:07 ncurses.colorconsts.html
-rw-r--r--     11272 2016-12-04 06:07 mysqlnd-ms.quickstart.mysql_fabric.html
-rw-r--r--      2567 2016-12-04 06:07 function.pspell-config-dict-dir.html
-rw-r--r--      5970 2016-12-04 06:07 imagick.smushimages.html
-rw-r--r--      2745 2016-12-04 06:08 class.ui-draw-text-font-italic.html
-rw-r--r--      4762 2016-12-04 06:08 memcached.getserverlist.html
-rw-r--r--     11270 2016-12-04 06:08 function.stream-filter-append.html
-rw-r--r--      5207 2016-12-04 06:08 soapclient.getlastrequest.html
-rw-r--r--      1520 2016-12-04 06:08 strings.setup.html
-rw-r--r--      2676 2016-12-04 06:07 function.m-connect.html
-rw-r--r--      4685 2016-12-04 06:08 sdo.installation.html
-rw-r--r--      4607 2016-12-04 06:07 mongodb.drop.html
-rw-r--r--      1816 2016-12-04 06:07 function.require-once.html
-rw-r--r--      3501 2016-12-04 06:07 function.calcul-hmac.html
-rw-r--r--      4248 2016-12-04 06:08 function.xmlwriter-set-indent.html
-rw-r--r--      2700 2016-12-04 06:08 solrquery.settermsupperbound.html
-rw-r--r--     47249 2016-12-04 06:07 functions.arguments.html
-rw-r--r--      6708 2016-12-04 06:08 function.msg-send.html
-rw-r--r--      4854 2016-12-04 06:07 function.cairo-font-options-set-hint-metrics.html
-rw-r--r--      3034 2016-12-04 06:07 function.newt-entry-set-flags.html
-rw-r--r--      1461 2016-12-04 06:07 gmp.resources.html
-rw-r--r--      1704 2016-12-04 06:07 intro.password.html
-rw-r--r--      7891 2016-12-04 06:08 function.iterator-to-array.html
-rw-r--r--      1319 2016-12-04 06:08 rpmreader.requirements.html
-rw-r--r--      5033 2016-12-04 06:07 function.mysql-field-seek.html
-rw-r--r--      1274 2016-12-04 06:07 weakref.resources.html
-rw-r--r--      7795 2016-12-04 06:07 function.imagecreatefromgd2part.html
-rw-r--r--      2758 2016-12-04 06:08 solrquery.getfacetmethod.html
-rw-r--r--     10463 2016-12-04 06:07 class.messageformatter.html
-rw-r--r--     10325 2016-12-04 06:07 function.pg-field-prtlen.html
-rw-r--r--      2862 2016-12-04 06:08 function.eio-sync.html
-rw-r--r--      6048 2016-12-04 06:07 features.file-upload.put-method.html
-rw-r--r--     10473 2016-12-04 06:07 imagickdraw.setfontstretch.html
-rw-r--r--     12196 2016-12-04 06:07 phar.decompressfiles.html
-rw-r--r--      2118 2016-12-04 06:07 function.maxdb-bind-param.html
-rw-r--r--      6899 2016-12-04 06:08 snmp.setsecurity.html
-rw-r--r--      3630 2016-12-04 06:07 class.cairofontslant.html
-rw-r--r--      2516 2016-12-04 06:07 ref.apcu.html
-rw-r--r--      6911 2016-12-04 06:07 function.random-int.html
-rw-r--r--      3247 2016-12-04 06:08 hwapi.dstofsrcanchor.html
-rw-r--r--      5876 2016-12-04 06:08 function.apache-request-headers.html
-rw-r--r--     12005 2016-12-04 06:08 book.strings.html
-rw-r--r--      4385 2016-12-04 06:08 function.mqseries-set.html
-rw-r--r--      9135 2016-12-04 06:07 locale.composelocale.html
-rw-r--r--      9727 2016-12-04 06:07 messageformatter.format.html
-rw-r--r--      2535 2016-12-04 06:07 cyrus.constants.html
-rw-r--r--      2571 2016-12-04 06:07 intro.enchant.html
-rw-r--r--      1503 2016-12-04 06:07 imap.setup.html
-rw-r--r--      4654 2016-12-04 06:08 function.ps-rect.html
-rw-r--r--      4370 2016-12-04 06:08 splfileinfo.isfile.html
-rw-r--r--      5959 2016-12-04 06:08 migration70.deprecated.html
-rw-r--r--      6444 2016-12-04 06:07 class.cairosurfacepattern.html
-rw-r--r--      4310 2016-12-04 06:07 function.apcu-sma-info.html
-rw-r--r--      2835 2016-12-04 06:08 function.rrd-first.html
-rw-r--r--     16047 2016-12-04 06:07 mysqli.overview.html
-rw-r--r--     20813 2016-12-04 06:08 function.dns-get-record.html
-rw-r--r--      1358 2016-12-04 06:08 gearman.resources.html
-rw-r--r--      3313 2016-12-04 06:07 mongo.tutorial.collection.html
-rw-r--r--      1506 2016-12-04 06:07 ifx.installation.html
-rw-r--r--      8515 2016-12-04 06:07 pdo.sqlitecreatecollation.html
-rw-r--r--      3419 2016-12-04 06:07 imagick.remapimage.html
-rw-r--r--      1291 2016-12-04 06:08 swish.requirements.html
-rw-r--r--      2581 2016-12-04 06:07 context.params.html
-rw-r--r--      7053 2016-12-04 06:08 splfileinfo.openfile.html
-rw-r--r--      2349 2016-12-04 06:08 ui-controls-group.setmargin.html
-rw-r--r--      7149 2016-12-04 06:07 mysqlnd-ms.failover.html
-rw-r--r--      2719 2016-12-04 06:08 sdo-model-property.getname.html
-rw-r--r--      5667 2016-12-04 06:07 function.intl-is-failure.html
-rw-r--r--     10468 2016-12-04 06:08 function.stream-socket-recvfrom.html
-rw-r--r--      3952 2016-12-04 06:07 error.getfile.html
-rw-r--r--      2955 2016-12-04 06:08 splfileinfo.getsize.html
-rw-r--r--     28279 2016-12-04 06:07 language.exceptions.extending.html
-rw-r--r--      6883 2016-12-04 06:08 class.yaf-exception.html
-rw-r--r--      5120 2016-12-04 06:07 function.ob-get-clean.html
-rw-r--r--      2371 2016-12-04 06:08 zmqpoll.getlasterrors.html
-rw-r--r--      3951 2016-12-04 06:07 function.mb-language.html
-rw-r--r--     13136 2016-12-04 06:07 mysqli.commit.html
-rw-r--r--      4821 2016-12-04 06:08 arrayiterator.valid.html
-rw-r--r--      8316 2016-12-04 06:08 function.eval.html
-rw-r--r--      1700 2016-12-04 06:08 posix.constants.html
-rw-r--r--     16807 2016-12-04 06:07 mysqli.examples-basic.html
-rw-r--r--      6965 2016-12-04 06:07 mysqlnd-qc.quickstart.concepts.html
-rw-r--r--      1908 2016-12-04 06:07 function.date-isodate-set.html
-rw-r--r--      3267 2016-12-04 06:07 function.dbplus-ropen.html
-rw-r--r--      1503 2016-12-04 06:07 mcve.setup.html
-rw-r--r--      4512 2016-12-04 06:08 function.get-declared-classes.html
-rw-r--r--     15308 2016-12-04 06:07 book.image.html
-rw-r--r--      2849 2016-12-04 06:08 function.closelog.html
-rw-r--r--     16591 2016-12-04 06:08 class.ds-set.html
-rw-r--r--      2334 2016-12-04 06:07 mongodb.requirements.html
-rw-r--r--      2988 2016-12-04 06:08 xmlreader.read.html
-rw-r--r--      3245 2016-12-04 06:07 gmagick.setimageblueprimary.html
-rw-r--r--      9591 2016-12-04 06:07 imagickdraw.setfontweight.html
-rw-r--r--     17053 2016-12-04 06:08 function.htmlentities.html
-rw-r--r--      6273 2016-12-04 06:08 function.variant-or.html
-rw-r--r--      4617 2016-12-04 06:07 cairolineargradient.construct.html
-rw-r--r--      8248 2016-12-04 06:08 function.is-soap-fault.html
-rw-r--r--      2698 2016-12-04 06:08 evwatcher.feed.html
-rw-r--r--      7308 2016-12-04 06:07 imagick.transparentpaintimage.html
-rw-r--r--      5175 2016-12-04 06:07 function.imap-fetchmime.html
-rw-r--r--      1685 2016-12-04 06:08 swish.installation.html
-rw-r--r--      1512 2016-12-04 06:08 regex.setup.html
-rw-r--r--      6468 2016-12-04 06:07 function.dbase-pack.html
-rw-r--r--      6304 2016-12-04 06:07 tokyotyrant.putcat.html
-rw-r--r--      2897 2016-12-04 06:07 function.getrandmax.html
-rw-r--r--      4874 2016-12-04 06:07 cairocontext.getmiterlimit.html
-rw-r--r--      6227 2016-12-04 06:07 function.ncurses-color-set.html
-rw-r--r--      8813 2016-12-04 06:07 function.imagerotate.html
-rw-r--r--      6338 2016-12-04 06:07 function.mssql-get-last-message.html
-rw-r--r--     13687 2016-12-04 06:08 evtimer.construct.html
-rw-r--r--      1386 2016-12-04 06:08 com.examples.html
-rw-r--r--      4667 2016-12-04 06:08 book.sam.html
-rw-r--r--      1493 2016-12-04 06:08 chdb.setup.html
-rw-r--r--     11008 2016-12-04 06:08 soapserver.setpersistence.html
-rw-r--r--     17862 2016-12-04 06:08 function.money-format.html
-rw-r--r--      3847 2016-12-04 06:07 function.enchant-broker-set-ordering.html
-rw-r--r--      4035 2016-12-04 06:07 mongocursor.partial.html
-rw-r--r--      2367 2016-12-04 06:07 imagick.getimageunits.html
-rw-r--r--     23096 2016-12-04 06:07 mongocollection.find.html
-rw-r--r--      5950 2016-12-04 06:08 function.gupnp-service-notify.html
-rw-r--r--      5249 2016-12-04 06:08 function.yp-first.html
-rw-r--r--      2443 2016-12-04 06:08 function.pdf-open-pdi-page.html
-rw-r--r--      4744 2016-12-04 06:08 book.sync.html
-rw-r--r--     10574 2016-12-04 06:08 function.strcspn.html
-rw-r--r--     25560 2016-12-04 06:07 function.oci-define-by-name.html
-rw-r--r--      2349 2016-12-04 06:08 swfbutton.addasound.html
-rw-r--r--      5083 2016-12-04 06:08 ds-vector.merge.html
-rw-r--r--      5957 2016-12-04 06:08 class.ui-controls-progress.html
-rw-r--r--      1241 2016-12-04 06:08 win32ps.constants.html
-rw-r--r--      2076 2016-12-04 06:08 migration51.changes.html
-rw-r--r--      2565 2016-12-04 06:07 function.ncurses-flushinp.html
-rw-r--r--      3419 2016-12-04 06:08 win32service.constants.controlsaccepted.html
-rw-r--r--      8183 2016-12-04 06:08 memcached.increment.html
-rw-r--r--      5922 2016-12-04 06:07 function.id3-get-version.html
-rw-r--r--      8095 2016-12-04 06:07 function.rand.html
-rw-r--r--      1508 2016-12-04 06:07 exif.setup.html
-rw-r--r--      3597 2016-12-04 06:08 harupage.setrgbstroke.html
-rw-r--r--      3968 2016-12-04 06:07 function.log-killcursor.html
-rw-r--r--      8763 2016-12-04 06:08 function.ldap-add.html
-rw-r--r--      3578 2016-12-04 06:08 xsltprocessor.hasexsltsupport.html
-rw-r--r--      6122 2016-12-04 06:07 cairomatrix.initrotate.html
-rw-r--r--      2826 2016-12-04 06:08 solrquery.getfacetdateother.html
-rw-r--r--      2786 2016-12-04 06:08 refs.utilspec.windows.html
-rw-r--r--      3152 2016-12-04 06:07 function.newt-grid-add-components-to-form.html
-rw-r--r--      2150 2016-12-04 06:07 function.ocistatementtype.html
-rw-r--r--      3161 2016-12-04 06:08 function.stream-supports-lock.html
-rw-r--r--      1931 2016-12-04 06:07 function.timezone-offset-get.html
-rw-r--r--      2581 2016-12-04 06:07 imagickpixeliterator.destroy.html
-rw-r--r--     18726 2016-12-04 06:08 function.list.html
-rw-r--r--      6394 2016-12-04 06:07 mongopool.getsize.html
-rw-r--r--      3084 2016-12-04 06:07 imagickdraw.pathmovetorelative.html
-rw-r--r--      2912 2016-12-04 06:08 yaf-config-ini.set.html
-rw-r--r--      2143 2016-12-04 06:08 hwapi.content-mimetype.html
-rw-r--r--      2484 2016-12-04 06:07 book.inotify.html
-rw-r--r--      3341 2016-12-04 06:07 function.zip-entry-compressedsize.html
-rw-r--r--      2358 2016-12-04 06:08 ui-window.add.html
-rw-r--r--      3556 2016-12-04 06:08 function.variant-set-type.html
-rw-r--r--      5882 2016-12-04 06:08 eventsslcontext.construct.html
-rw-r--r--      4750 2016-12-04 06:07 class.cairosubpixelorder.html
-rw-r--r--     13191 2016-12-04 06:07 function.maxdb-use-result.html
-rw-r--r--      5908 2016-12-04 06:08 directoryiterator.valid.html
-rw-r--r--      3720 2016-12-04 06:08 class.ui-menuitem.html
-rw-r--r--      2500 2016-12-04 06:07 imagick.clampimage.html
-rw-r--r--      2532 2016-12-04 06:07 imagickdraw.getstrokedashoffset.html
-rw-r--r--      6010 2016-12-04 06:08 function.geoip-id-by-name.html
-rw-r--r--      1293 2016-12-04 06:07 bc.resources.html
-rw-r--r--      6404 2016-12-04 06:08 yaf-application.clearlasterror.html
-rw-r--r--      2732 2016-12-04 06:07 sqlsrv.installation.html
-rw-r--r--     13689 2016-12-04 06:08 samconnection.send.html
-rw-r--r--      3785 2016-12-04 06:07 function.finfo-set-flags.html
-rw-r--r--      2383 2016-12-04 06:08 solrgenericresponse.destruct.html
-rw-r--r--     16413 2016-12-04 06:08 function.array-splice.html
-rw-r--r--      7667 2016-12-04 06:07 mongocursor.timeout.html
-rw-r--r--      2836 2016-12-04 06:08 iteratoriterator.key.html
-rw-r--r--      2341 2016-12-04 06:08 soapfault.tostring.html
-rw-r--r--      2766 2016-12-04 06:08 reflectionparameter.isvariadic.html
-rw-r--r--     23365 2016-12-04 06:08 class.zookeeper.html
-rw-r--r--      9280 2016-12-04 06:07 function.openssl-pkcs7-encrypt.html
-rw-r--r--      2848 2016-12-04 06:08 solrquery.setmltmaxwordlength.html
-rw-r--r--      2698 2016-12-04 06:08 yaf-controller-abstract.getinvokearg.html
-rw-r--r--      2668 2016-12-04 06:07 phar.fileformat.signature.html
-rw-r--r--      3073 2016-12-04 06:07 class.cairosvgversion.html
-rw-r--r--      6489 2016-12-04 06:08 directoryiterator.getextension.html
-rw-r--r--      4121 2016-12-04 06:07 language.namespaces.definition.html
-rw-r--r--      4052 2016-12-04 06:07 function.mb-ereg-search-getpos.html
-rw-r--r--      8264 2016-12-04 06:07 language.oop5.serialization.html
-rw-r--r--      1335 2016-12-04 06:08 classkit.resources.html
-rw-r--r--      4133 2016-12-04 06:07 function.sqlite-has-prev.html
-rw-r--r--      5743 2016-12-04 06:08 function.eio-sendfile.html
-rw-r--r--      2626 2016-12-04 06:08 function.svn-fs-txn-root.html
-rw-r--r--      5474 2016-12-04 06:08 function.eio-chmod.html
-rw-r--r--      7356 2016-12-04 06:07 imagickpixeliterator.clear.html
-rw-r--r--      6763 2016-12-04 06:07 language.namespaces.fallback.html
-rw-r--r--      2855 2016-12-04 06:07 apcuiterator.key.html
-rw-r--r--      3521 2016-12-04 06:07 function.ncurses-mvvline.html
-rw-r--r--     18618 2016-12-04 06:07 function.mysqlnd-qc-get-core-stats.html
-rw-r--r--      5295 2016-12-04 06:08 function.fann-set-scaling-params.html
-rw-r--r--      3003 2016-12-04 06:07 ref.mysqlnd-qc.html
-rw-r--r--      2797 2016-12-04 06:08 solrquery.removehighlightfield.html
-rw-r--r--      8865 2016-12-04 06:07 mongocommandcursor.info.html
-rw-r--r--      6216 2016-12-04 06:08 sdo-das-relational.construct.html
-rw-r--r--      5453 2016-12-04 06:07 phar.count.html
-rw-r--r--      1377 2016-12-04 06:08 xmlreader.configuration.html
-rw-r--r--      2542 2016-12-04 06:08 solrdocument.valid.html
-rw-r--r--      4264 2016-12-04 06:08 splfileinfo.isdir.html
-rw-r--r--      5257 2016-12-04 06:07 intlchar.getnumericvalue.html
-rw-r--r--      1880 2016-12-04 06:07 mongodb.installation.html
-rw-r--r--      3988 2016-12-04 06:07 function.fdf-set-ap.html
-rw-r--r--      3249 2016-12-04 06:08 sdo-model-type.isopentype.html
-rw-r--r--      2948 2016-12-04 06:07 ref.errorfunc.html
-rw-r--r--      8590 2016-12-04 06:07 function.imagestring.html
-rw-r--r--      2720 2016-12-04 06:07 function.newt-scale-set.html
-rw-r--r--      4526 2016-12-04 06:08 reflectionclass.isinterface.html
-rw-r--r--      9201 2016-12-04 06:08 book.ps.html
-rw-r--r--      3022 2016-12-04 06:07 function.newt-checkbox-tree-get-multi-selection.html
-rw-r--r--      3315 2016-12-04 06:07 function.dbplus-open.html
-rw-r--r--      2174 2016-12-04 06:07 runkit.installation.html
-rw-r--r--     21854 2016-12-04 06:07 mysqlnd-ms.quickstart.xa_transactions.html
-rw-r--r--      7190 2016-12-04 06:07 function.radius-put-vendor-attr.html
-rw-r--r--      1315 2016-12-04 06:08 shmop.examples.html
-rw-r--r--      3213 2016-12-04 06:08 soapserver.setobject.html
-rw-r--r--      4591 2016-12-04 06:08 internals2.opcodes.fetch-obj-r.html
-rw-r--r--      4523 2016-12-04 06:07 ref.wincache.html
-rw-r--r--      2546 2016-12-04 06:08 haruimage.getsize.html
-rw-r--r--      3198 2016-12-04 06:08 ref.xmlrpc.html
-rw-r--r--      7641 2016-12-04 06:08 quickhashstringinthash.update.html
-rw-r--r--      5025 2016-12-04 06:08 function.svn-blame.html
-rw-r--r--      1933 2016-12-04 06:07 function.date-timezone-get.html
-rw-r--r--      1326 2016-12-04 06:08 net-gopher.requirements.html
-rw-r--r--     27319 2016-12-04 06:07 language.oop5.magic.html
-rw-r--r--      2254 2016-12-04 06:07 function.fdf-remove-item.html
-rw-r--r--      9002 2016-12-04 06:08 class.ui-draw-path.html
-rw-r--r--     11162 2016-12-04 06:07 function.debug-backtrace.html
-rw-r--r--      6149 2016-12-04 06:08 function.ftp-exec.html
-rw-r--r--      5591 2016-12-04 06:07 function.odbc-result.html
-rw-r--r--      4688 2016-12-04 06:08 memcached.callbacks.read-through.html
-rw-r--r--     15118 2016-12-04 06:07 mongocollection.remove.html
-rw-r--r--      1837 2016-12-04 06:07 intro.inclued.html
-rw-r--r--      5877 2016-12-04 06:07 language.variables.predefined.html
-rw-r--r--      9970 2016-12-04 06:07 mongodb.authenticate.html
-rw-r--r--      4023 2016-12-04 06:07 pdo.pgsqlcopytofile.html
-rw-r--r--      5313 2016-12-04 06:07 imagick.radialblurimage.html
-rw-r--r--      3023 2016-12-04 06:07 function.ifx-textasvarchar.html
-rw-r--r--     11575 2016-12-04 06:08 reflectionfunction.construct.html
-rw-r--r--     19682 2016-12-04 06:07 imagickdraw.bezier.html
-rw-r--r--      7552 2016-12-04 06:08 function.uniqid.html
-rw-r--r--      3705 2016-12-04 06:08 solrinputdocument.getchilddocumentscount.html
-rw-r--r--      2877 2016-12-04 06:07 function.openssl-x509-read.html
-rw-r--r--      4899 2016-12-04 06:07 imagick.medianfilterimage.html
-rw-r--r--      9335 2016-12-04 06:08 function.exit.html
-rw-r--r--      5061 2016-12-04 06:07 phar.getsupportedcompression.html
-rw-r--r--      4399 2016-12-04 06:07 function.cli-get-process-title.html
-rw-r--r--      5398 2016-12-04 06:07 function.imagecreatefromgd2.html
-rw-r--r--      3878 2016-12-04 06:07 function.fbsql-drop-db.html
-rw-r--r--      2104 2016-12-04 06:07 function.maxdb-execute.html
-rw-r--r--      5326 2016-12-04 06:07 cairocontext.setmatrix.html
-rw-r--r--     11960 2016-12-04 06:08 class.simplexmliterator.html
-rw-r--r--      8316 2016-12-04 06:07 install.unix.nginx.html
-rw-r--r--      6481 2016-12-04 06:07 function.gmp-hamdist.html
-rw-r--r--      3000 2016-12-04 06:08 migration5.configuration.html
-rw-r--r--      5183 2016-12-04 06:07 cairocontext.mask.html
-rw-r--r--      9422 2016-12-04 06:08 yaml.examples.html
-rw-r--r--      6532 2016-12-04 06:08 function.snmp2-walk.html
-rw-r--r--     38071 2016-12-04 06:08 class.ev.html
-rw-r--r--      7579 2016-12-04 06:07 function.fbsql-create-blob.html
-rw-r--r--      8156 2016-12-04 06:07 function.mysqlnd-uh-convert-to-mysqlnd.html
-rw-r--r--      8128 2016-12-04 06:07 mongocursor.awaitdata.html
-rw-r--r--      3435 2016-12-04 06:08 ui-draw-path.arcto.html
-rw-r--r--      2211 2016-12-04 06:07 phar.fileformat.tar.html
-rw-r--r--      3527 2016-12-04 06:08 domelement.getattributenode.html
-rw-r--r--      3244 2016-12-04 06:08 reflectionproperty.getmodifiers.html
-rw-r--r--      3093 2016-12-04 06:07 function.newt-checkbox-set-flags.html
-rw-r--r--      8923 2016-12-04 06:07 closure.bindto.html
-rw-r--r--      3399 2016-12-04 06:08 zookeeper.getstate.html
-rw-r--r--      3394 2016-12-04 06:07 function.openal-context-create.html
-rw-r--r--      9088 2016-12-04 06:08 sdo-das-datafactory.addpropertytotype.html
-rw-r--r--      5357 2016-12-04 06:07 function.ncurses-wborder.html
-rw-r--r--      3023 2016-12-04 06:08 yaf-request-abstract.getparam.html
-rw-r--r--      6806 2016-12-04 06:07 class.mongodb-driver-exception-connectionexception.html
-rw-r--r--      5595 2016-12-04 06:08 function.eio-readahead.html
-rw-r--r--      2601 2016-12-04 06:07 function.mysqli-bind-param.html
-rw-r--r--      2921 2016-12-04 06:07 function.ncurses-flash.html
-rw-r--r--     19156 2016-12-04 06:07 function.mysqlnd-ms-set-user-pick-server.html
-rw-r--r--      3505 2016-12-04 06:07 function.apd-continue.html
-rw-r--r--      2984 2016-12-04 06:07 intltimezone.geterrormessage.html
-rw-r--r--      3543 2016-12-04 06:07 mhash.examples.html
-rw-r--r--      4100 2016-12-04 06:07 install.cloud.azure.html
-rw-r--r--      3461 2016-12-04 06:08 migration54.classes.html
-rw-r--r--      4468 2016-12-04 06:08 ds-set.copy.html
-rw-r--r--      3440 2016-12-04 06:08 hwapi.lock.html
-rw-r--r--      2743 2016-12-04 06:08 zmqdevice.settimertimeout.html
-rw-r--r--      2490 2016-12-04 06:07 function.trader-cos.html
-rw-r--r--      5461 2016-12-04 06:07 function.mailparse-rfc822-parse-addresses.html
-rw-r--r--      4368 2016-12-04 06:07 exception.gettraceasstring.html
-rw-r--r--      3731 2016-12-04 06:08 sdo-sequence.move.html
-rw-r--r--      4048 2016-12-04 06:08 sphinx.examples.html
-rw-r--r--      9679 2016-12-04 06:08 yaf-route-map.construct.html
-rw-r--r--      9739 2016-12-04 06:07 imagickdraw.setfont.html
-rw-r--r--      7158 2016-12-04 06:08 syncsharedmemory.read.html
-rw-r--r--      7242 2016-12-04 06:08 reflectionclass.getdefaultproperties.html
-rw-r--r--      4139 2016-12-04 06:07 function.mailparse-msg-extract-part.html
-rw-r--r--      5387 2016-12-04 06:08 function.eio-utime.html
-rw-r--r--      5988 2016-12-04 06:07 function.lchown.html
-rw-r--r--     11605 2016-12-04 06:08 sca.examples.understanding-wsdl.html
-rw-r--r--      4971 2016-12-04 06:07 cairocontext.getfontface.html
-rw-r--r--      1873 2016-12-04 06:08 stream.filters.html
-rw-r--r--      5289 2016-12-04 06:07 imagick.setpointsize.html
-rw-r--r--      4859 2016-12-04 06:07 function.cairo-pdf-surface-create.html
-rw-r--r--      4095 2016-12-04 06:08 book.stomp.html
-rw-r--r--      2135 2016-12-04 06:07 dio.installation.html
-rw-r--r--      7077 2016-12-04 06:07 function.mysqlnd-ms-match-wild.html
-rw-r--r--      5186 2016-12-04 06:07 reserved.variables.post.html
-rw-r--r--      3262 2016-12-04 06:07 function.trader-cdl3blackcrows.html
-rw-r--r--      3057 2016-12-04 06:08 swfsoundinstance.loopinpoint.html
-rw-r--r--      2828 2016-12-04 06:07 mongodb.selectcollection.html
-rw-r--r--      9845 2016-12-04 06:08 solrclient.query.html
-rw-r--r--      1558 2016-12-04 06:07 mcrypt.installation.html
-rw-r--r--      2493 2016-12-04 06:07 imagickdraw.gettextinterwordspacing.html
-rw-r--r--     29552 2016-12-04 06:07 pdostatement.fetch.html
-rw-r--r--      2448 2016-12-04 06:08 evwatcher.getloop.html
-rw-r--r--      2753 2016-12-04 06:07 function.ncurses-putp.html
-rw-r--r--      4090 2016-12-04 06:08 eventhttprequest.sendreply.html
-rw-r--r--      9630 2016-12-04 06:08 reflectionproperty.setvalue.html
-rw-r--r--      3517 2016-12-04 06:07 function.ncurses-mvhline.html
-rw-r--r--      2758 2016-12-04 06:07 book.mysqlnd-memcache.html
-rw-r--r--      1844 2016-12-04 06:07 enchant.requirements.html
-rw-r--r--      3540 2016-12-04 06:07 cairopattern.construct.html
-rw-r--r--      2700 2016-12-04 06:07 function.px-delete.html
-rw-r--r--      3454 2016-12-04 06:08 multipleiterator.containsiterator.html
-rw-r--r--      3514 2016-12-04 06:07 function.dbplus-getunique.html
-rw-r--r--      3694 2016-12-04 06:08 ref.mnogosearch.html
-rw-r--r--      4844 2016-12-04 06:08 function.apache-response-headers.html
-rw-r--r--      2474 2016-12-04 06:07 oci-collection.size.html
-rw-r--r--      2468 2016-12-04 06:08 function.event-base-free.html
-rw-r--r--      3063 2016-12-04 06:08 swfsoundinstance.loopoutpoint.html
-rw-r--r--      2263 2016-12-04 06:07 book.inclued.html
-rw-r--r--      1580 2016-12-04 06:08 sdodasrel.setup.html
-rw-r--r--      5481 2016-12-04 06:07 tokyotyrant.setmaster.html
-rw-r--r--      1349 2016-12-04 06:07 mime-magic.resources.html
-rw-r--r--      2933 2016-12-04 06:08 class.yaf-exception-dispatchfailed.html
-rw-r--r--      7535 2016-12-04 06:08 migration54.ini.html
-rw-r--r--      3005 2016-12-04 06:08 eventbuffer.add.html
-rw-r--r--      1294 2016-12-04 06:08 exec.requirements.html
-rw-r--r--      4004 2016-12-04 06:08 sdodasrel.requirements.html
-rw-r--r--      2371 2016-12-04 06:08 function.ldap-parse-reference.html
-rw-r--r--      2353 2016-12-04 06:07 function.ncurses-slk-refresh.html
-rw-r--r--      3430 2016-12-04 06:08 harupage.showtext.html
-rw-r--r--      3058 2016-12-04 06:07 function.newt-grid-v-close-stacked.html
-rw-r--r--      2976 2016-12-04 06:08 function.ldap-unbind.html
-rw-r--r--     10849 2016-12-04 06:08 faq.mailinglist.html
-rw-r--r--      2828 2016-12-04 06:08 eventhttprequest.getcommand.html
-rw-r--r--      3803 2016-12-04 06:08 reflectionparameter.export.html
-rw-r--r--      1849 2016-12-04 06:07 language.errors.html
-rw-r--r--      3667 2016-12-04 06:07 intlchar.foldcase.html
-rw-r--r--      2509 2016-12-04 06:07 function.trader-asin.html
-rw-r--r--      2790 2016-12-04 06:08 swfvideostream.setdimension.html
-rw-r--r--      3010 2016-12-04 06:08 svmmodel.construct.html
-rw-r--r--      1384 2016-12-04 06:07 mysql.examples.html
-rw-r--r--      7687 2016-12-04 06:07 imagick.levelimage.html
-rw-r--r--      5416 2016-12-04 06:08 function.rpm-get-tag.html
-rw-r--r--      1597 2016-12-04 06:08 intro.tokenizer.html
-rw-r--r--      7214 2016-12-04 06:07 mysqlnduhconnection.endpsession.html
-rw-r--r--      2531 2016-12-04 06:07 recode.installation.html
-rw-r--r--      3692 2016-12-04 06:07 function.sybase-min-client-severity.html
drwxr-xr-x         0 2016-12-04 06:08 images/
-rw-r--r--       712 2016-12-04 06:07 images/21009b70229598c6a80eef8b45bf282b-imagefilledarc.png
-rw-r--r--     31908 2016-12-04 06:07 images/fa7c5b5f326e3c4a6cc9db19e7edbaf0-xkcd-bobby-tables.png
-rw-r--r--     26214 2016-12-04 06:07 images/0baa1b9fae6aec55bbb73037f3016001-xkcd-goto.png
-rw-r--r--       108 2016-12-04 06:07 images/21009b70229598c6a80eef8b45bf282b-imagecharup.png
-rw-r--r--      1254 2016-12-04 06:07 images/21009b70229598c6a80eef8b45bf282b-imagecopy.gif
-rw-r--r--      1608 2016-12-04 06:07 images/21009b70229598c6a80eef8b45bf282b-imagecreatefromjpeg.jpg
-rw-r--r--      1266 2016-12-04 06:07 images/21009b70229598c6a80eef8b45bf282b-imageconvolution_gaussian.png
-rw-r--r--     17535 2016-12-04 06:08 images/befd863081615f539082d9ff76bf7b39-zend.04-cross-converter.png
-rw-r--r--      5968 2016-12-04 06:07 images/12f37b1c6963c1c5c18f30495416a197-loop-array.png
-rw-r--r--    189105 2016-12-04 06:07 images/21009b70229598c6a80eef8b45bf282b-watermarks.png
-rw-r--r--       521 2016-12-04 06:07 images/c0d23d2d6769e53e24a1b3136c064577-floodfillpaint_result.png
-rw-r--r--     22096 2016-12-04 06:07 images/21009b70229598c6a80eef8b45bf282b-imagesettile.png
-rw-r--r--      9586 2016-12-04 06:07 images/c0d23d2d6769e53e24a1b3136c064577-hello_world_reflection.png
-rw-r--r--      8398 2016-12-04 06:07 images/b4cf2bb34e3c20eebcf8f9e8e7949efd-iis6defaultdoc.png
-rw-r--r--       107 2016-12-04 06:07 images/21009b70229598c6a80eef8b45bf282b-imagechar.png
-rw-r--r--      9414 2016-12-04 06:07 images/55c7816ef6df6821f05678a68b4e4e63-mymemflow.png
-rw-r--r--     25905 2016-12-04 06:07 images/b4cf2bb34e3c20eebcf8f9e8e7949efd-iis6anonauth.png
-rw-r--r--      7025 2016-12-04 06:08 images/befd863081615f539082d9ff76bf7b39-zend.07-warning-messages.png
-rw-r--r--       287 2016-12-04 06:07 images/21009b70229598c6a80eef8b45bf282b-imagefill.png
-rw-r--r--       287 2016-12-04 06:07 images/21009b70229598c6a80eef8b45bf282b-imagecreatetruecolor.png
-rw-r--r--       917 2016-12-04 06:07 images/21009b70229598c6a80eef8b45bf282b-imagelayereffect.png
-rw-r--r--      2268 2016-12-04 06:07 images/21009b70229598c6a80eef8b45bf282b-imagettftext.png
-rw-r--r--      1874 2016-12-04 06:07 images/21009b70229598c6a80eef8b45bf282b-imagesetbrush.png
-rw-r--r--      5978 2016-12-04 06:07 images/c0d23d2d6769e53e24a1b3136c064577-adaptiveBlurImage.gif
-rw-r--r--       178 2016-12-04 06:07 images/21009b70229598c6a80eef8b45bf282b-imagecreate.png
-rw-r--r--     10201 2016-12-04 06:07 images/12f37b1c6963c1c5c18f30495416a197-simple-array2.png
-rw-r--r--      2629 2016-12-04 06:07 images/21009b70229598c6a80eef8b45bf282b-imagesetstyle.jpg
-rw-r--r--       221 2016-12-04 06:07 images/21009b70229598c6a80eef8b45bf282b-imagecreatefromgif.gif
-rw-r--r--      1474 2016-12-04 06:07 images/21009b70229598c6a80eef8b45bf282b-imageellipse.png
-rw-r--r--     30544 2016-12-04 06:07 images/b4cf2bb34e3c20eebcf8f9e8e7949efd-iis7handlermap.png
-rw-r--r--     62231 2016-12-04 06:07 images/12f37b1c6963c1c5c18f30495416a197-gc-benchmark.png
-rw-r--r--       140 2016-12-04 06:07 images/21009b70229598c6a80eef8b45bf282b-imagecolortransparent.png
-rw-r--r--      5018 2016-12-04 06:07 images/21009b70229598c6a80eef8b45bf282b-imagefilterpixelate.png
-rw-r--r--       497 2016-12-04 06:07 images/c0d23d2d6769e53e24a1b3136c064577-floodfillpaint_intermediate.png
-rw-r--r--     17127 2016-12-04 06:07 images/21009b70229598c6a80eef8b45bf282b-imagecopyresampled_2.jpg
-rw-r--r--       377 2016-12-04 06:07 images/21009b70229598c6a80eef8b45bf282b-imagesetthickness.png
-rw-r--r--      1443 2016-12-04 06:07 images/21009b70229598c6a80eef8b45bf282b-imageantialias.png
-rw-r--r--     18502 2016-12-04 06:08 images/befd863081615f539082d9ff76bf7b39-zend.01-internal-structure.png
-rw-r--r--     73387 2016-12-04 06:08 images/4fd86c7f1b197d1d954ad0f4b033dc93-yar.png
-rw-r--r--      9665 2016-12-04 06:08 images/befd863081615f539082d9ff76bf7b39-zend.09-execution-info.png
-rw-r--r--      3403 2016-12-04 06:07 images/c0d23d2d6769e53e24a1b3136c064577-distortImage.png
-rw-r--r--     50382 2016-12-04 06:07 images/f3bc48edf40d5e3e09a166c7fadc7efb-driver_arch.png
-rw-r--r--     19547 2016-12-04 06:08 images/befd863081615f539082d9ff76bf7b39-zend.06-variable-creation.png
-rw-r--r--      2350 2016-12-04 06:07 images/c0d23d2d6769e53e24a1b3136c064577-functionImage_polynomial.png
-rw-r--r--    103817 2016-12-04 06:08 images/2a34c7f2e658f6ae74f3869f2aa5886f-crypt-text-rendered.svg
-rw-r--r--      5630 2016-12-04 06:07 images/c0d23d2d6769e53e24a1b3136c064577-hello_world.png
-rw-r--r--     37752 2016-12-04 06:07 images/e88cefb5c3fca5060e2490b9763c4433-readfile.png
-rw-r--r--       379 2016-12-04 06:07 images/21009b70229598c6a80eef8b45bf282b-imagestringup.png
-rw-r--r--     54553 2016-12-04 06:07 images/b4cf2bb34e3c20eebcf8f9e8e7949efd-iis7w2k8cgi.png
-rw-r--r--      1301 2016-12-04 06:07 images/21009b70229598c6a80eef8b45bf282b-imagejpeg.jpg
-rw-r--r--     19682 2016-12-04 06:08 images/befd863081615f539082d9ff76bf7b39-zend.05-reference-test.png
-rw-r--r--      2859 2016-12-04 06:07 images/21009b70229598c6a80eef8b45bf282b-imagecolorallocatealpha.png
-rw-r--r--      1288 2016-12-04 06:07 images/21009b70229598c6a80eef8b45bf282b-imagefilledpolygon.png
-rw-r--r--      1301 2016-12-04 06:07 images/21009b70229598c6a80eef8b45bf282b-imagecopyresized.jpg
-rw-r--r--     55381 2016-12-04 06:07 images/b4cf2bb34e3c20eebcf8f9e8e7949efd-iis7handlericon.png
-rw-r--r--      2373 2016-12-04 06:07 images/c0d23d2d6769e53e24a1b3136c064577-functionImage_sinusoidal.png
-rw-r--r--     48022 2016-12-04 06:07 images/b4cf2bb34e3c20eebcf8f9e8e7949efd-iis7vistacgi.png
-rw-r--r--     22197 2016-12-04 06:08 images/befd863081615f539082d9ff76bf7b39-zend.08-phpinfo-output.png
-rw-r--r--      2453 2016-12-04 06:07 images/c0d23d2d6769e53e24a1b3136c064577-functionImage_multiplied.png
-rw-r--r--      1480 2016-12-04 06:07 images/21009b70229598c6a80eef8b45bf282b-imagepolygon.png
-rw-r--r--       376 2016-12-04 06:07 images/21009b70229598c6a80eef8b45bf282b-imagecreatefrompng.png
-rw-r--r--       530 2016-12-04 06:07 images/21009b70229598c6a80eef8b45bf282b-imagefilltoborder.png
-rw-r--r--      1696 2016-12-04 06:07 images/21009b70229598c6a80eef8b45bf282b-imagearc.png
-rw-r--r--       138 2016-12-04 06:07 images/21009b70229598c6a80eef8b45bf282b-imagecreatefromstring.png
-rw-r--r--    193967 2016-12-04 06:07 images/21009b70229598c6a80eef8b45bf282b-watermark-merged.png
-rw-r--r--      1214 2016-12-04 06:07 images/21009b70229598c6a80eef8b45bf282b-imagecopyresampled.jpg
-rw-r--r--     30936 2016-12-04 06:07 images/12f37b1c6963c1c5c18f30495416a197-gc-algorithm.png
-rw-r--r--      5348 2016-12-04 06:07 images/12f37b1c6963c1c5c18f30495416a197-leak-array.png
-rw-r--r--      6804 2016-12-04 06:07 images/21009b70229598c6a80eef8b45bf282b-imagerotate.jpg
-rw-r--r--      9359 2016-12-04 06:07 images/12f37b1c6963c1c5c18f30495416a197-simple-array.png
-rw-r--r--      3004 2016-12-04 06:07 images/21009b70229598c6a80eef8b45bf282b-imageconvolution_emboss.png
-rw-r--r--      2419 2016-12-04 06:07 images/21009b70229598c6a80eef8b45bf282b-imagesetpixel.png
-rw-r--r--      1724 2016-12-04 06:07 images/21009b70229598c6a80eef8b45bf282b-imagefilledellipse.png
-rw-r--r--     21269 2016-12-04 06:07 images/c0d23d2d6769e53e24a1b3136c064577-php_logo.png
-rw-r--r--      3108 2016-12-04 06:07 images/21009b70229598c6a80eef8b45bf282b-imagerectangle.jpg
-rw-r--r--       167 2016-12-04 06:07 images/21009b70229598c6a80eef8b45bf282b-imagedashedline.png
-rw-r--r--       979 2016-12-04 06:07 images/21009b70229598c6a80eef8b45bf282b-imageopenpolygon.png
-rw-r--r--       125 2016-12-04 06:07 images/21009b70229598c6a80eef8b45bf282b-imagefilledrectangle.png
-rw-r--r--       175 2016-12-04 06:07 images/21009b70229598c6a80eef8b45bf282b-imagestring.png
-rw-r--r--      2237 2016-12-04 06:07 images/21009b70229598c6a80eef8b45bf282b-imagefliphorizontal.png
-rw-r--r--      2223 2016-12-04 06:07 images/21009b70229598c6a80eef8b45bf282b-imageflipvertical.png
-rw-r--r--       346 2016-12-04 06:07 images/c0d23d2d6769e53e24a1b3136c064577-importimagepixels.jpg
-rw-r--r--     10823 2016-12-04 06:07 function.hash.html
-rw-r--r--      5593 2016-12-04 06:08 splobjectstorage.detach.html
-rw-r--r--      6519 2016-12-04 06:08 class.zmqdevice.html
-rw-r--r--      3498 2016-12-04 06:08 eventbuffer.write.html
-rw-r--r--      7829 2016-12-04 06:07 function.pg-fetch-result.html
-rw-r--r--      2380 2016-12-04 06:07 gmagick.getimageunits.html
-rw-r--r--     13149 2016-12-04 06:08 function.define-syslog-variables.html
-rw-r--r--      7833 2016-12-04 06:07 intlchar.enumcharnames.html
-rw-r--r--      2866 2016-12-04 06:07 intltimezone.hassamerules.html
-rw-r--r--      5346 2016-12-04 06:08 class.yar-client.html
-rw-r--r--      3456 2016-12-04 06:08 function.fann-get-cascade-min-cand-epochs.html
-rw-r--r--      4707 2016-12-04 06:07 mysqli.more-results.html
-rw-r--r--      5273 2016-12-04 06:07 function.date-parse-from-format.html
-rw-r--r--      1902 2016-12-04 06:08 function.pdf-set-word-spacing.html
-rw-r--r--      2471 2016-12-04 06:08 solrparams.getpreparedparams.html
-rw-r--r--      2726 2016-12-04 06:08 class.luaclosure.html
-rw-r--r--      2176 2016-12-04 06:07 intro.dio.html
-rw-r--r--      3178 2016-12-04 06:08 xsltprocessor.setsecurityprefs.html
-rw-r--r--     12660 2016-12-04 06:07 pdo.prepare.html
-rw-r--r--      9331 2016-12-04 06:08 xml.constants.html
-rw-r--r--      3382 2016-12-04 06:07 function.imap-utf7-encode.html
-rw-r--r--      6579 2016-12-04 06:07 function.hash-update-stream.html
-rw-r--r--      3445 2016-12-04 06:07 function.ob-clean.html
-rw-r--r--      1777 2016-12-04 06:08 internals2.opcodes.send-var-no-ref.html
-rw-r--r--      6034 2016-12-04 06:07 function.cubrid-num-cols.html
-rw-r--r--      2634 2016-12-04 06:07 function.trader-mom.html
-rw-r--r--      4260 2016-12-04 06:08 function.posix-setrlimit.html
-rw-r--r--      3547 2016-12-04 06:08 arrayiterator.natsort.html
-rw-r--r--      2388 2016-12-04 06:07 function.mysqli-rpl-probe.html
-rw-r--r--     24601 2016-12-04 06:07 mysqli.real-connect.html
-rw-r--r--     25180 2016-12-04 06:07 class.collator.html
-rw-r--r--      1666 2016-12-04 06:08 xmlwriter.installation.html
-rw-r--r--      2882 2016-12-04 06:07 iteratoraggregate.getiterator.html
-rw-r--r--      5804 2016-12-04 06:08 solrquery.setgrouptruncate.html
-rw-r--r--     12387 2016-12-04 06:08 class.quickhashinthash.html
-rw-r--r--      2877 2016-12-04 06:08 cachingiterator.construct.html
-rw-r--r--      8574 2016-12-04 06:07 function.fbsql-read-clob.html
-rw-r--r--      7400 2016-12-04 06:07 function.cubrid-field-table.html
-rw-r--r--      6626 2016-12-04 06:08 splobjectstorage.offsetexists.html
-rw-r--r--      5302 2016-12-04 06:07 tokyotyranttable.out.html
-rw-r--r--      2528 2016-12-04 06:07 hrtime-performancecounter.stop.html
-rw-r--r--      3768 2016-12-04 06:08 domnode.c14n.html
-rw-r--r--      6151 2016-12-04 06:07 function.mb-substitute-character.html
-rw-r--r--      8666 2016-12-04 06:08 regexp.reference.character-classes.html
-rw-r--r--     10260 2016-12-04 06:07 mysqlinfo.concepts.buffering.html
-rw-r--r--      4319 2016-12-04 06:08 domdocument.construct.html
-rw-r--r--      4126 2016-12-04 06:07 mongotimestamp.construct.html
-rw-r--r--      4564 2016-12-04 06:07 mysqli-stmt.construct.html
-rw-r--r--      3658 2016-12-04 06:08 function.win32-pause-service.html
-rw-r--r--      3304 2016-12-04 06:07 function.ifx-update-blob.html
-rw-r--r--      4938 2016-12-04 06:07 ref.pdo-odbc.connection.html
-rw-r--r--      3265 2016-12-04 06:08 spldoublylinkedlist.offsetget.html
-rw-r--r--     12138 2016-12-04 06:07 function.sqlite-fetch-all.html
-rw-r--r--      8044 2016-12-04 06:08 function.ssh2-publickey-add.html
-rw-r--r--      5376 2016-12-04 06:08 function.parsekit-func-arginfo.html
-rw-r--r--     31012 2016-12-04 06:07 ref.maxdb.html
-rw-r--r--      4200 2016-12-04 06:07 function.runkit-function-rename.html
-rw-r--r--     13211 2016-12-04 06:08 svn.constants.html
-rw-r--r--     11043 2016-12-04 06:07 filesystem.constants.html
-rw-r--r--      2610 2016-12-04 06:07 intro.zlib.html
-rw-r--r--      2654 2016-12-04 06:08 yaf-response-abstract.setheader.html
-rw-r--r--      3125 2016-12-04 06:07 function.newt-scale.html
-rw-r--r--      5509 2016-12-04 06:07 function.grapheme-strlen.html
-rw-r--r--      2467 2016-12-04 06:07 datetime.formats.html
-rw-r--r--      3187 2016-12-04 06:08 function.udm-free-ispell-data.html
-rw-r--r--      2682 2016-12-04 06:07 function.trader-roc.html
-rw-r--r--      1766 2016-12-04 06:07 ref.mhash.html
-rw-r--r--      3787 2016-12-04 06:08 function.ps-close-image.html
-rw-r--r--      2192 2016-12-04 06:07 ref.bzip2.html
-rw-r--r--      2167 2016-12-04 06:08 function.event-new.html
-rw-r--r--      2460 2016-12-04 06:08 event.setpriority.html
-rw-r--r--      5434 2016-12-04 06:07 control-structures.do.while.html
-rw-r--r--      6971 2016-12-04 06:08 migration53.methods.html
-rw-r--r--     15488 2016-12-04 06:07 function.mysqlnd-qc-get-normalized-query-trace-log.html
-rw-r--r--     27645 2016-12-04 06:08 faq.installation.html
-rw-r--r--      4855 2016-12-04 06:08 memcached.getresultmessage.html
-rw-r--r--      1795 2016-12-04 06:08 internals2.memory.html
-rw-r--r--      7454 2016-12-04 06:08 function.array-flip.html
-rw-r--r--     15549 2016-12-04 06:07 language.types.type-juggling.html
-rw-r--r--      2803 2016-12-04 06:08 reflectionproperty.tostring.html
-rw-r--r--      2459 2016-12-04 06:07 audioproperties.getsamplebitrate.html
-rw-r--r--      2238 2016-12-04 06:08 mqseries.constants.html
-rw-r--r--      2977 2016-12-04 06:08 recursiveiteratoriterator.callgetchildren.html
-rw-r--r--      3923 2016-12-04 06:08 internals2.opcodes.include-or-eval.html
-rw-r--r--      3595 2016-12-04 06:07 function.openssl-pkey-new.html
-rw-r--r--      3111 2016-12-04 06:07 function.openal-source-destroy.html
-rw-r--r--      7591 2016-12-04 06:08 splfileobject.key.html
-rw-r--r--      3606 2016-12-04 06:07 class.mongodb-bson-timestamp.html
-rw-r--r--      1238 2016-12-04 06:07 csprng.constants.html
-rw-r--r--     15867 2016-12-04 06:07 language.oop5.interfaces.html
-rw-r--r--      1760 2016-12-04 06:07 book.htscanner.html
-rw-r--r--      5074 2016-12-04 06:08 directoryiterator.getsize.html
-rw-r--r--      1791 2016-12-04 06:08 function.is-double.html
-rw-r--r--      2057 2016-12-04 06:07 refs.remote.auth.html
-rw-r--r--      1547 2016-12-04 06:08 classobj.setup.html
-rw-r--r--      5708 2016-12-04 06:07 function.password-verify.html
-rw-r--r--      1454 2016-12-04 06:07 bzip2.requirements.html
-rw-r--r--     16468 2016-12-04 06:07 features.file-upload.post-method.html
-rw-r--r--      1931 2016-12-04 06:07 mssql.installation.html
-rw-r--r--      3997 2016-12-04 06:08 ds-stack.clear.html
-rw-r--r--      4237 2016-12-04 06:08 samconnection.setdebug.html
-rw-r--r--      1363 2016-12-04 06:07 paradox.configuration.html
-rw-r--r--      5319 2016-12-04 06:07 reserved.variables.get.html
-rw-r--r--      1581 2016-12-04 06:08 chdb.requirements.html
-rw-r--r--      5345 2016-12-04 06:08 ds-priorityqueue.toarray.html
-rw-r--r--      3872 2016-12-04 06:07 cairoscaledfont.glyphextents.html
-rw-r--r--      2745 2016-12-04 06:07 mongocommandcursor.key.html
-rw-r--r--      2420 2016-12-04 06:08 solrquery.getstatsfields.html
-rw-r--r--      1198 2016-12-04 06:07 manual.html
-rw-r--r--     20673 2016-12-04 06:07 mysqli.query.html
-rw-r--r--      2680 2016-12-04 06:08 solrparams.get.html
-rw-r--r--      2127 2016-12-04 06:07 language.types.html
-rw-r--r--      5547 2016-12-04 06:07 function.inflate-init.html
-rw-r--r--      2679 2016-12-04 06:08 yaf-config-ini.offsetget.html
-rw-r--r--      3107 2016-12-04 06:07 intlbreakiterator.createcharacterinstance.html
-rw-r--r--      4051 2016-12-04 06:08 swfshape.drawcurve.html
-rw-r--r--      3254 2016-12-04 06:07 class.mongodb-bson-objectid.html
-rw-r--r--      8829 2016-12-04 06:08 function.fann-create-train-from-callback.html
-rw-r--r--      5595 2016-12-04 06:07 imagick.modulateimage.html
-rw-r--r--     13598 2016-12-04 06:07 mysqli-stmt.error-list.html
-rw-r--r--      2924 2016-12-04 06:07 apciterator.valid.html
-rw-r--r--      3127 2016-12-04 06:08 book.mqseries.html
-rw-r--r--     13335 2016-12-04 06:07 phar.uncompressallfiles.html
-rw-r--r--      6077 2016-12-04 06:07 class.throwable.html
-rw-r--r--      1807 2016-12-04 06:07 intro.math.html
-rw-r--r--      3158 2016-12-04 06:07 imagick.setimageprofile.html
-rw-r--r--      8591 2016-12-04 06:07 function.date-default-timezone-get.html
-rw-r--r--      2701 2016-12-04 06:07 gmagick.getimagehistogram.html
-rw-r--r--     11072 2016-12-04 06:07 pdostatement.debugdumpparams.html
-rw-r--r--      4498 2016-12-04 06:07 mongocode.tostring.html
-rw-r--r--      9349 2016-12-04 06:08 function.print-r.html
-rw-r--r--      5666 2016-12-04 06:08 directoryiterator.next.html
-rw-r--r--      3560 2016-12-04 06:07 mongoid.gethostname.html
-rw-r--r--      3347 2016-12-04 06:08 oauth.getcapath.html
-rw-r--r--      1632 2016-12-04 06:07 hash.installation.html
-rw-r--r--      6080 2016-12-04 06:07 imagick.getiteratorindex.html
-rw-r--r--      5217 2016-12-04 06:08 ds-set.xor.html
-rw-r--r--     13932 2016-12-04 06:07 book.cubrid.html
-rw-r--r--     21398 2016-12-04 06:07 function.oci-new-descriptor.html
-rw-r--r--      7729 2016-12-04 06:07 function.imagecolorexact.html
-rw-r--r--      5383 2016-12-04 06:07 function.pspell-save-wordlist.html
-rw-r--r--      9335 2016-12-04 06:07 numberformatter.getpattern.html
-rw-r--r--      2490 2016-12-04 06:08 internals2.opcodes.jmpz-ex.html
-rw-r--r--      2062 2016-12-04 06:07 intro.mime-magic.html
-rw-r--r--      5419 2016-12-04 06:07 class.datetimeinterface.html
-rw-r--r--      7007 2016-12-04 06:08 function.socket-getpeername.html
-rw-r--r--     15962 2016-12-04 06:08 function.array-filter.html
-rw-r--r--      3551 2016-12-04 06:07 gmagick.thumbnailimage.html
-rw-r--r--      3890 2016-12-04 06:07 mongocursor.hint.html
-rw-r--r--      7536 2016-12-04 06:07 mysqlnduhconnection.serverdumpdebuginformation.html
-rw-r--r--      8056 2016-12-04 06:07 pdo.exec.html
-rw-r--r--      3984 2016-12-04 06:07 function.newt-textbox-reflowed.html
-rw-r--r--      2328 2016-12-04 06:08 varnishadmin.auth.html
-rw-r--r--      4547 2016-12-04 06:07 function.openssl-csr-export-to-file.html
-rw-r--r--      5308 2016-12-04 06:07 class.arithmeticerror.html
-rw-r--r--      2997 2016-12-04 06:08 fannconnection.setweight.html
-rw-r--r--     15111 2016-12-04 06:08 ldap.constants.html
-rw-r--r--      2482 2016-12-04 06:08 rrdcreator.save.html
-rw-r--r--      5343 2016-12-04 06:07 function.pg-host.html
-rw-r--r--      6249 2016-12-04 06:08 function.getmxrr.html
-rw-r--r--      8290 2016-12-04 06:07 class.dateinterval.html
-rw-r--r--      4152 2016-12-04 06:07 function.dbplus-rcrtexact.html
-rw-r--r--      4168 2016-12-04 06:08 streamwrapper.stream-write.html
-rw-r--r--      4324 2016-12-04 06:07 function.fbsql-set-transaction.html
-rw-r--r--      7268 2016-12-04 06:07 mongodb-driver-writeconcernerror.getmessage.html
-rw-r--r--      5444 2016-12-04 06:08 swish.construct.html
-rw-r--r--      4756 2016-12-04 06:07 imagick.setimageorientation.html
-rw-r--r--      2880 2016-12-04 06:08 splsubject.detach.html
-rw-r--r--      3594 2016-12-04 06:07 function.sybase-field-seek.html
-rw-r--r--      6835 2016-12-04 06:07 function.uopz-function.html
-rw-r--r--      1335 2016-12-04 06:08 parsekit.resources.html
-rw-r--r--      3085 2016-12-04 06:08 internals2.opcodes.assign-obj.html
-rw-r--r--      1746 2016-12-04 06:08 ref.simplexml.html
-rw-r--r--      2974 2016-12-04 06:08 solrcollapsefunction.getsize.html
-rw-r--r--      2990 2016-12-04 06:08 harupage.movetonextline.html
-rw-r--r--     14762 2016-12-04 06:07 imagickdraw.setfillrule.html
-rw-r--r--      7313 2016-12-04 06:07 rarexception.setusingexceptions.html
-rw-r--r--      9402 2016-12-04 06:07 mongodb-driver-writeresult.getupsertedids.html
-rw-r--r--      3794 2016-12-04 06:08 function.event-add.html
-rw-r--r--      1328 2016-12-04 06:07 haru.examples.html
-rw-r--r--      6092 2016-12-04 06:07 function.runkit-function-add.html
-rw-r--r--      3245 2016-12-04 06:07 function.odbc-num-rows.html
-rw-r--r--      3877 2016-12-04 06:08 swfdisplayitem.skewyto.html
-rw-r--r--      7723 2016-12-04 06:08 function.get-parent-class.html
-rw-r--r--      2562 2016-12-04 06:08 harufont.getdescent.html
-rw-r--r--      9611 2016-12-04 06:07 function.gmp-gcdext.html
-rw-r--r--      6792 2016-12-04 06:08 function.curl-escape.html
-rw-r--r--      2921 2016-12-04 06:08 reflectionparameter.getposition.html
-rw-r--r--      6582 2016-12-04 06:07 function.is-dir.html
-rw-r--r--      3268 2016-12-04 06:08 solrquery.sethighlightsnippets.html
-rw-r--r--      9908 2016-12-04 06:07 function.db2-rollback.html
-rw-r--r--      5753 2016-12-04 06:08 directoryiterator.isdir.html
-rw-r--r--      2828 2016-12-04 06:07 book.lapack.html
-rw-r--r--      2451 2016-12-04 06:08 function.pdf-arc.html
-rw-r--r--      3959 2016-12-04 06:07 tokyotyranttable.putnr.html
-rw-r--r--      1947 2016-12-04 06:07 function.get-required-files.html
-rw-r--r--      2268 2016-12-04 06:08 ui-window.hasborders.html
-rw-r--r--      2370 2016-12-04 06:07 class.mongodb-driver-exception-exception.html
-rw-r--r--      1673 2016-12-04 06:08 v8js.installation.html
-rw-r--r--      3035 2016-12-04 06:08 yaf-request-abstract.setparam.html
-rw-r--r--      8937 2016-12-04 06:07 sqlite3.createcollation.html
-rw-r--r--      2578 2016-12-04 06:07 function.stats-skew.html
-rw-r--r--      3070 2016-12-04 06:08 function.pdf-shading.html
-rw-r--r--      2664 2016-12-04 06:07 imagick.setimagegamma.html
-rw-r--r--     15798 2016-12-04 06:07 langref.html
-rw-r--r--      9294 2016-12-04 06:07 ziparchive.locatename.html
-rw-r--r--      1703 2016-12-04 06:08 win32ps.installation.html
-rw-r--r--      1309 2016-12-04 06:07 ingres.examples.html
-rw-r--r--      2616 2016-12-04 06:07 mongoclient.tostring.html
-rw-r--r--      2008 2016-12-04 06:07 book.mail.html
-rw-r--r--      3856 2016-12-04 06:07 harudoc.setpagelayout.html
-rw-r--r--      7101 2016-12-04 06:08 ev.supportedbackends.html
-rw-r--r--      9801 2016-12-04 06:07 function.mysqlnd-ms-get-last-gtid.html
-rw-r--r--      2489 2016-12-04 06:08 yaf-view-simple.isset.html
-rw-r--r--      5749 2016-12-04 06:07 function.cubrid-num-fields.html
-rw-r--r--      1858 2016-12-04 06:08 intro.solr.html
-rw-r--r--     32279 2016-12-04 06:07 changelog.mongo.html
-rw-r--r--      5838 2016-12-04 06:07 intlcalendar.getlocale.html
-rw-r--r--      3129 2016-12-04 06:08 swfshape.drawarc.html
-rw-r--r--      2797 2016-12-04 06:07 throwable.getline.html
-rw-r--r--      4599 2016-12-04 06:07 pdo-4d.sqltypes.html
-rw-r--r--      2405 2016-12-04 06:07 audioproperties.getlength.html
-rw-r--r--     97920 2016-12-04 06:08 curl.constants.html
-rw-r--r--      4546 2016-12-04 06:07 function.inclued-get-data.html
-rw-r--r--     19424 2016-12-04 06:07 function.oci-fetch-object.html
-rw-r--r--     10736 2016-12-04 06:07 mongo.connecting.rs.html
-rw-r--r--      3619 2016-12-04 06:07 imagick.quantizeimages.html
-rw-r--r--      5884 2016-12-04 06:08 ref.sdodasrel.html
-rw-r--r--      6366 2016-12-04 06:07 function.radius-cvt-addr.html
-rw-r--r--      4785 2016-12-04 06:07 function.openssl-private-encrypt.html
-rw-r--r--      4311 2016-12-04 06:07 imagick.configuration.html
-rw-r--r--      3388 2016-12-04 06:07 book.errorfunc.html
-rw-r--r--      7124 2016-12-04 06:08 function.ldap-parse-result.html
-rw-r--r--      6101 2016-12-04 06:07 mongocollection.getindexinfo.html
-rw-r--r--      5699 2016-12-04 06:07 imagick.gammaimage.html
-rw-r--r--      3218 2016-12-04 06:07 mysqlnd-mux.constants.html
-rw-r--r--      2450 2016-12-04 06:08 ui-controls-editablecombo.settext.html
-rw-r--r--      3765 2016-12-04 06:08 lua.eval.html
-rw-r--r--      2930 2016-12-04 06:07 dbx.requirements.html
-rw-r--r--      3413 2016-12-04 06:07 function.ibase-free-event-handler.html
-rw-r--r--      6235 2016-12-04 06:07 mongodate.construct.html
-rw-r--r--      2362 2016-12-04 06:08 ui-draw-path.construct.html
-rw-r--r--      2542 2016-12-04 06:08 swfmovie.importfont.html
-rw-r--r--      2240 2016-12-04 06:08 function.pdf-lineto.html
-rw-r--r--      1335 2016-12-04 06:07 datetime.resources.html
-rw-r--r--      1322 2016-12-04 06:07 datetime.requirements.html
-rw-r--r--      2643 2016-12-04 06:08 yaf-controller-abstract.setviewpath.html
-rw-r--r--      5067 2016-12-04 06:07 imagick.queryfonts.html
-rw-r--r--      4042 2016-12-04 06:07 function.cairo-ps-get-levels.html
-rw-r--r--      6337 2016-12-04 06:07 function.set-include-path.html
-rw-r--r--      6584 2016-12-04 06:08 book.soap.html
-rw-r--r--      3760 2016-12-04 06:07 cairofontoptions.gethintmetrics.html
-rw-r--r--      3104 2016-12-04 06:08 internals2.opcodes.is-not-equal.html
-rw-r--r--      2411 2016-12-04 06:08 ui-controls-entry.gettext.html
-rw-r--r--      4633 2016-12-04 06:07 cairocontext.devicetouser.html
-rw-r--r--      8563 2016-12-04 06:07 intl.constants.html
-rw-r--r--      7418 2016-12-04 06:07 datetimezone.getoffset.html
-rw-r--r--      8629 2016-12-04 06:07 function.realpath.html
-rw-r--r--      9474 2016-12-04 06:07 function.imap-mailboxmsginfo.html
-rw-r--r--     11273 2016-12-04 06:08 function.in-array.html
-rw-r--r--      5594 2016-12-04 06:07 function.cairo-image-surface-create-for-data.html
-rw-r--r--      3872 2016-12-04 06:07 function.ibase-blob-create.html
-rw-r--r--      6037 2016-12-04 06:08 yar-server-exception.gettype.html
-rw-r--r--      4079 2016-12-04 06:08 win32service.constants.basepriorities.html
-rw-r--r--      2633 2016-12-04 06:08 yaf-config-abstract.set.html
-rw-r--r--      2562 2016-12-04 06:07 uconverter.geterrormessage.html
-rw-r--r--      1677 2016-12-04 06:07 xdiff.requirements.html
-rw-r--r--      5556 2016-12-04 06:07 function.get-extension-funcs.html
-rw-r--r--      6979 2016-12-04 06:08 function.get-object-vars.html
-rw-r--r--      2464 2016-12-04 06:07 function.ncurses-termattrs.html
-rw-r--r--      4459 2016-12-04 06:07 function.mysqlnd-ms-fabric-select-shard.html
-rw-r--r--      2203 2016-12-04 06:08 function.pdf-load-3ddata.html
-rw-r--r--      6288 2016-12-04 06:07 mysqlnd.overview.html
-rw-r--r--      3238 2016-12-04 06:07 function.newt-push-help-line.html
-rw-r--r--      8976 2016-12-04 06:07 outcontrol.configuration.html
-rw-r--r--      2129 2016-12-04 06:07 radius.constants.html
-rw-r--r--      8524 2016-12-04 06:07 pdo.sqlitecreatefunction.html
-rw-r--r--      6422 2016-12-04 06:07 function.cubrid-ping.html
-rw-r--r--      2982 2016-12-04 06:08 iteratoriterator.rewind.html
-rw-r--r--      3317 2016-12-04 06:07 oci-lob.write.html
-rw-r--r--     26399 2016-12-04 06:07 language.variables.scope.html
-rw-r--r--      4648 2016-12-04 06:08 quickhashinthash.getsize.html
-rw-r--r--      2503 2016-12-04 06:08 ui-controls-multilineentry.append.html
-rw-r--r--      3594 2016-12-04 06:08 function.fann-set-rprop-increase-factor.html
-rw-r--r--     10195 2016-12-04 06:08 function.array-slice.html
-rw-r--r--      6120 2016-12-04 06:08 soapserver.getfunctions.html
-rw-r--r--      3449 2016-12-04 06:07 uconverter.toucallback.html
-rw-r--r--      6106 2016-12-04 06:08 swftextfield.construct.html
-rw-r--r--      5085 2016-12-04 06:08 function.strtolower.html
-rw-r--r--      2915 2016-12-04 06:07 wincache.win32build.building.html
-rw-r--r--      3238 2016-12-04 06:07 mysqlnd-ms.loadbalancing.html
-rw-r--r--      1535 2016-12-04 06:07 openal.setup.html
-rw-r--r--      1897 2016-12-04 06:08 function.pdf-add-bookmark.html
-rw-r--r--      2407 2016-12-04 06:08 solrdocument.next.html
-rw-r--r--      8670 2016-12-04 06:07 function.radius-get-vendor-attr.html
-rw-r--r--      2251 2016-12-04 06:08 swfsoundinstance.nomultiple.html
-rw-r--r--      2869 2016-12-04 06:07 intlbreakiterator.preceding.html
-rw-r--r--      4037 2016-12-04 06:07 function.bindtextdomain.html
-rw-r--r--      1866 2016-12-04 06:07 function.imap-header.html
-rw-r--r--      3027 2016-12-04 06:08 internals2.opcodes.sr.html
-rw-r--r--      4198 2016-12-04 06:07 function.apd-set-pprof-trace.html
-rw-r--r--      1701 2016-12-04 06:08 taint.detail.html
-rw-r--r--      4923 2016-12-04 06:08 reflectionextension.getinientries.html
-rw-r--r--      3092 2016-12-04 06:07 function.dbplus-undoprepare.html
-rw-r--r--      1680 2016-12-04 06:08 internals2.streams.html
-rw-r--r--      3182 2016-12-04 06:07 mongocollection.construct.html
-rw-r--r--      4935 2016-12-04 06:07 cairosurface.copypage.html
-rw-r--r--      2485 2016-12-04 06:07 imagick.getimagerenderingintent.html
-rw-r--r--      2250 2016-12-04 06:08 transports.html
-rw-r--r--      2578 2016-12-04 06:08 function.pdf-arcn.html
-rw-r--r--      5089 2016-12-04 06:08 function.is-resource.html
-rw-r--r--      4819 2016-12-04 06:07 ref.sqlsrv.html
-rw-r--r--      9975 2016-12-04 06:08 migration52.parameters.html
-rw-r--r--      2842 2016-12-04 06:07 mysqlnd.persist.html
-rw-r--r--      1342 2016-12-04 06:07 proctitle.resources.html
-rw-r--r--      3277 2016-12-04 06:08 class.swfbitmap.html
-rw-r--r--    182621 2016-12-04 06:07 mysqlnd-ms.plugin-ini-json.html
-rw-r--r--      3834 2016-12-04 06:07 openssl.ciphers.html
-rw-r--r--      3004 2016-12-04 06:08 swftext.setspacing.html
-rw-r--r--      2713 2016-12-04 06:07 function.ifx-nullformat.html
-rw-r--r--      7201 2016-12-04 06:08 arrayobject.construct.html
-rw-r--r--      2436 2016-12-04 06:07 id3v2attachedpictureframe.settype.html
-rw-r--r--      2214 2016-12-04 06:08 function.pdf-moveto.html
-rw-r--r--      4547 2016-12-04 06:08 ds-stack.peek.html
-rw-r--r--      4568 2016-12-04 06:07 mongocollection.getname.html
-rw-r--r--      3369 2016-12-04 06:07 function.trader-cdlconcealbabyswall.html
-rw-r--r--      5394 2016-12-04 06:08 ftp.examples-basic.html
-rw-r--r--      3146 2016-12-04 06:08 function.posix-initgroups.html
-rw-r--r--      1907 2016-12-04 06:07 mysql.requirements.html
-rw-r--r--      3584 2016-12-04 06:07 cairosurface.finish.html
-rw-r--r--      4545 2016-12-04 06:08 harupage.settextmatrix.html
-rw-r--r--      2995 2016-12-04 06:07 function.stats-rand-gen-noncentral-t.html
-rw-r--r--     15245 2016-12-04 06:07 function.imagejpeg.html
-rw-r--r--      1567 2016-12-04 06:08 reflection.setup.html
-rw-r--r--     19017 2016-12-04 06:08 gearman.examples-reverse-task.html
-rw-r--r--      6007 2016-12-04 06:08 ds-map.sum.html
-rw-r--r--      3315 2016-12-04 06:07 function.trader-cdlgravestonedoji.html
-rw-r--r--      3055 2016-12-04 06:08 ui-size.of.html
-rw-r--r--      6555 2016-12-04 06:08 function.array-chunk.html
-rw-r--r--      1789 2016-12-04 06:07 function.msql-tablename.html
-rw-r--r--      5080 2016-12-04 06:08 eventbuffer.appendfrom.html
-rw-r--r--      2929 2016-12-04 06:07 imagick.setimageextent.html
-rw-r--r--      3874 2016-12-04 06:08 sdo-model-reflectiondataobject.export.html
-rw-r--r--     19865 2016-12-04 06:08 function.stream-filter-register.html
-rw-r--r--      4657 2016-12-04 06:07 function.uopz-restore.html
-rw-r--r--      2507 2016-12-04 06:08 swftext.getascent.html
-rw-r--r--      2357 2016-12-04 06:07 imagick.getversion.html
-rw-r--r--      4623 2016-12-04 06:07 intlcalendar.isset.html
-rw-r--r--      5513 2016-12-04 06:08 internals2.opcodes.fe-fetch.html
-rw-r--r--      2602 2016-12-04 06:07 imagick.getimageblob.html
-rw-r--r--      4070 2016-12-04 06:08 function.fann-scale-output-train-data.html
-rw-r--r--      2680 2016-12-04 06:08 swfbutton.setmenu.html
-rw-r--r--      1608 2016-12-04 06:07 intro.opcache.html
-rw-r--r--      3488 2016-12-04 06:07 serializable.serialize.html
-rw-r--r--      6100 2016-12-04 06:07 intlchar.iscntrl.html
-rw-r--r--      5957 2016-12-04 06:08 directoryiterator.getgroup.html
-rw-r--r--      2250 2016-12-04 06:07 function.maxdb-master-query.html
-rw-r--r--      2431 2016-12-04 06:07 enchant.constants.html
-rw-r--r--      1342 2016-12-04 06:08 snmp.configuration.html
-rw-r--r--      3287 2016-12-04 06:08 about.translations.html
-rw-r--r--      3656 2016-12-04 06:07 function.jddayofweek.html
-rw-r--r--      4914 2016-12-04 06:08 ds-vector.unshift.html
-rw-r--r--      5480 2016-12-04 06:08 book.xml.html
-rw-r--r--      5142 2016-12-04 06:07 cairosurface.createsimilar.html
-rw-r--r--      4568 2016-12-04 06:07 function.cairo-ps-surface-dsc-begin-page-setup.html
-rw-r--r--      1520 2016-12-04 06:08 varnish.setup.html
-rw-r--r--     13883 2016-12-04 06:08 class.evperiodic.html
-rw-r--r--      2245 2016-12-04 06:07 imagick.getcopyright.html
-rw-r--r--      1340 2016-12-04 06:08 win32ps.examples.html
-rw-r--r--      9350 2016-12-04 06:07 mysqli.error.html
-rw-r--r--      3184 2016-12-04 06:07 function.dbplus-chdir.html
-rw-r--r--      2652 2016-12-04 06:07 function.trader-medprice.html
-rw-r--r--      2525 2016-12-04 06:07 book.cyrus.html
-rw-r--r--      4155 2016-12-04 06:07 function.sys-get-temp-dir.html
-rw-r--r--      2689 2016-12-04 06:07 intro.xdiff.html
-rw-r--r--     11999 2016-12-04 06:07 function.imap-get-quota.html
-rw-r--r--     10402 2016-12-04 06:07 imagickdraw.setfontfamily.html
-rw-r--r--     15043 2016-12-04 06:07 ref.image.html
-rw-r--r--      3821 2016-12-04 06:07 imagick.identifyimage.html
-rw-r--r--      1265 2016-12-04 06:07 intro.xattr.html
-rw-r--r--      5594 2016-12-04 06:07 class.ktaglib-id3v2-tag.html
-rw-r--r--      9268 2016-12-04 06:07 function.mysql-field-name.html
-rw-r--r--      5007 2016-12-04 06:07 imagick.setimageresolution.html
-rw-r--r--      7890 2016-12-04 06:08 ev.periodic-modes.html
-rw-r--r--      5018 2016-12-04 06:07 collator.getstrength.html
-rw-r--r--      2374 2016-12-04 06:08 swfdisplayitem.getxskew.html
-rw-r--r--      4537 2016-12-04 06:08 ds-stack.copy.html
-rw-r--r--      1300 2016-12-04 06:08 sem.resources.html
-rw-r--r--      4138 2016-12-04 06:07 function.sybase-query.html
-rw-r--r--      1272 2016-12-04 06:08 reflection.constants.html
-rw-r--r--      3564 2016-12-04 06:08 limititerator.valid.html
-rw-r--r--      4214 2016-12-04 06:08 function.stream-is-local.html
-rw-r--r--      3571 2016-12-04 06:07 book.kadm5.html
-rw-r--r--      1314 2016-12-04 06:07 xattr.resources.html
-rw-r--r--      5479 2016-12-04 06:08 directoryiterator.isreadable.html
-rw-r--r--      3201 2016-12-04 06:08 function.wddx-deserialize.html
-rw-r--r--      5467 2016-12-04 06:07 function.pg-version.html
-rw-r--r--      5494 2016-12-04 06:08 function.ssh2-sftp-rmdir.html
-rw-r--r--      9295 2016-12-04 06:07 function.imagecreatefromjpeg.html
-rw-r--r--     19508 2016-12-04 06:08 swfdisplayitem.setratio.html
-rw-r--r--      2348 2016-12-04 06:08 pool.resize.html
-rw-r--r--      4873 2016-12-04 06:07 cairofontoptions.status.html
-rw-r--r--      5801 2016-12-04 06:07 phar.addemptydir.html
-rw-r--r--      2471 2016-12-04 06:08 ui-draw-text-font.construct.html
-rw-r--r--      2796 2016-12-04 06:07 gmagick.commentimage.html
-rw-r--r--      2625 2016-12-04 06:08 function.udm-errno.html
-rw-r--r--      5829 2016-12-04 06:07 function.base-convert.html
-rw-r--r--     18083 2016-12-04 06:07 trader.constants.html
-rw-r--r--     21361 2016-12-04 06:07 function.mktime.html
-rw-r--r--      3684 2016-12-04 06:08 streamwrapper.dir-rewinddir.html
-rw-r--r--      5305 2016-12-04 06:08 function.strnatcasecmp.html
-rw-r--r--      5313 2016-12-04 06:07 function.pg-num-fields.html
-rw-r--r--      2495 2016-12-04 06:08 yaf-loader.import.html
-rw-r--r--      8721 2016-12-04 06:08 ds-set.reduce.html
-rw-r--r--      2864 2016-12-04 06:07 mysqlnd-qc.quickstart.html
-rw-r--r--      1593 2016-12-04 06:07 intro.info.html
-rw-r--r--      6703 2016-12-04 06:08 function.session-cache-expire.html
-rw-r--r--      1899 2016-12-04 06:08 ctype.installation.html
-rw-r--r--      1302 2016-12-04 06:08 ds.requirements.html
-rw-r--r--      7688 2016-12-04 06:07 function.maxdb-get-proto-info.html
-rw-r--r--      7773 2016-12-04 06:07 language.references.return.html
-rw-r--r--      3081 2016-12-04 06:08 swfbutton.setdown.html
-rw-r--r--      1918 2016-12-04 06:07 ref.mysqlnd-uh.html
-rw-r--r--      1988 2016-12-04 06:07 install.pecl.html
-rw-r--r--      3629 2016-12-04 06:07 function.openssl-x509-parse.html
-rw-r--r--      7180 2016-12-04 06:07 function.dbase-get-header-info.html
-rw-r--r--      4977 2016-12-04 06:08 function.fann-set-activation-function-layer.html
-rw-r--r--      4577 2016-12-04 06:08 quickhashstringinthash.savetostring.html
-rw-r--r--      3821 2016-12-04 06:07 function.fbsql-commit.html
-rw-r--r--     12346 2016-12-04 06:07 language.namespaces.basics.html
-rw-r--r--      3751 2016-12-04 06:07 function.log.html
-rw-r--r--      2937 2016-12-04 06:08 function.ssdeep-fuzzy-hash-filename.html
-rw-r--r--      4006 2016-12-04 06:08 tidy.examples.basic.html
-rw-r--r--      2288 2016-12-04 06:08 function.pdf-circle.html
-rw-r--r--     26583 2016-12-04 06:08 book.reflection.html
-rw-r--r--      1301 2016-12-04 06:08 intro.v8js.html
-rw-r--r--      5972 2016-12-04 06:07 function.dbx-error.html
-rw-r--r--      2720 2016-12-04 06:07 function.rewinddir.html
-rw-r--r--      5505 2016-12-04 06:08 function.apache-setenv.html
-rw-r--r--      2480 2016-12-04 06:07 intl.installation.html
-rw-r--r--      3760 2016-12-04 06:07 cairofontoptions.gethintstyle.html
-rw-r--r--      9267 2016-12-04 06:07 datetime.settimezone.html
-rw-r--r--      8637 2016-12-04 06:07 class.error.html
-rw-r--r--     12967 2016-12-04 06:07 imagick.setoption.html
-rw-r--r--      7778 2016-12-04 06:07 ref.pdo-mysql.connection.html
-rw-r--r--      3711 2016-12-04 06:07 function.ncurses-can-change-color.html
-rw-r--r--      9093 2016-12-04 06:08 function.simplexml-load-string.html
-rw-r--r--      3990 2016-12-04 06:08 yaf-route-simple.route.html
-rw-r--r--      3645 2016-12-04 06:08 swfdisplayitem.moveto.html
-rw-r--r--      2892 2016-12-04 06:08 gearmanworker.construct.html
-rw-r--r--      5328 2016-12-04 06:07 cairofontoptions.setantialias.html
-rw-r--r--      2674 2016-12-04 06:08 yaf-config-ini.offsetexists.html
-rw-r--r--      5871 2016-12-04 06:07 function.link.html
-rw-r--r--     10992 2016-12-04 06:07 messageformatter.setpattern.html
-rw-r--r--      4072 2016-12-04 06:08 class.ui-draw-brush.html
-rw-r--r--      6780 2016-12-04 06:08 class.ui-controls-editablecombo.html
-rw-r--r--      5287 2016-12-04 06:07 function.gzopen.html
-rw-r--r--      5549 2016-12-04 06:07 function.bzdecompress.html
-rw-r--r--      1985 2016-12-04 06:08 ps.installation.html
-rw-r--r--      3105 2016-12-04 06:07 class.cairofontweight.html
-rw-r--r--      8376 2016-12-04 06:07 imagickkernel.getmatrix.html
-rw-r--r--      9669 2016-12-04 06:07 function.iconv-mime-decode-headers.html
-rw-r--r--      5680 2016-12-04 06:08 function.is-array.html
-rw-r--r--      3398 2016-12-04 06:08 function.shm-remove-var.html
-rw-r--r--      8271 2016-12-04 06:08 function.strip-tags.html
-rw-r--r--      2335 2016-12-04 06:08 ui-draw-stroke.setmiterlimit.html
-rw-r--r--     18839 2016-12-04 06:08 class.yaf-controller-abstract.html
-rw-r--r--      9278 2016-12-04 06:07 pharfileinfo.decompress.html
-rw-r--r--      2534 2016-12-04 06:07 imagick.getregistry.html
-rw-r--r--      3677 2016-12-04 06:07 mysqli.dump-debug-info.html
-rw-r--r--      2752 2016-12-04 06:08 gearmantask.datasize.html
-rw-r--r--      2923 2016-12-04 06:08 haruencoder.getwritingmode.html
-rw-r--r--      4369 2016-12-04 06:07 class.mongodb-bson-decimal128.html
-rw-r--r--      2539 2016-12-04 06:08 solrresponse.getrawresponse.html
-rw-r--r--      2156 2016-12-04 06:08 xml.installation.html
-rw-r--r--      2201 2016-12-04 06:08 spl-types.installation.html
-rw-r--r--     22223 2016-12-04 06:08 function.usort.html
-rw-r--r--      3951 2016-12-04 06:08 book.swish.html
-rw-r--r--      8950 2016-12-04 06:07 mysqlnduhpreparedstatement.execute.html
-rw-r--r--      7732 2016-12-04 06:07 imagick.subimagematch.html
-rw-r--r--      4019 2016-12-04 06:07 function.apd-croak.html
-rw-r--r--      3915 2016-12-04 06:08 internals2.opcodes.post-dec-obj.html
-rw-r--r--      1388 2016-12-04 06:08 xmldiff.setup.html
-rw-r--r--      2735 2016-12-04 06:07 gmagickdraw.rotate.html
-rw-r--r--      3963 2016-12-04 06:07 function.ibase-blob-close.html
-rw-r--r--      2289 2016-12-04 06:08 intro.pdf.html
-rw-r--r--     19598 2016-12-04 06:08 eio.constants.html
-rw-r--r--      2387 2016-12-04 06:08 classkit.constants.html
-rw-r--r--      7484 2016-12-04 06:07 datetime.gettimezone.html
-rw-r--r--      8208 2016-12-04 06:07 cairocontext.appendpath.html
-rw-r--r--     10335 2016-12-04 06:08 evperiodic.construct.html
-rw-r--r--      2876 2016-12-04 06:07 hrtime-stopwatch.getelapsedtime.html
-rw-r--r--      5410 2016-12-04 06:08 reflectionparameter.getclass.html
-rw-r--r--      1285 2016-12-04 06:08 internals2.classes.html
-rw-r--r--      1594 2016-12-04 06:07 intro.imap.html
-rw-r--r--      2398 2016-12-04 06:08 ui-controls-group.construct.html
-rw-r--r--      3917 2016-12-04 06:07 tokyotyrant.construct.html
-rw-r--r--      5339 2016-12-04 06:08 swish.getpropertylist.html
-rw-r--r--      3491 2016-12-04 06:07 ref.calendar.html
-rw-r--r--      6430 2016-12-04 06:08 directoryiterator.current.html
-rw-r--r--      5827 2016-12-04 06:07 function.xdiff-file-bdiff.html
-rw-r--r--      5151 2016-12-04 06:07 cairocontext.showtext.html
-rw-r--r--      7543 2016-12-04 06:07 mysqlnduhconnection.getserverversion.html
-rw-r--r--      2370 2016-12-04 06:08 yaf-dispatcher.sleep.html
-rw-r--r--      3977 2016-12-04 06:08 ds-vector.last.html
-rw-r--r--      5443 2016-12-04 06:08 directoryiterator.seek.html
-rw-r--r--      3729 2016-12-04 06:08 reflectionfunction.export.html
-rw-r--r--      3820 2016-12-04 06:07 function.fbsql-clob-size.html
-rw-r--r--      3838 2016-12-04 06:08 function.proc-close.html
-rw-r--r--      2665 2016-12-04 06:08 yaf-request-abstract.getlanguage.html
-rw-r--r--      2629 2016-12-04 06:08 function.fann-destroy-train.html
-rw-r--r--      5993 2016-12-04 06:08 threaded.iswaiting.html
-rw-r--r--      2842 2016-12-04 06:07 function.pg-flush.html
-rw-r--r--      6411 2016-12-04 06:07 function.bzread.html
-rw-r--r--      3251 2016-12-04 06:08 eventhttpconnection.setmaxbodysize.html
-rw-r--r--      4186 2016-12-04 06:07 function.mysqlnd-ms-fabric-select-global.html
-rw-r--r--     11080 2016-12-04 06:07 mysqlnduhconnection.connect.html
-rw-r--r--      6644 2016-12-04 06:08 function.reset.html
-rw-r--r--      6369 2016-12-04 06:07 function.trigger-error.html
-rw-r--r--      2365 2016-12-04 06:08 migration53.sapi.html
-rw-r--r--      1299 2016-12-04 06:08 swish.examples.html
-rw-r--r--      7714 2016-12-04 06:07 function.grapheme-strpos.html
-rw-r--r--      4674 2016-12-04 06:07 imagick.opaquepaintimage.html
-rw-r--r--      5981 2016-12-04 06:07 function.ob-end-flush.html
-rw-r--r--      2396 2016-12-04 06:07 imagick.flattenimages.html
-rw-r--r--      4405 2016-12-04 06:08 evprepare.createstopped.html
-rw-r--r--     18412 2016-12-04 06:08 function.bbcode-set-arg-parser.html
-rw-r--r--      5630 2016-12-04 06:07 function.bcompiler-write-footer.html
-rw-r--r--      4782 2016-12-04 06:08 ds-map.haskey.html
-rw-r--r--      4851 2016-12-04 06:08 arrayiterator.rewind.html
-rw-r--r--      4069 2016-12-04 06:08 internals2.opcodes.post-inc-obj.html
-rw-r--r--      2455 2016-12-04 06:07 function.ibase-db-info.html
-rw-r--r--      9126 2016-12-04 06:07 function.pg-field-size.html
-rw-r--r--      3590 2016-12-04 06:08 xmlreader.setrelaxngschemasource.html
-rw-r--r--      3303 2016-12-04 06:07 function.newt-component-add-callback.html
-rw-r--r--      2162 2016-12-04 06:07 openal.installation.html
-rw-r--r--      2930 2016-12-04 06:07 function.ncurses-termname.html
-rw-r--r--      4251 2016-12-04 06:08 class.ui-draw-text-font-stretch.html
-rw-r--r--     13873 2016-12-04 06:07 imagickpixel.construct.html
-rw-r--r--      2667 2016-12-04 06:08 yaf-request-abstract.getmodulename.html
-rw-r--r--      4102 2016-12-04 06:08 internals2.opcodes.add-array-element.html
-rw-r--r--      7174 2016-12-04 06:07 tokyotyranttable.getquery.html
-rw-r--r--      7443 2016-12-04 06:08 xsltprocessor.registerphpfunctions.html
-rw-r--r--      5966 2016-12-04 06:08 directoryiterator.getctime.html
-rw-r--r--      2641 2016-12-04 06:07 lapack.identity.html
-rw-r--r--      2936 2016-12-04 06:08 judy.count.html
-rw-r--r--      2025 2016-12-04 06:08 migration53.class-constants.html
-rw-r--r--      3220 2016-12-04 06:07 function.ifxus-read-slob.html
-rw-r--r--      4236 2016-12-04 06:07 function.gnupg-geterror.html
-rw-r--r--      2679 2016-12-04 06:08 domnode.hasattributes.html
-rw-r--r--      4069 2016-12-04 06:07 function.xhprof-disable.html
-rw-r--r--      5160 2016-12-04 06:07 function.runkit-class-emancipate.html
-rw-r--r--      4929 2016-12-04 06:08 domentityreference.construct.html
-rw-r--r--      2821 2016-12-04 06:07 function.newt-form-set-timer.html
-rw-r--r--      8284 2016-12-04 06:08 function.ssh2-methods-negotiated.html
-rw-r--r--      6990 2016-12-04 06:07 function.cubrid-load-from-glo.html
-rw-r--r--      5763 2016-12-04 06:07 mongocollection.getwriteconcern.html
-rw-r--r--      5570 2016-12-04 06:08 reflectiongenerator.getexecutingfile.html
-rw-r--r--      2691 2016-12-04 06:08 function.eio-set-min-parallel.html
-rw-r--r--      5502 2016-12-04 06:07 function.mssql-min-error-severity.html
-rw-r--r--     11663 2016-12-04 06:08 class.solrupdateresponse.html
-rw-r--r--     11985 2016-12-04 06:08 changelog.strings.html
-rw-r--r--     13794 2016-12-04 06:07 mysqli.warning-count.html
-rw-r--r--      2725 2016-12-04 06:08 judy.firstempty.html
-rw-r--r--      1335 2016-12-04 06:07 lzf.configuration.html
-rw-r--r--      8856 2016-12-04 06:07 function.set-exception-handler.html
-rw-r--r--     18392 2016-12-04 06:07 language.types.integer.html
-rw-r--r--      1738 2016-12-04 06:07 function.fputs.html
-rw-r--r--     17445 2016-12-04 06:08 sammessage.header.html
-rw-r--r--      4783 2016-12-04 06:07 cairocontext.status.html
-rw-r--r--      4882 2016-12-04 06:08 ds-vector.push.html
-rw-r--r--      2941 2016-12-04 06:08 internals2.opcodes.assign-bw-or.html
-rw-r--r--      2547 2016-12-04 06:07 function.newt-button-bar.html
-rw-r--r--      4656 2016-12-04 06:08 gearmanclient.dolowbackground.html
-rw-r--r--      3548 2016-12-04 06:08 function.fann-set-cascade-weight-multiplier.html
-rw-r--r--      7707 2016-12-04 06:07 sqlite3stmt.bindvalue.html
-rw-r--r--      3795 2016-12-04 06:07 security.apache.html
-rw-r--r--      1429 2016-12-04 06:07 pspell.requirements.html
-rw-r--r--      2663 2016-12-04 06:07 mysqli-stmt.insert-id.html
-rw-r--r--      2851 2016-12-04 06:08 internals2.opcodes.assign-add.html
-rw-r--r--      2436 2016-12-04 06:08 gearmantask.construct.html
-rw-r--r--      3021 2016-12-04 06:08 recursiveiterator.getchildren.html
-rw-r--r--      1339 2016-12-04 06:08 intro.lua.html
-rw-r--r--      4815 2016-12-04 06:07 cairocontext.getdash.html
-rw-r--r--      2661 2016-12-04 06:08 migration5.databases.html
-rw-r--r--      6256 2016-12-04 06:08 reflectionfunctionabstract.hasreturntype.html
-rw-r--r--      4854 2016-12-04 06:08 worker.getstacked.html
-rw-r--r--      2413 2016-12-04 06:08 function.pdf-setgray.html
-rw-r--r--      4149 2016-12-04 06:07 function.imagesetclip.html
-rw-r--r--      2272 2016-12-04 06:08 function.stream-encoding.html
-rw-r--r--      5902 2016-12-04 06:07 ref.pdo-ibm.connection.html
-rw-r--r--      2875 2016-12-04 06:07 apc.installation.html
-rw-r--r--      3478 2016-12-04 06:07 tokyotyrant.restore.html
-rw-r--r--      6983 2016-12-04 06:08 samconnection.connect.html
-rw-r--r--      2882 2016-12-04 06:07 gmagick.removeimageprofile.html
-rw-r--r--      2593 2016-12-04 06:08 judy.bycount.html
-rw-r--r--      2957 2016-12-04 06:08 function.autoload.html
-rw-r--r--      1353 2016-12-04 06:07 openal.configuration.html
-rw-r--r--      1356 2016-12-04 06:08 mnogosearch.resources.html
-rw-r--r--      3361 2016-12-04 06:07 book.hash.html
-rw-r--r--      3812 2016-12-04 06:07 function.px-set-value.html
-rw-r--r--      2769 2016-12-04 06:07 mysqlnd-mux.architecture.html
-rw-r--r--      6671 2016-12-04 06:07 imagick.mergeimagelayers.html
-rw-r--r--      4571 2016-12-04 06:07 function.px-set-parameter.html
-rw-r--r--      5372 2016-12-04 06:08 function.socket-set-block.html
-rw-r--r--      6231 2016-12-04 06:07 cairocontext.setsourcergba.html
-rw-r--r--      3739 2016-12-04 06:07 imagick.getimageregion.html
-rw-r--r--      2518 2016-12-04 06:07 intro.memtrack.html
-rw-r--r--     11093 2016-12-04 06:07 mysqlnduhconnection.close.html
-rw-r--r--      4585 2016-12-04 06:07 function.openssl-pkey-export-to-file.html
-rw-r--r--     11767 2016-12-04 06:07 phardata.decompressfiles.html
-rw-r--r--      2646 2016-12-04 06:07 mysqli.get-warnings.html
-rw-r--r--      5019 2016-12-04 06:07 function.gmp-mul.html
-rw-r--r--      3001 2016-12-04 06:08 class.yaf-exception-loadfailed-module.html
-rw-r--r--      2236 2016-12-04 06:08 yaf-router.construct.html
-rw-r--r--      1515 2016-12-04 06:07 xattr.setup.html
-rw-r--r--     14702 2016-12-04 06:07 function.fread.html
-rw-r--r--      8438 2016-12-04 06:07 locale.getdisplayname.html
-rw-r--r--      4091 2016-12-04 06:07 class.cairocontent.html
-rw-r--r--      2995 2016-12-04 06:07 function.filepro.html
-rw-r--r--      3336 2016-12-04 06:07 function.trader-cdlcounterattack.html
-rw-r--r--      2922 2016-12-04 06:07 imagick.setregistry.html
-rw-r--r--      2238 2016-12-04 06:08 splfileobject.tostring.html
-rw-r--r--      3221 2016-12-04 06:07 function.newt-listbox-select-item.html
-rw-r--r--     15039 2016-12-04 06:07 ingres.configuration.html
-rw-r--r--      3599 2016-12-04 06:07 gmagick.chopimage.html
-rw-r--r--      4402 2016-12-04 06:07 function.cubrid-lob2-size.html
-rw-r--r--      8612 2016-12-04 06:08 function.array-intersect-assoc.html
-rw-r--r--      3234 2016-12-04 06:07 function.ncurses-erase.html
-rw-r--r--      6117 2016-12-04 06:07 class.generator.html
-rw-r--r--      1323 2016-12-04 06:07 hash.requirements.html
-rw-r--r--      3057 2016-12-04 06:08 sdo-model-type.isabstracttype.html
-rw-r--r--      2535 2016-12-04 06:07 function.ibase-errmsg.html
-rw-r--r--      2094 2016-12-04 06:08 swffont.getshape.html
-rw-r--r--      4030 2016-12-04 06:08 syncreaderwriter.writeunlock.html
-rw-r--r--      1723 2016-12-04 06:08 internals2.variables.html
-rw-r--r--      9754 2016-12-04 06:07 function.cubrid-lob2-bind.html
-rw-r--r--      4784 2016-12-04 06:08 function.ldap-rename.html
-rw-r--r--      3685 2016-12-04 06:08 internals2.counter.function.counter-bump-value.html
-rw-r--r--     10553 2016-12-04 06:07 function.maxdb-thread-id.html
-rw-r--r--      3939 2016-12-04 06:08 ds-set.clear.html
-rw-r--r--      4534 2016-12-04 06:07 function.cubrid-list-dbs.html
-rw-r--r--      4288 2016-12-04 06:07 function.ezmlm-hash.html
-rw-r--r--      5844 2016-12-04 06:08 function.get-defined-functions.html
-rw-r--r--      3234 2016-12-04 06:08 reflectionfunctionabstract.getfilename.html
-rw-r--r--      2181 2016-12-04 06:07 imagick.setlastiterator.html
-rw-r--r--      1356 2016-12-04 06:07 csprng.configuration.html
-rw-r--r--      6905 2016-12-04 06:07 function.xdiff-file-diff.html
-rw-r--r--      4852 2016-12-04 06:07 function.cairo-font-options-set-subpixel-order.html
-rw-r--r--      7626 2016-12-04 06:07 function.pg-fetch-row.html
-rw-r--r--      5205 2016-12-04 06:07 book.mssql.html
-rw-r--r--      3178 2016-12-04 06:08 internals2.opcodes.is-smaller-or-equal.html
-rw-r--r--      1562 2016-12-04 06:08 xmlwriter.setup.html
-rw-r--r--      3924 2016-12-04 06:08 swfdisplayitem.skewxto.html
-rw-r--r--      4623 2016-12-04 06:08 ref.libevent.html
-rw-r--r--      4713 2016-12-04 06:07 function.imap-fetchheader.html
-rw-r--r--      4927 2016-12-04 06:07 function.cairo-svg-surface-create.html
-rw-r--r--     12743 2016-12-04 06:07 function.sqlite-array-query.html
-rw-r--r--      2826 2016-12-04 06:07 imagick.setimagecompression.html
-rw-r--r--      6764 2016-12-04 06:08 function.compact.html
-rw-r--r--      2618 2016-12-04 06:08 solrquery.getmltmaxwordlength.html
-rw-r--r--      6572 2016-12-04 06:07 function.rename.html
-rw-r--r--      5806 2016-12-04 06:07 msql.examples-basic.html
-rw-r--r--      2055 2016-12-04 06:08 solrquery.getexpand.html
-rw-r--r--      1328 2016-12-04 06:07 gettext.resources.html
-rw-r--r--      2860 2016-12-04 06:08 evstat.set.html
-rw-r--r--      2843 2016-12-04 06:08 event.persistence.html
-rw-r--r--      3997 2016-12-04 06:08 splfileinfo.getpathname.html
-rw-r--r--      4529 2016-12-04 06:08 memcache.getstats.html
-rw-r--r--      1621 2016-12-04 06:08 extensions.html
-rw-r--r--      9985 2016-12-04 06:07 function.imagefilltoborder.html
-rw-r--r--      2006 2016-12-04 06:07 function.date-create-from-format.html
-rw-r--r--      6354 2016-12-04 06:07 odbc.installation.html
-rw-r--r--      4742 2016-12-04 06:08 ds-deque.allocate.html
-rw-r--r--      1580 2016-12-04 06:07 filesystem.setup.html
-rw-r--r--     19000 2016-12-04 06:07 mysqli-stmt.bind-param.html
-rw-r--r--      3534 2016-12-04 06:08 appenditerator.next.html
-rw-r--r--      8337 2016-12-04 06:07 ziparchive.getexternalattributesindex.html
-rw-r--r--      2140 2016-12-04 06:08 ui-area.redraw.html
-rw-r--r--      2607 2016-12-04 06:07 oci-collection.free.html
-rw-r--r--     11422 2016-12-04 06:08 filters.encryption.html
-rw-r--r--      2561 2016-12-04 06:08 judy.offsetexists.html
-rw-r--r--     15172 2016-12-04 06:07 ncurses.keyconsts.html
-rw-r--r--      4491 2016-12-04 06:07 function.fdf-get-value.html
-rw-r--r--      2457 2016-12-04 06:08 zmqsocket.ispersistent.html
-rw-r--r--      2765 2016-12-04 06:07 uconverter.setdestinationencoding.html
-rw-r--r--      4677 2016-12-04 06:07 mongodate.todatetime.html
-rw-r--r--     11312 2016-12-04 06:07 function.sqlsrv-fetch.html
-rw-r--r--      2682 2016-12-04 06:08 ref.win32service.html
-rw-r--r--      4116 2016-12-04 06:07 tokyotyrant.num.html
-rw-r--r--      4520 2016-12-04 06:07 lapack.pseudoinverse.html
-rw-r--r--      8218 2016-12-04 06:08 quickhashintset.exists.html
-rw-r--r--      4690 2016-12-04 06:07 function.cairo-ps-surface-set-eps.html
-rw-r--r--      2028 2016-12-04 06:07 intro.fbsql.html
-rw-r--r--     13368 2016-12-04 06:08 function.svn-diff.html
-rw-r--r--      1214 2016-12-04 06:08 wddx.constants.html
-rw-r--r--      2786 2016-12-04 06:07 apd.installation.html
-rw-r--r--      5524 2016-12-04 06:08 function.msg-stat-queue.html
-rw-r--r--      3707 2016-12-04 06:08 sdodasrel.limitations.html
-rw-r--r--     12845 2016-12-04 06:08 function.levenshtein.html
-rw-r--r--      1349 2016-12-04 06:07 cairo.configuration.html
-rw-r--r--      6257 2016-12-04 06:07 intlchar.istitle.html
-rw-r--r--     10207 2016-12-04 06:07 set.mongodb.html
-rw-r--r--      2730 2016-12-04 06:08 swffontchar.addutf8chars.html
-rw-r--r--      2832 2016-12-04 06:08 internals2.counter.counter-class.resetvalue.html
-rw-r--r--      2628 2016-12-04 06:08 gearmanclient.removeoptions.html
-rw-r--r--      5986 2016-12-04 06:08 function.stream-set-write-buffer.html
-rw-r--r--      2843 2016-12-04 06:08 eventdnsbase.addnameserverip.html
-rw-r--r--      2924 2016-12-04 06:07 imagick.setimageattribute.html
-rw-r--r--      6262 2016-12-04 06:08 class.ui-exception-runtimeexception.html
-rw-r--r--      1792 2016-12-04 06:08 intro.spl.html
-rw-r--r--      3219 2016-12-04 06:08 internals2.opcodes.nop.html
-rw-r--r--      6705 2016-12-04 06:07 function.chgrp.html
-rw-r--r--      6764 2016-12-04 06:07 mongo.getpoolsize.html
-rw-r--r--      5601 2016-12-04 06:07 book.fdf.html
-rw-r--r--     10048 2016-12-04 06:07 context.socket.html
-rw-r--r--      3435 2016-12-04 06:07 function.apd-dump-persistent-resources.html
-rw-r--r--      7033 2016-12-04 06:08 memcache.increment.html
-rw-r--r--      1772 2016-12-04 06:07 gmp.requirements.html
-rw-r--r--      1489 2016-12-04 06:08 ftp.setup.html
-rw-r--r--      5642 2016-12-04 06:07 messageformatter.getlocale.html
-rw-r--r--      9782 2016-12-04 06:07 rararchive.getentry.html
-rw-r--r--      4887 2016-12-04 06:08 function.ps-add-bookmark.html
-rw-r--r--      4591 2016-12-04 06:08 function.setrawcookie.html
-rw-r--r--      5551 2016-12-04 06:07 imagick.sharpenimage.html
-rw-r--r--      1742 2016-12-04 06:07 xhprof.requirements.html
-rw-r--r--      2012 2016-12-04 06:08 ref.wddx.html
-rw-r--r--      4518 2016-12-04 06:08 ds-queue.construct.html
-rw-r--r--      1459 2016-12-04 06:08 intro.fpm.html
-rw-r--r--      2139 2016-12-04 06:07 book.proctitle.html
-rw-r--r--      2758 2016-12-04 06:08 solrquery.settermsmaxcount.html
-rw-r--r--      5033 2016-12-04 06:08 ds.examples.html
-rw-r--r--      5156 2016-12-04 06:07 language.constants.html
-rw-r--r--      3028 2016-12-04 06:07 function.ncurses-whline.html
-rw-r--r--      2922 2016-12-04 06:08 solrquery.sethighlight.html
-rw-r--r--      2571 2016-12-04 06:08 xml.error-codes.html
-rw-r--r--      4507 2016-12-04 06:08 splobjectstorage.serialize.html
-rw-r--r--      1485 2016-12-04 06:08 intro.fann.html
-rw-r--r--      7909 2016-12-04 06:07 function.xhprof-enable.html
-rw-r--r--      8727 2016-12-04 06:07 mongodb-driver-writeresult.getinsertedcount.html
-rw-r--r--      3243 2016-12-04 06:07 function.m-setssl-files.html
-rw-r--r--     11115 2016-12-04 06:07 function.maxdb-stmt-num-rows.html
-rw-r--r--     20827 2016-12-04 06:08 sdo.sample.getset.html
-rw-r--r--      1296 2016-12-04 06:08 funchand.constants.html
-rw-r--r--      8010 2016-12-04 06:08 function.print.html
-rw-r--r--      2494 2016-12-04 06:08 splfixedarray.valid.html
-rw-r--r--      2671 2016-12-04 06:08 yaf-request-abstract.getrequesturi.html
-rw-r--r--      6786 2016-12-04 06:07 function.random-bytes.html
-rw-r--r--      5224 2016-12-04 06:08 memcached.addbykey.html
-rw-r--r--      4262 2016-12-04 06:07 function.uopz-backup.html
-rw-r--r--      5885 2016-12-04 06:07 function.gmp-clrbit.html
-rw-r--r--     15713 2016-12-04 06:08 function.socket-recv.html
-rw-r--r--      2938 2016-12-04 06:08 internals2.opcodes.assign-bw-xor.html
-rw-r--r--      1795 2016-12-04 06:08 function.doubleval.html
-rw-r--r--      3925 2016-12-04 06:08 evidle.construct.html
-rw-r--r--      4938 2016-12-04 06:08 internals2.opcodes.fetch-dim-rw.html
-rw-r--r--      1755 2016-12-04 06:07 function.msql.html
-rw-r--r--      3036 2016-12-04 06:08 function.libxml-get-last-error.html
-rw-r--r--      2602 2016-12-04 06:08 ui-draw-pen.write.html
-rw-r--r--      8658 2016-12-04 06:07 install.pecl.windows.html
-rw-r--r--      6138 2016-12-04 06:08 yaf-response-abstract.setbody.html
-rw-r--r--      2768 2016-12-04 06:07 function.ncurses-wrefresh.html
-rw-r--r--      9502 2016-12-04 06:08 function.substr-count.html
-rw-r--r--      5309 2016-12-04 06:08 function.xmlwriter-start-document.html
-rw-r--r--      2466 2016-12-04 06:07 function.trader-log10.html
-rw-r--r--      7347 2016-12-04 06:08 function.ldap-get-attributes.html
-rw-r--r--      9198 2016-12-04 06:07 book.openssl.html
-rw-r--r--      5563 2016-12-04 06:07 function.jdtojewish.html
-rw-r--r--      7310 2016-12-04 06:07 apciterator.construct.html
-rw-r--r--      2620 2016-12-04 06:07 function.vpopmail-alias-del.html
-rw-r--r--      4887 2016-12-04 06:07 function.newt-button.html
-rw-r--r--      3983 2016-12-04 06:07 imagick.getimagechanneldistortion.html
-rw-r--r--      1974 2016-12-04 06:08 book.tcpwrap.html
-rw-r--r--      4539 2016-12-04 06:08 function.variant-pow.html
-rw-r--r--      4091 2016-12-04 06:08 evloop.construct.html
-rw-r--r--      2550 2016-12-04 06:07 imagick.getimagegreenprimary.html
-rw-r--r--      8165 2016-12-04 06:07 mysqli.get-proto-info.html
-rw-r--r--      5911 2016-12-04 06:08 function.socket-connect.html
-rw-r--r--      6178 2016-12-04 06:07 function.pg-affected-rows.html
-rw-r--r--      3872 2016-12-04 06:08 ds-vector.reverse.html
-rw-r--r--      1672 2016-12-04 06:08 svm.installation.html
-rw-r--r--      5163 2016-12-04 06:07 function.gmp-invert.html
-rw-r--r--      5504 2016-12-04 06:08 function.preg-grep.html
-rw-r--r--      8440 2016-12-04 06:07 function.px-timestamp2string.html
-rw-r--r--      3442 2016-12-04 06:07 ref.pdo-sqlite.html
-rw-r--r--      2238 2016-12-04 06:07 mongocursor.reset.html
-rw-r--r--      3567 2016-12-04 06:07 function.openal-context-suspend.html
-rw-r--r--      3077 2016-12-04 06:07 function.m-responsekeys.html
-rw-r--r--      5606 2016-12-04 06:07 function.fdf-save-string.html
-rw-r--r--      1513 2016-12-04 06:07 blenc.setup.html
-rw-r--r--     19639 2016-12-04 06:07 class.datetime.html
-rw-r--r--      5283 2016-12-04 06:08 quickhashintset.savetofile.html
-rw-r--r--      1377 2016-12-04 06:08 spl-types.configuration.html
-rw-r--r--      4466 2016-12-04 06:08 function.fann-init-weights.html
-rw-r--r--     10986 2016-12-04 06:07 intlcalendar.equals.html
-rw-r--r--      7828 2016-12-04 06:07 intlchar.digit.html
-rw-r--r--      3789 2016-12-04 06:07 function.msql-db-query.html
-rw-r--r--      3393 2016-12-04 06:08 function.fann-get-sarprop-step-error-shift.html
-rw-r--r--      7141 2016-12-04 06:07 ref.oci8.html
-rw-r--r--      2201 2016-12-04 06:08 function.ldap-first-reference.html
-rw-r--r--     15281 2016-12-04 06:07 function.oci-new-connect.html
-rw-r--r--      4872 2016-12-04 06:08 memcached.deletemultibykey.html
-rw-r--r--      3184 2016-12-04 06:08 yaf-controller-abstract.construct.html
-rw-r--r--      3663 2016-12-04 06:07 mongodb-driver-server.ishidden.html
-rw-r--r--      1782 2016-12-04 06:07 control-structures.intro.html
-rw-r--r--      7392 2016-12-04 06:08 function.xml-set-unparsed-entity-decl-handler.html
-rw-r--r--      4173 2016-12-04 06:08 zookeeper.connect.html
-rw-r--r--      1335 2016-12-04 06:07 gmp.configuration.html
-rw-r--r--      1363 2016-12-04 06:07 filepro.configuration.html
-rw-r--r--      4933 2016-12-04 06:07 cairofontoptions.getantialias.html
-rw-r--r--      5733 2016-12-04 06:07 function.gmp-testbit.html
-rw-r--r--      1372 2016-12-04 06:07 bzip2.resources.html
-rw-r--r--      2199 2016-12-04 06:08 function.ldap-next-reference.html
-rw-r--r--      5897 2016-12-04 06:07 mongodb.repair.html
-rw-r--r--      4549 2016-12-04 06:08 quickhashintset.getsize.html
-rw-r--r--      9594 2016-12-04 06:08 domimplementation.hasfeature.html
-rw-r--r--      3193 2016-12-04 06:07 function.bzflush.html
-rw-r--r--      3247 2016-12-04 06:08 harupage.circle.html
-rw-r--r--      9627 2016-12-04 06:07 mysqli.ping.html
-rw-r--r--      2868 2016-12-04 06:07 hrtime-stopwatch.getlastelapsedtime.html
-rw-r--r--      3736 2016-12-04 06:07 sqlite3.exec.html
-rw-r--r--      5098 2016-12-04 06:08 function.session-id.html
-rw-r--r--      3522 2016-12-04 06:07 function.oci-lob-copy.html
-rw-r--r--      1649 2016-12-04 06:07 mysqlnd-ms.setup.html
-rw-r--r--      4877 2016-12-04 06:07 function.bzopen.html
-rw-r--r--      1502 2016-12-04 06:07 ref.proctitle.html
-rw-r--r--     20989 2016-12-04 06:07 function.include.html
-rw-r--r--      3205 2016-12-04 06:08 function.xml-error-string.html
-rw-r--r--      2694 2016-12-04 06:08 solrobject.offsetget.html
-rw-r--r--     11349 2016-12-04 06:08 function.count.html
-rw-r--r--      2296 2016-12-04 06:08 function.fastcgi-finish-request.html
-rw-r--r--      8401 2016-12-04 06:08 function.define.html
-rw-r--r--      3282 2016-12-04 06:08 migration70.removed-exts-sapis.html
-rw-r--r--     16204 2016-12-04 06:07 book.oci8.html
-rw-r--r--      2338 2016-12-04 06:08 ui-controls-radio.append.html
-rw-r--r--      4567 2016-12-04 06:07 function.cairo-scaled-font-get-font-face.html
-rw-r--r--     15925 2016-12-04 06:07 ref.sqlite.html
-rw-r--r--      3460 2016-12-04 06:08 function.pcntl-wifexited.html
-rw-r--r--      5175 2016-12-04 06:08 function.posix-setegid.html
-rw-r--r--      3254 2016-12-04 06:07 function.dbplus-unselect.html
-rw-r--r--      4400 2016-12-04 06:08 function.xml-parser-create-ns.html
-rw-r--r--      6687 2016-12-04 06:08 ds-map.map.html
-rw-r--r--      6286 2016-12-04 06:08 function.fann-train-on-data.html
-rw-r--r--      2763 2016-12-04 06:08 function.svn-fs-is-dir.html
-rw-r--r--      2975 2016-12-04 06:07 gmagick.readimagefile.html
-rw-r--r--      5925 2016-12-04 06:07 book.math.html
-rw-r--r--      4225 2016-12-04 06:07 function.newt-open-window.html
-rw-r--r--     12294 2016-12-04 06:07 function.mysql-fetch-assoc.html
-rw-r--r--      3184 2016-12-04 06:07 function.ncurses-clear.html
-rw-r--r--      2600 2016-12-04 06:08 ui-menu.appendquit.html
-rw-r--r--      2736 2016-12-04 06:07 function.trader-rocr100.html
-rw-r--r--     10464 2016-12-04 06:07 function.pg-fetch-object.html
-rw-r--r--      3425 2016-12-04 06:08 sdo-model-type.isinstance.html
-rw-r--r--      3341 2016-12-04 06:07 function.trader-cdlxsidegap3methods.html
-rw-r--r--      1286 2016-12-04 06:08 internals2.apiref.html
-rw-r--r--      3766 2016-12-04 06:07 function.acosh.html
-rw-r--r--      5360 2016-12-04 06:08 eventbufferevent.getinput.html
-rw-r--r--      5152 2016-12-04 06:07 function.crack-check.html
-rw-r--r--      1806 2016-12-04 06:08 ev.installation.html
-rw-r--r--      7380 2016-12-04 06:07 function.pg-lo-export.html
-rw-r--r--      6744 2016-12-04 06:07 imagick.getpixeliterator.html
-rw-r--r--      3559 2016-12-04 06:07 mysqli-stmt.attr-get.html
-rw-r--r--      2763 2016-12-04 06:08 solrdocument.getinputdocument.html
-rw-r--r--      5500 2016-12-04 06:07 function.fbsql-field-name.html
-rw-r--r--      2773 2016-12-04 06:07 function.mcrypt-enc-self-test.html
-rw-r--r--      3722 2016-12-04 06:08 internals2.opcodes.send-ref.html
-rw-r--r--      9200 2016-12-04 06:08 function.number-format.html
-rw-r--r--      8320 2016-12-04 06:07 imagick.setimagetickspersecond.html
-rw-r--r--      3514 2016-12-04 06:08 hwapi.insertcollection.html
-rw-r--r--      3209 2016-12-04 06:08 reflectionproperty.getdeclaringclass.html
-rw-r--r--      3444 2016-12-04 06:07 ref.mailparse.html
-rw-r--r--      2505 2016-12-04 06:08 emptyiterator.rewind.html
-rw-r--r--      2903 2016-12-04 06:08 about.generate.html
-rw-r--r--      2761 2016-12-04 06:08 solrquery.settermsmincount.html
-rw-r--r--      1397 2016-12-04 06:08 shmop.resources.html
-rw-r--r--      2925 2016-12-04 06:08 eventbufferevent.sslgetciphername.html
-rw-r--r--      2582 2016-12-04 06:08 spldoublylinkedlist.valid.html
-rw-r--r--      5847 2016-12-04 06:08 directoryiterator.getmtime.html
-rw-r--r--      2491 2016-12-04 06:08 yaf-dispatcher.getinstance.html
-rw-r--r--      3217 2016-12-04 06:07 gmagick.setimageredprimary.html
-rw-r--r--      7616 2016-12-04 06:08 streamwrapper.stream-metadata.html
-rw-r--r--      3376 2016-12-04 06:08 recursiveiteratoriterator.getmaxdepth.html
-rw-r--r--     14827 2016-12-04 06:07 book.newt.html
-rw-r--r--      2832 2016-12-04 06:07 function.vpopmail-auth-user.html
-rw-r--r--      5317 2016-12-04 06:07 function.mb-strrchr.html
-rw-r--r--      2550 2016-12-04 06:08 yaf-session.get.html
-rw-r--r--      8125 2016-12-04 06:07 book.tokyo-tyrant.html
-rw-r--r--      4063 2016-12-04 06:07 function.dio-close.html
-rw-r--r--      4633 2016-12-04 06:08 ref.curl.html
-rw-r--r--      3851 2016-12-04 06:08 reflectionobject.export.html
-rw-r--r--      3165 2016-12-04 06:07 function.m-getheader.html
-rw-r--r--      5588 2016-12-04 06:08 yaf-application.execute.html
-rw-r--r--      4888 2016-12-04 06:08 evchild.createstopped.html
-rw-r--r--      3942 2016-12-04 06:07 ref.pdo-firebird.connection.html
-rw-r--r--      2837 2016-12-04 06:07 function.radius-request-authenticator.html
-rw-r--r--      2762 2016-12-04 06:07 imagick.setimagefilename.html
-rw-r--r--      2973 2016-12-04 06:08 eventbase.priorityinit.html
-rw-r--r--      1780 2016-12-04 06:07 exif.installation.html
-rw-r--r--      7903 2016-12-04 06:08 recursivearrayiterator.getchildren.html
-rw-r--r--      2606 2016-12-04 06:07 gender-gender.construct.html
-rw-r--r--     12324 2016-12-04 06:08 yar.examples.html
-rw-r--r--      3266 2016-12-04 06:07 function.stats-cdf-logistic.html
-rw-r--r--      3608 2016-12-04 06:08 internals2.opcodes.is-equal.html
-rw-r--r--      3856 2016-12-04 06:08 sdo-das-xml.addtypes.html
-rw-r--r--      4297 2016-12-04 06:07 function.imap-gc.html
-rw-r--r--      3969 2016-12-04 06:08 oauth.setnonce.html
-rw-r--r--      4929 2016-12-04 06:07 mysqlnd-ms.transaction.html
-rw-r--r--      2573 2016-12-04 06:07 imagick.getimagepage.html
-rw-r--r--      3151 2016-12-04 06:08 soapclient.setcookie.html
-rw-r--r--      6419 2016-12-04 06:07 function.php-ini-scanned-files.html
-rw-r--r--      9128 2016-12-04 06:07 function.sqlsrv-send-stream-data.html
-rw-r--r--      2433 2016-12-04 06:08 function.pdf-setgray-stroke.html
-rw-r--r--      3095 2016-12-04 06:07 function.kadm5-destroy.html
-rw-r--r--      5260 2016-12-04 06:07 book.rar.html
-rw-r--r--      5241 2016-12-04 06:08 apache.configuration.html
-rw-r--r--      4056 2016-12-04 06:07 gmagick.raiseimage.html
-rw-r--r--      2313 2016-12-04 06:08 ui-controls-colorbutton.onchange.html
-rw-r--r--      2143 2016-12-04 06:07 function.lzf-optimized-for.html
-rw-r--r--      3126 2016-12-04 06:07 imagick.getimagepixelcolor.html
-rw-r--r--      3213 2016-12-04 06:08 evchild.set.html
-rw-r--r--      4272 2016-12-04 06:07 error.gettraceasstring.html
-rw-r--r--      5381 2016-12-04 06:07 cairocontext.setfontoptions.html
-rw-r--r--      3250 2016-12-04 06:07 function.trader-cdlhikkake.html
-rw-r--r--      6734 2016-12-04 06:08 memcached.fetch.html
-rw-r--r--      2770 2016-12-04 06:08 ui-window.construct.html
-rw-r--r--      8938 2016-12-04 06:07 pdo.pgsqllobcreate.html
-rw-r--r--      2415 2016-12-04 06:08 judy.free.html
-rw-r--r--      1318 2016-12-04 06:07 intro.sybase.html
-rw-r--r--      5087 2016-12-04 06:08 ref.sockets.html
-rw-r--r--      1764 2016-12-04 06:08 migration54.removed-extensions.html
-rw-r--r--      5225 2016-12-04 06:07 function.ingres-pconnect.html
-rw-r--r--      3920 2016-12-04 06:07 function.xdiff-string-bpatch.html
-rw-r--r--      5710 2016-12-04 06:08 splfileinfo.getfilename.html
-rw-r--r--      5256 2016-12-04 06:07 oci8.datatypes.html
-rw-r--r--      8932 2016-12-04 06:08 function.curl-multi-add-handle.html
-rw-r--r--      5911 2016-12-04 06:07 intlchar.isidignorable.html
-rw-r--r--      3115 2016-12-04 06:08 function.pdf-add-weblink.html
-rw-r--r--      2661 2016-12-04 06:07 intlbreakiterator.gettext.html
-rw-r--r--      5791 2016-12-04 06:07 function.mb-encoding-aliases.html
-rw-r--r--      2548 2016-12-04 06:08 evsignal.set.html
-rw-r--r--      3627 2016-12-04 06:08 regexp.reference.delimiters.html
-rw-r--r--      3706 2016-12-04 06:08 function.session-decode.html
-rw-r--r--      3248 2016-12-04 06:08 net-gopher.constants.html
-rw-r--r--      5817 2016-12-04 06:07 function.mongodb.bson-fromphp.html
-rw-r--r--      8868 2016-12-04 06:07 function.imap-delete.html
-rw-r--r--      3031 2016-12-04 06:07 imagick.setimageredprimary.html
-rw-r--r--      2857 2016-12-04 06:07 gmagickpixel.setcolor.html
-rw-r--r--      4840 2016-12-04 06:07 function.ifx-num-fields.html
-rw-r--r--      8791 2016-12-04 06:08 function.preg-replace-callback-array.html
-rw-r--r--      1363 2016-12-04 06:07 tokyo-tyrant.resources.html
-rw-r--r--      2645 2016-12-04 06:08 solrdocument.unserialize.html
-rw-r--r--      3338 2016-12-04 06:07 function.newt-entry.html
-rw-r--r--      4405 2016-12-04 06:07 function.fdf-set-submit-form-action.html
-rw-r--r--      7575 2016-12-04 06:07 function.mysql-list-processes.html
-rw-r--r--      3027 2016-12-04 06:07 intltimezone.fromdatetimezone.html
-rw-r--r--      2486 2016-12-04 06:07 oop5.intro.html
-rw-r--r--     20836 2016-12-04 06:08 com.constants.html
-rw-r--r--      2695 2016-12-04 06:07 function.odbc-close-all.html
-rw-r--r--      8156 2016-12-04 06:07 features.dtrace.systemtap.html
-rw-r--r--      2920 2016-12-04 06:07 intlbreakiterator.createcodepointinstance.html
-rw-r--r--      3368 2016-12-04 06:07 mpegfile.construct.html
-rw-r--r--      7638 2016-12-04 06:08 zookeeper.addauth.html
-rw-r--r--      4448 2016-12-04 06:07 function.cairo-pattern-get-surface.html
-rw-r--r--      6672 2016-12-04 06:08 function.classkit-import.html
-rw-r--r--     10440 2016-12-04 06:08 class.multipleiterator.html
-rw-r--r--      1322 2016-12-04 06:07 vpopmail.requirements.html
-rw-r--r--      6231 2016-12-04 06:08 function.fann-train-on-file.html
-rw-r--r--      8228 2016-12-04 06:07 function.assert-options.html
-rw-r--r--      3371 2016-12-04 06:08 function.posix-getuid.html
-rw-r--r--      6538 2016-12-04 06:08 swishresult.stem.html
-rw-r--r--      4313 2016-12-04 06:08 ds-sequence.reversed.html
-rw-r--r--      5648 2016-12-04 06:07 class.mongodb-driver-cursor.html
-rw-r--r--      6483 2016-12-04 06:08 solrdocument.toarray.html
-rw-r--r--      2430 2016-12-04 06:08 event.flags.html
-rw-r--r--      3124 2016-12-04 06:08 function.ps-save.html
-rw-r--r--      3445 2016-12-04 06:07 function.asin.html
-rw-r--r--      7356 2016-12-04 06:08 function.nl2br.html
-rw-r--r--     33937 2016-12-04 06:07 mysqlnd-ms.quickstart.gtid.html
-rw-r--r--      3667 2016-12-04 06:08 function.win32-start-service.html
-rw-r--r--      3736 2016-12-04 06:07 function.maxdb-init.html
-rw-r--r--      6214 2016-12-04 06:07 function.wincache-ucache-cas.html
-rw-r--r--     13966 2016-12-04 06:08 internals2.funcs.html
-rw-r--r--      4188 2016-12-04 06:07 imagick.liquidrescaleimage.html
-rw-r--r--      5090 2016-12-04 06:08 solrclient.optimize.html
-rw-r--r--      2251 2016-12-04 06:08 function.pdf-setlinejoin.html
-rw-r--r--      4120 2016-12-04 06:07 mysqli-stmt.reset.html
-rw-r--r--      8604 2016-12-04 06:08 yaf-plugin-abstract.routershutdown.html
-rw-r--r--      1329 2016-12-04 06:07 mailparse.requirements.html
-rw-r--r--     10827 2016-12-04 06:07 function.sqlsrv-get-field.html
-rw-r--r--      1851 2016-12-04 06:07 function.set-file-buffer.html
-rw-r--r--     20145 2016-12-04 06:08 sockets.examples.html
-rw-r--r--      3041 2016-12-04 06:08 haruannotation.setopened.html
-rw-r--r--      3099 2016-12-04 06:07 function.openal-buffer-destroy.html
-rw-r--r--      3294 2016-12-04 06:08 function.fann-get-mse.html
-rw-r--r--      2007 2016-12-04 06:07 function.date-get-last-errors.html
-rw-r--r--     39199 2016-12-04 06:07 language.operators.comparison.html
-rw-r--r--      2866 2016-12-04 06:07 uconverter.convert.html
-rw-r--r--      6408 2016-12-04 06:07 intlcalendar.gettime.html
-rw-r--r--      2794 2016-12-04 06:08 swffill.rotateto.html
-rw-r--r--      4566 2016-12-04 06:07 function.cubrid-lob2-size64.html
-rw-r--r--      3847 2016-12-04 06:07 function.dbplus-rchperm.html
-rw-r--r--     10563 2016-12-04 06:07 function.imap-fetch-overview.html
-rw-r--r--      3869 2016-12-04 06:08 function.fann-get-cascade-num-candidate-groups.html
-rw-r--r--      7245 2016-12-04 06:07 intldateformatter.getcalendarobject.html
-rw-r--r--      5947 2016-12-04 06:07 function.mb-eregi-replace.html
-rw-r--r--      2803 2016-12-04 06:07 function.ncurses-delay-output.html
-rw-r--r--      2454 2016-12-04 06:08 solrquery.getterms.html
-rw-r--r--    102082 2016-12-04 06:08 class.solrquery.html
-rw-r--r--      7198 2016-12-04 06:07 function.pg-result-status.html
-rw-r--r--     18454 2016-12-04 06:08 filter.constants.html
-rw-r--r--      2703 2016-12-04 06:08 function.pdf-get-pdi-value.html
-rw-r--r--      1529 2016-12-04 06:07 sqlite.setup.html
-rw-r--r--     11088 2016-12-04 06:08 sam.installation.html
-rw-r--r--      2506 2016-12-04 06:07 function.trader-ht-trendline.html
-rw-r--r--      4002 2016-12-04 06:07 function.sybase-close.html
-rw-r--r--     15402 2016-12-04 06:08 class.sessionhandlerinterface.html
-rw-r--r--      4741 2016-12-04 06:07 function.cairo-font-options-equal.html
-rw-r--r--      2645 2016-12-04 06:08 solrquery.getfacetprefix.html
-rw-r--r--      1796 2016-12-04 06:07 timezones.australia.html
-rw-r--r--      4487 2016-12-04 06:07 function.cairo-scaled-font-get-ctm.html
-rw-r--r--      7611 2016-12-04 06:07 mongocommandcursor.timeout.html
-rw-r--r--      1419 2016-12-04 06:08 intro.stomp.html
-rw-r--r--      6336 2016-12-04 06:07 function.imagecrop.html
-rw-r--r--     20707 2016-12-04 06:07 mysqli.construct.html
-rw-r--r--      2813 2016-12-04 06:08 solrquery.getfacetdatehardend.html
-rw-r--r--      3955 2016-12-04 06:08 ds-deque.first.html
-rw-r--r--      4466 2016-12-04 06:07 error.gettrace.html
-rw-r--r--      4648 2016-12-04 06:08 worker.stack.html
-rw-r--r--      2347 2016-12-04 06:08 ui-controls-button.settext.html
-rw-r--r--      1335 2016-12-04 06:07 mbstring.resources.html
-rw-r--r--      7366 2016-12-04 06:08 book.session.html
-rw-r--r--      2842 2016-12-04 06:08 solrinputdocument.getfieldboost.html
-rw-r--r--      2904 2016-12-04 06:07 function.odbc-field-num.html
-rw-r--r--      7553 2016-12-04 06:07 function.fseek.html
-rw-r--r--     27192 2016-12-04 06:08 eventbufferevent.connect.html
-rw-r--r--      7182 2016-12-04 06:08 stomp.getsessionid.html
-rw-r--r--      1345 2016-12-04 06:08 eio.resources.html
-rw-r--r--     10531 2016-12-04 06:07 function.phpinfo.html
-rw-r--r--      5311 2016-12-04 06:08 function.curl-close.html
-rw-r--r--      5273 2016-12-04 06:08 function.is-float.html
-rw-r--r--     14532 2016-12-04 06:08 function.ldap-control-paged-result.html
-rw-r--r--      5237 2016-12-04 06:07 cairocontext.setlinewidth.html
-rw-r--r--      4209 2016-12-04 06:07 cairosurface.setdeviceoffset.html
-rw-r--r--      3046 2016-12-04 06:07 intltimezone.getequivalentid.html
-rw-r--r--      6746 2016-12-04 06:08 domdocument.loadhtmlfile.html
-rw-r--r--      4587 2016-12-04 06:07 function.is-nan.html
-rw-r--r--     25606 2016-12-04 06:08 extensions.alphabetical.html
-rw-r--r--     16568 2016-12-04 06:07 pdo-4d.examples.html
-rw-r--r--      4677 2016-12-04 06:08 internals2.opcodes.jmpznz.html
-rw-r--r--      3341 2016-12-04 06:07 imagick.getimagelength.html
-rw-r--r--      8056 2016-12-04 06:07 mongodb-driver-command.construct.html
-rw-r--r--      6044 2016-12-04 06:08 class.gearmanexception.html
-rw-r--r--      1874 2016-12-04 06:08 intro.svn.html
-rw-r--r--      3036 2016-12-04 06:07 haru.builtin.fonts.html
-rw-r--r--      8643 2016-12-04 06:07 transliterator.transliterate.html
-rw-r--r--      1490 2016-12-04 06:08 yaf.setup.html
-rw-r--r--      2826 2016-12-04 06:07 ibase.installation.html
-rw-r--r--      2504 2016-12-04 06:07 sqlite3.lasterrorcode.html
-rw-r--r--     12605 2016-12-04 06:08 function.snmp3-set.html
-rw-r--r--      6223 2016-12-04 06:07 function.openssl-pkcs7-verify.html
-rw-r--r--     32503 2016-12-04 06:07 function.oci-get-implicit-resultset.html
-rw-r--r--      3788 2016-12-04 06:08 function.fann-get-bit-fail-limit.html
-rw-r--r--      1381 2016-12-04 06:08 com.requirements.html
-rw-r--r--      8417 2016-12-04 06:07 locale.getdisplayscript.html
-rw-r--r--      1507 2016-12-04 06:07 csprng.setup.html
-rw-r--r--     12104 2016-12-04 06:07 function.cubrid-connect.html
-rw-r--r--      3073 2016-12-04 06:08 hwapi.unlock.html
-rw-r--r--      2440 2016-12-04 06:08 splfileinfo.iswritable.html
-rw-r--r--      2699 2016-12-04 06:07 imagick.getpointsize.html
-rw-r--r--      3773 2016-12-04 06:08 ui-draw-brush-gradient.setstop.html
-rw-r--r--      2739 2016-12-04 06:07 gmagick.getimagemattecolor.html
-rw-r--r--      4745 2016-12-04 06:07 mysqli.debug.html
-rw-r--r--      2158 2016-12-04 06:07 mysqlnd-mux.changes-one-o.html
-rw-r--r--      7354 2016-12-04 06:07 function.sqlite-busy-timeout.html
-rw-r--r--      1544 2016-12-04 06:08 parsekit.setup.html
-rw-r--r--      1964 2016-12-04 06:07 sqlite3.installation.html
-rw-r--r--      1307 2016-12-04 06:08 pcre.resources.html
-rw-r--r--      5503 2016-12-04 06:08 function.socket-send.html
-rw-r--r--      5338 2016-12-04 06:07 function.mb-strripos.html
-rw-r--r--      5361 2016-12-04 06:08 ds-set.remove.html
-rw-r--r--      2147 2016-12-04 06:08 lua.installation.html
-rw-r--r--      2459 2016-12-04 06:08 spldoublylinkedlist.next.html
-rw-r--r--      2690 2016-12-04 06:07 ref.intl.grapheme.html
-rw-r--r--      2843 2016-12-04 06:08 solrparams.set.html
-rw-r--r--     13283 2016-12-04 06:07 class.sqlite3.html
-rw-r--r--      4502 2016-12-04 06:08 syncsemaphore.unlock.html
-rw-r--r--      3301 2016-12-04 06:07 oci-lob.erase.html
-rw-r--r--      2681 2016-12-04 06:08 solrquery.getmltmintermfrequency.html
-rw-r--r--      3855 2016-12-04 06:08 sessionhandlerinterface.open.html
-rw-r--r--      2242 2016-12-04 06:08 zmqpoll.clear.html
-rw-r--r--      1356 2016-12-04 06:08 stream.configuration.html
-rw-r--r--      2277 2016-12-04 06:08 varnishlog.getline.html
-rw-r--r--     29681 2016-12-04 06:08 function.json-encode.html
-rw-r--r--     15095 2016-12-04 06:07 function.oci-rollback.html
-rw-r--r--      5282 2016-12-04 06:07 function.cubrid-client-encoding.html
-rw-r--r--     12291 2016-12-04 06:08 ref.strings.html
-rw-r--r--      5037 2016-12-04 06:07 class.assertionerror.html
-rw-r--r--     10313 2016-12-04 06:08 function.snmpset.html
-rw-r--r--      4002 2016-12-04 06:07 function.odbc-primarykeys.html
-rw-r--r--      4022 2016-12-04 06:07 gmagick.annotateimage.html
-rw-r--r--      2907 2016-12-04 06:08 sdo-dataobject.gettypenamespaceuri.html
-rw-r--r--      1788 2016-12-04 06:07 mysqlnd-memcache.changes.html
-rw-r--r--      2708 2016-12-04 06:08 recursivetreeiterator.valid.html
-rw-r--r--      1335 2016-12-04 06:08 msession.resources.html
-rw-r--r--      6051 2016-12-04 06:08 function.function-exists.html
-rw-r--r--      5365 2016-12-04 06:07 locale.getscript.html
-rw-r--r--      1342 2016-12-04 06:08 simplexml.resources.html
-rw-r--r--      1529 2016-12-04 06:07 fbsql.setup.html
-rw-r--r--      4137 2016-12-04 06:07 function.fbsql-insert-id.html
-rw-r--r--      3169 2016-12-04 06:08 gearmantask.unique.html
-rw-r--r--      3526 2016-12-04 06:08 function.posix-ttyname.html
-rw-r--r--      4558 2016-12-04 06:08 function.fann-test.html
-rw-r--r--      1923 2016-12-04 06:08 function.pdf-set-info-keywords.html
-rw-r--r--      2446 2016-12-04 06:08 solrdocument.reset.html
-rw-r--r--      3091 2016-12-04 06:07 function.newt-grid-get-size.html
-rw-r--r--      2400 2016-12-04 06:07 mysqlnd-memcache.requirements.html
-rw-r--r--      8345 2016-12-04 06:07 class.imagickpixeliterator.html
-rw-r--r--      2693 2016-12-04 06:07 xattr.constants.html
-rw-r--r--      4170 2016-12-04 06:07 function.id3-get-genre-name.html
-rw-r--r--      2999 2016-12-04 06:07 function.m-validateidentifier.html
-rw-r--r--      6222 2016-12-04 06:07 ingres.examples-basic.html
-rw-r--r--      6577 2016-12-04 06:07 phar.createdefaultstub.html
-rw-r--r--      7123 2016-12-04 06:08 class.recursivefilteriterator.html
-rw-r--r--      3123 2016-12-04 06:07 imagick.setimagecolormapcolor.html
-rw-r--r--      4826 2016-12-04 06:08 function.ps-arc.html
-rw-r--r--      8120 2016-12-04 06:07 function.mb-send-mail.html
-rw-r--r--      2777 2016-12-04 06:07 imagick.writeimagesfile.html
-rw-r--r--      2778 2016-12-04 06:08 function.fann-get-connection-rate.html
-rw-r--r--     11799 2016-12-04 06:08 class.yaf-action-abstract.html
-rw-r--r--      5280 2016-12-04 06:08 domnode.getnodepath.html
-rw-r--r--      5091 2016-12-04 06:08 memcached.getstats.html
-rw-r--r--     22219 2016-12-04 06:08 class.eventutil.html
-rw-r--r--      4290 2016-12-04 06:08 function.eio-busy.html
-rw-r--r--      3571 2016-12-04 06:07 fdf.installation.html
-rw-r--r--      1509 2016-12-04 06:07 oci8.setup.html
-rw-r--r--      3710 2016-12-04 06:08 internals2.opcodes.init-fcall-by-name.html
-rw-r--r--      2664 2016-12-04 06:08 splpriorityqueue.rewind.html
-rw-r--r--      5670 2016-12-04 06:08 quickhashintset.delete.html
-rw-r--r--     12743 2016-12-04 06:08 class.yaf-session.html
-rw-r--r--      5901 2016-12-04 06:07 class.mongoprotocolexception.html
-rw-r--r--      2467 2016-12-04 06:08 yaf-config-ini.current.html
-rw-r--r--      7543 2016-12-04 06:07 class.cairogradientpattern.html
-rw-r--r--      5319 2016-12-04 06:07 function.gmp-perfect-square.html
-rw-r--r--     13432 2016-12-04 06:08 book.ev.html
-rw-r--r--      2696 2016-12-04 06:07 uconverter.setsubstchars.html
-rw-r--r--      5624 2016-12-04 06:07 intlchar.isprint.html
-rw-r--r--      7272 2016-12-04 06:07 cairocontext.copypage.html
-rw-r--r--      1969 2016-12-04 06:08 ref.ming.html
-rw-r--r--     21400 2016-12-04 06:07 function.cubrid-bind.html
-rw-r--r--      2881 2016-12-04 06:07 gmagick.edgeimage.html
-rw-r--r--      9668 2016-12-04 06:08 reflectionfunction.invokeargs.html
-rw-r--r--      3039 2016-12-04 06:08 function.variant-set.html
-rw-r--r--      6697 2016-12-04 06:08 function.stream-filter-remove.html
-rw-r--r--      3362 2016-12-04 06:08 function.fann-set-quickprop-mu.html
-rw-r--r--      3670 2016-12-04 06:08 xmlreader.movetonextattribute.html
-rw-r--r--      4955 2016-12-04 06:07 spoofchecker.areconfusable.html
-rw-r--r--      2400 2016-12-04 06:07 audioproperties.getlayer.html
-rw-r--r--      1342 2016-12-04 06:08 wddx.configuration.html
-rw-r--r--      2170 2016-12-04 06:07 function.ocicollassignelem.html
-rw-r--r--      1377 2016-12-04 06:08 simplexml.configuration.html
-rw-r--r--     10618 2016-12-04 06:07 mongocursor.batchsize.html
-rw-r--r--      4147 2016-12-04 06:08 function.ldap-next-entry.html
-rw-r--r--     19183 2016-12-04 06:08 function.session-regenerate-id.html
-rw-r--r--      2784 2016-12-04 06:08 swftextfield.setlinespacing.html
-rw-r--r--      1746 2016-12-04 06:08 intro.memcache.html
-rw-r--r--      4518 2016-12-04 06:07 intro.maxdb.html
-rw-r--r--      5787 2016-12-04 06:08 function.eio-futime.html
-rw-r--r--      2400 2016-12-04 06:07 imagick.haspreviousimage.html
-rw-r--r--      7634 2016-12-04 06:07 mysqli.store-result.html
-rw-r--r--      2811 2016-12-04 06:08 solrinputdocument.setboost.html
-rw-r--r--      4690 2016-12-04 06:08 ds-map.skip.html
-rw-r--r--      1295 2016-12-04 06:07 intro.gnupg.html
-rw-r--r--      4365 2016-12-04 06:08 haruimage.setcolormask.html
-rw-r--r--     13151 2016-12-04 06:07 mongocollection.save.html
-rw-r--r--      2566 2016-12-04 06:08 soapheader.construct.html
-rw-r--r--      2493 2016-12-04 06:07 function.ncurses-panel-window.html
-rw-r--r--     12663 2016-12-04 06:07 datetime.add.html
-rw-r--r--      2493 2016-12-04 06:08 ui-draw-text-font-descriptor.getweight.html
-rw-r--r--     14200 2016-12-04 06:08 class.swfdisplayitem.html
-rw-r--r--      4475 2016-12-04 06:07 function.imap-body.html
-rw-r--r--      3455 2016-12-04 06:07 function.openal-source-play.html
-rw-r--r--      2157 2016-12-04 06:08 yaml.installation.html
-rw-r--r--     10896 2016-12-04 06:07 function.imagesetpixel.html
-rw-r--r--      1481 2016-12-04 06:08 quickhash.setup.html
-rw-r--r--      2356 2016-12-04 06:08 evloop.invokepending.html
-rw-r--r--      2516 2016-12-04 06:07 security.cgi-bin.shell.html
-rw-r--r--      1505 2016-12-04 06:07 msql.setup.html
-rw-r--r--      7481 2016-12-04 06:07 mysqli.connect-error.html
-rw-r--r--     14462 2016-12-04 06:07 function.mcrypt-module-open.html
-rw-r--r--      3495 2016-12-04 06:08 function.fann-set-quickprop-decay.html
-rw-r--r--      1499 2016-12-04 06:08 ctype.setup.html
-rw-r--r--      6819 2016-12-04 06:07 function.date-default-timezone-set.html
-rw-r--r--      2508 2016-12-04 06:08 function.pdf-fit-pdi-page.html
-rw-r--r--      7651 2016-12-04 06:08 function.ldap-get-values.html
-rw-r--r--     11607 2016-12-04 06:07 mongo.installation.html
-rw-r--r--      2189 2016-12-04 06:07 mssql.resources.html
-rw-r--r--      1698 2016-12-04 06:07 pharexception.intro.unused.html
-rw-r--r--      3137 2016-12-04 06:08 reflectionclass.getparentclass.html
-rw-r--r--      3698 2016-12-04 06:07 ref.apd.html
-rw-r--r--      7873 2016-12-04 06:07 function.mysql-fetch-row.html
-rw-r--r--      3132 2016-12-04 06:08 function.session-write-close.html
-rw-r--r--     10392 2016-12-04 06:07 intlcalendar.getrepeatedwalltimeoption.html
-rw-r--r--      1328 2016-12-04 06:08 win32ps.resources.html
-rw-r--r--     13707 2016-12-04 06:07 mysqlnd-ms.pooling.html
-rw-r--r--      2819 2016-12-04 06:08 gearmantask.jobhandle.html
-rw-r--r--      3588 2016-12-04 06:08 function.quoted-printable-decode.html
-rw-r--r--      3290 2016-12-04 06:08 harupage.getgmode.html
-rw-r--r--      8314 2016-12-04 06:08 quickhashinthash.exists.html
-rw-r--r--      3506 2016-12-04 06:07 reserved.variables.html
-rw-r--r--      1549 2016-12-04 06:07 intro.openssl.html
-rw-r--r--      4859 2016-12-04 06:07 cairocontext.resetclip.html
-rw-r--r--      3006 2016-12-04 06:07 imagickdraw.pathlinetohorizontalrelative.html
-rw-r--r--      2830 2016-12-04 06:08 function.get-declared-traits.html
-rw-r--r--      2359 2016-12-04 06:07 dba.configuration.html
-rw-r--r--      2746 2016-12-04 06:08 event.getsupportedmethods.html
-rw-r--r--      5160 2016-12-04 06:07 function.cairo-pattern-create-linear.html
-rw-r--r--     12267 2016-12-04 06:08 function.eio-read.html
-rw-r--r--      2663 2016-12-04 06:08 function.rrdc-disconnect.html
-rw-r--r--      1409 2016-12-04 06:08 intro.oauth.html
-rw-r--r--      3508 2016-12-04 06:07 function.mcrypt-module-is-block-algorithm.html
-rw-r--r--      2687 2016-12-04 06:07 security.cgi-bin.force-redirect.html
-rw-r--r--      5249 2016-12-04 06:08 arrayobject.offsetget.html
-rw-r--r--      7465 2016-12-04 06:07 function.openssl-spki-export-challenge.html
-rw-r--r--      1477 2016-12-04 06:08 ps.setup.html
-rw-r--r--      3885 2016-12-04 06:07 function.inotify-queue-len.html
-rw-r--r--      2146 2016-12-04 06:07 function.ncurses-reset-shell-mode.html
-rw-r--r--      4538 2016-12-04 06:08 gearmanclient.addservers.html
-rw-r--r--      3766 2016-12-04 06:07 intro.fdf.html
-rw-r--r--      2560 2016-12-04 06:08 harufont.getencodingname.html
-rw-r--r--      4244 2016-12-04 06:08 multipleiterator.attachiterator.html
-rw-r--r--      2674 2016-12-04 06:07 gmagickdraw.polygon.html
-rw-r--r--      8672 2016-12-04 06:08 arrayobject.uksort.html
-rw-r--r--      7189 2016-12-04 06:07 function.grapheme-strstr.html
-rw-r--r--      5398 2016-12-04 06:07 function.runkit-function-copy.html
-rw-r--r--      7373 2016-12-04 06:08 migration71.constants.html
-rw-r--r--      4623 2016-12-04 06:08 function.gupnp-service-proxy-callback-set.html
-rw-r--r--      2292 2016-12-04 06:08 varnishadmin.start.html
-rw-r--r--      7050 2016-12-04 06:07 function.radius-put-int.html
-rw-r--r--     21031 2016-12-04 06:07 security.database.sql-injection.html
-rw-r--r--      3139 2016-12-04 06:08 function.session-pgsql-set-field.html
-rw-r--r--      2008 2016-12-04 06:08 function.pdf-resume-page.html
-rw-r--r--      2283 2016-12-04 06:07 function.readline-on-new-line.html
-rw-r--r--      3758 2016-12-04 06:07 cairoscaledfont.getscalematrix.html
-rw-r--r--      3455 2016-12-04 06:08 function.sem-release.html
-rw-r--r--      3724 2016-12-04 06:08 function.fann-get-training-algorithm.html
-rw-r--r--      4557 2016-12-04 06:08 hwapi.checkin.html
-rw-r--r--      6393 2016-12-04 06:08 solrdismaxquery.removeboostquery.html
-rw-r--r--      5737 2016-12-04 06:07 function.restore-error-handler.html
-rw-r--r--      2308 2016-12-04 06:08 function.pdf-load-font.html
-rw-r--r--      7078 2016-12-04 06:07 refs.international.html
-rw-r--r--      4562 2016-12-04 06:08 memcached.appendbykey.html
-rw-r--r--      2781 2016-12-04 06:08 function.svn-fs-delete.html
-rw-r--r--      4223 2016-12-04 06:07 imagick.flopimage.html
-rw-r--r--      1520 2016-12-04 06:08 intro.gupnp.html
-rw-r--r--      1481 2016-12-04 06:07 mongo.gridfs.html
-rw-r--r--      2324 2016-12-04 06:08 function.pdf-info-font.html
-rw-r--r--      1498 2016-12-04 06:07 cairo.setup.html
-rw-r--r--      7539 2016-12-04 06:07 resourcebundle.create.html
-rw-r--r--      6194 2016-12-04 06:07 mongoid.tostring.html
-rw-r--r--      1600 2016-12-04 06:08 migration54.deprecated.html
-rw-r--r--      3219 2016-12-04 06:07 function.dgettext.html
-rw-r--r--      3795 2016-12-04 06:08 eventhttprequest.addheader.html
-rw-r--r--      9315 2016-12-04 06:08 function.get-class.html
-rw-r--r--      5970 2016-12-04 06:07 function.fdf-open.html
-rw-r--r--      7780 2016-12-04 06:08 class.ui-controls-form.html
-rw-r--r--      4542 2016-12-04 06:08 ds-deque.shift.html
-rw-r--r--      2552 2016-12-04 06:08 yaf-session.unset.html
-rw-r--r--      3010 2016-12-04 06:08 reflectionfunctionabstract.getclosurescopeclass.html
-rw-r--r--      4748 2016-12-04 06:08 simplexmlelement.getname.html
-rw-r--r--     21502 2016-12-04 06:08 sdodasrel.metadata.html
-rw-r--r--     27019 2016-12-04 06:08 class.harudoc.html
-rw-r--r--      2793 2016-12-04 06:07 imagickdraw.setresolution.html
-rw-r--r--      2714 2016-12-04 06:08 function.pdf-get-pdi-parameter.html
-rw-r--r--      5853 2016-12-04 06:07 imagick.evaluateimage.html
-rw-r--r--      8843 2016-12-04 06:07 imagickdraw.setstrokealpha.html
-rw-r--r--      5226 2016-12-04 06:07 function.imagecreatefromgd.html
-rw-r--r--      3508 2016-12-04 06:08 v8js.configuration.html
-rw-r--r--      6680 2016-12-04 06:08 class.ui-controls-colorbutton.html
-rw-r--r--      2929 2016-12-04 06:07 mongodb.dropcollection.html
-rw-r--r--      2923 2016-12-04 06:07 function.m-returnstatus.html
-rw-r--r--      2846 2016-12-04 06:07 oci-lob.eof.html
-rw-r--r--      6014 2016-12-04 06:08 function.is-null.html
-rw-r--r--      2898 2016-12-04 06:07 function.newt-checkbox-set-value.html
-rw-r--r--      2681 2016-12-04 06:07 class.mongodb-bson-minkey.html
-rw-r--r--      1403 2016-12-04 06:08 posix.installation.html
-rw-r--r--      3649 2016-12-04 06:08 sphinxclient.setgroupdistinct.html
-rw-r--r--     11018 2016-12-04 06:07 function.pg-connect.html
-rw-r--r--      2882 2016-12-04 06:08 solrquery.gethighlightsimplepre.html
-rw-r--r--      2203 2016-12-04 06:08 sdodasrel.installation.html
-rw-r--r--      2744 2016-12-04 06:07 book.dbx.html
-rw-r--r--      8418 2016-12-04 06:07 intldateformatter.gettimezone.html
-rw-r--r--      9623 2016-12-04 06:08 memcache.set.html
-rw-r--r--      2702 2016-12-04 06:08 function.iis-add-server.html
-rw-r--r--      3809 2016-12-04 06:07 function.ifx-errormsg.html
-rw-r--r--      4048 2016-12-04 06:08 internals2.opcodes.assign.html
-rw-r--r--     15131 2016-12-04 06:08 function.parse-url.html
-rw-r--r--      5505 2016-12-04 06:07 function.dbase-get-record.html
-rw-r--r--      1814 2016-12-04 06:08 function.dns-get-mx.html
-rw-r--r--      6555 2016-12-04 06:08 arrayobject.asort.html
-rw-r--r--      2987 2016-12-04 06:07 function.ncurses-savetty.html
-rw-r--r--      6794 2016-12-04 06:07 mongodb.getreadpreference.html
-rw-r--r--      8546 2016-12-04 06:08 stomp.error.html
-rw-r--r--      3900 2016-12-04 06:08 function.socket-close.html
-rw-r--r--     11942 2016-12-04 06:07 book.pgsql.html
-rw-r--r--      6163 2016-12-04 06:07 function.openssl-pkcs7-decrypt.html
-rw-r--r--      9488 2016-12-04 06:08 libevent.examples.html
-rw-r--r--      2850 2016-12-04 06:08 swfmorph.getshape2.html
-rw-r--r--      2935 2016-12-04 06:08 svmmodel.load.html
-rw-r--r--      8258 2016-12-04 06:08 quickhashinthash.loadfromfile.html
-rw-r--r--      5732 2016-12-04 06:07 class.mongomaxkey.html
-rw-r--r--      2478 2016-12-04 06:07 intliterator.valid.html
-rw-r--r--      4676 2016-12-04 06:08 rrd.examples-procedural.html
-rw-r--r--     13106 2016-12-04 06:07 dbplus.errorcodes.html
-rw-r--r--      4031 2016-12-04 06:08 simplexmlelement.tostring.html
-rw-r--r--      3836 2016-12-04 06:08 domelement.getelementsbytagnamens.html
-rw-r--r--     12573 2016-12-04 06:08 function.array-diff-ukey.html
-rw-r--r--      7634 2016-12-04 06:08 function.mqseries-open.html
-rw-r--r--      4999 2016-12-04 06:07 function.mysql-get-client-info.html
-rw-r--r--      8821 2016-12-04 06:08 function.ldap-bind.html
-rw-r--r--      7607 2016-12-04 06:07 class.mongodb-driver-readconcern.html
-rw-r--r--      2943 2016-12-04 06:07 function.sybase-get-last-message.html
-rw-r--r--      1335 2016-12-04 06:08 sca.configuration.html
-rw-r--r--      2154 2016-12-04 06:08 function.msession-inc.html
-rw-r--r--      8848 2016-12-04 06:07 function.imageflip.html
-rw-r--r--      1855 2016-12-04 06:07 function.diskfreespace.html
-rw-r--r--      4217 2016-12-04 06:07 cairosurface.setfallbackresolution.html
-rw-r--r--     10496 2016-12-04 06:07 mongodb-driver-bulkwrite.delete.html
-rw-r--r--      9678 2016-12-04 06:07 function.imagerectangle.html
-rw-r--r--      3661 2016-12-04 06:08 swftext.setcolor.html
-rw-r--r--      8140 2016-12-04 06:08 function.libxml-set-external-entity-loader.html
-rw-r--r--      6416 2016-12-04 06:07 class.iteratoraggregate.html
-rw-r--r--      5033 2016-12-04 06:08 function.tidy-warning-count.html
-rw-r--r--      4771 2016-12-04 06:07 mysqli.get-client-version.html
-rw-r--r--      3584 2016-12-04 06:08 function.fann-get-train-error-function.html
-rw-r--r--      5996 2016-12-04 06:08 function.yaml-parse-url.html
-rw-r--r--      2640 2016-12-04 06:07 oci-lob.tell.html
-rw-r--r--      3922 2016-12-04 06:08 class.swfsoundinstance.html
-rw-r--r--      1516 2016-12-04 06:08 pcntl.setup.html
-rw-r--r--      4324 2016-12-04 06:07 function.cairo-surface-flush.html
-rw-r--r--      1990 2016-12-04 06:08 regexp.reference.alternation.html
-rw-r--r--      2775 2016-12-04 06:08 swftext.getwidth.html
-rw-r--r--     12451 2016-12-04 06:07 function.mysql-affected-rows.html
-rw-r--r--     11382 2016-12-04 06:07 function.sqlite-fetch-array.html
-rw-r--r--      3128 2016-12-04 06:07 function.cosh.html
-rw-r--r--      3291 2016-12-04 06:07 function.zip-entry-close.html
-rw-r--r--      1816 2016-12-04 06:07 intro.dbx.html
-rw-r--r--      3731 2016-12-04 06:07 function.px-set-tablename.html
-rw-r--r--      8540 2016-12-04 06:08 yaf-dispatcher.catchexception.html
-rw-r--r--      2947 2016-12-04 06:07 function.m-iscommadelimited.html
-rw-r--r--      2818 2016-12-04 06:07 mongoint64.tostring.html
-rw-r--r--      2752 2016-12-04 06:07 function.ncurses-addchstr.html
-rw-r--r--      2743 2016-12-04 06:08 migration51.errorcheck.html
-rw-r--r--      2344 2016-12-04 06:08 varnishadmin.clearpanic.html
-rw-r--r--      2556 2016-12-04 06:08 harupage.fill.html
-rw-r--r--      2747 2016-12-04 06:07 function.newt-resume.html
-rw-r--r--      6298 2016-12-04 06:08 function.xmlwriter-write-element-ns.html
-rw-r--r--      7660 2016-12-04 06:08 ds-deque.contains.html
-rw-r--r--      5658 2016-12-04 06:08 function.ksort.html
-rw-r--r--      8335 2016-12-04 06:07 function.sqlsrv-rows-affected.html
-rw-r--r--      7356 2016-12-04 06:07 function.imagefilledrectangle.html
-rw-r--r--      7230 2016-12-04 06:08 internals2.opcodes.throw.html
-rw-r--r--      9368 2016-12-04 06:08 oauth.getaccesstoken.html
-rw-r--r--      5697 2016-12-04 06:08 function.ps-set-info.html
-rw-r--r--      1301 2016-12-04 06:07 dbase.requirements.html
-rw-r--r--     11112 2016-12-04 06:07 function.db2-procedure-columns.html
-rw-r--r--      6099 2016-12-04 06:08 splfileinfo.getrealpath.html
-rw-r--r--      1321 2016-12-04 06:07 kadm5.examples.html
-rw-r--r--      2447 2016-12-04 06:07 imagick.current.html
-rw-r--r--     10658 2016-12-04 06:07 class.OCI-Lob.html
-rw-r--r--      2904 2016-12-04 06:08 yaf-config-ini.offsetset.html
-rw-r--r--      3752 2016-12-04 06:08 function.ps-setlinecap.html
-rw-r--r--      3094 2016-12-04 06:07 intlbreakiterator.createlineinstance.html
-rw-r--r--      2810 2016-12-04 06:07 function.cyrus-query.html
-rw-r--r--      7062 2016-12-04 06:08 function.yaz-itemorder.html
-rw-r--r--     14219 2016-12-04 06:08 solrclient.adddocument.html
-rw-r--r--     11814 2016-12-04 06:08 class.recursivearrayiterator.html
-rw-r--r--      4462 2016-12-04 06:07 imagickdraw.pathcurvetoabsolute.html
-rw-r--r--      2580 2016-12-04 06:08 yaf-request-simple.getfiles.html
-rw-r--r--      3082 2016-12-04 06:08 swfmovie.setrate.html
-rw-r--r--      6255 2016-12-04 06:07 function.is-readable.html
-rw-r--r--      5317 2016-12-04 06:08 ds-vector.apply.html
-rw-r--r--      2121 2016-12-04 06:08 function.pdf-delete-pvf.html
-rw-r--r--      2477 2016-12-04 06:07 imagick.getimageextrema.html
-rw-r--r--      9797 2016-12-04 06:08 class.domentityreference.html
-rw-r--r--     10718 2016-12-04 06:07 language.constants.syntax.html
-rw-r--r--     25107 2016-12-04 06:08 pcntl.constants.html
-rw-r--r--      5874 2016-12-04 06:07 function.mssql-close.html
-rw-r--r--      3335 2016-12-04 06:07 function.fdf-get-encoding.html
-rw-r--r--      3221 2016-12-04 06:08 libevent.constants.html
-rw-r--r--      3006 2016-12-04 06:08 sdo-model-type.isdatatype.html
-rw-r--r--     95620 2016-12-04 06:08 function.curl-setopt.html
-rw-r--r--      4237 2016-12-04 06:07 function.pspell-check.html
-rw-r--r--      2572 2016-12-04 06:08 ui-draw-color.getchannel.html
-rw-r--r--      4620 2016-12-04 06:07 function.trader-stoch.html
-rw-r--r--      3045 2016-12-04 06:08 yaf-dispatcher.getapplication.html
-rw-r--r--      2760 2016-12-04 06:07 gmagick.getimagechanneldepth.html
-rw-r--r--      2602 2016-12-04 06:08 ui-controls-multilineentry.construct.html
-rw-r--r--      2815 2016-12-04 06:07 function.calculhmac.html
-rw-r--r--      3782 2016-12-04 06:08 function.ps-setlinejoin.html
-rw-r--r--      6095 2016-12-04 06:07 function.xattr-remove.html
-rw-r--r--      3864 2016-12-04 06:07 function.fdf-get-ap.html
-rw-r--r--      2894 2016-12-04 06:08 internals2.opcodes.assign-sl.html
-rw-r--r--     11214 2016-12-04 06:07 mysqli.thread-id.html
-rw-r--r--     10450 2016-12-04 06:07 numberformatter.create.html
-rw-r--r--      3057 2016-12-04 06:08 gearmanworker.echo.html
-rw-r--r--     18088 2016-12-04 06:07 class.mongolog.html
-rw-r--r--     24524 2016-12-04 06:07 class.intlrulebasedbreakiterator.html
-rw-r--r--      4889 2016-12-04 06:08 recursivecallbackfilteriterator.construct.html
-rw-r--r--      1634 2016-12-04 06:08 iisfunc.installation.html
-rw-r--r--      2995 2016-12-04 06:08 reflectionproperty.getname.html
-rw-r--r--      3882 2016-12-04 06:07 cairopssurface.dsccomment.html
-rw-r--r--      4030 2016-12-04 06:07 function.fbsql-hostname.html
-rw-r--r--      3560 2016-12-04 06:07 language.references.arent.html
-rw-r--r--      7263 2016-12-04 06:08 function.eio-cancel.html
-rw-r--r--      1937 2016-12-04 06:08 function.pdf-get-image-width.html
-rw-r--r--      2508 2016-12-04 06:08 swftext.getdescent.html
-rw-r--r--      4967 2016-12-04 06:08 tidynode.getparent.html
-rw-r--r--      9316 2016-12-04 06:07 function.cubrid-fetch-assoc.html
-rw-r--r--      1349 2016-12-04 06:07 bzip2.configuration.html
-rw-r--r--      8341 2016-12-04 06:08 function.strnatcmp.html
-rw-r--r--      3232 2016-12-04 06:08 yaf-plugin-abstract.predispatch.html
-rw-r--r--      6624 2016-12-04 06:07 apcu.constants.html
-rw-r--r--      5376 2016-12-04 06:08 internals2.opcodes.switch-free.html
-rw-r--r--     15114 2016-12-04 06:08 function.setlocale.html
-rw-r--r--      6543 2016-12-04 06:08 function.array-merge-recursive.html
-rw-r--r--     11512 2016-12-04 06:07 intldateformatter.localtime.html
-rw-r--r--      2943 2016-12-04 06:07 arrayaccess.offsetunset.html
-rw-r--r--      3335 2016-12-04 06:07 features.cookies.html
-rw-r--r--      2713 2016-12-04 06:08 function.eio-set-max-idle.html
-rw-r--r--      3138 2016-12-04 06:08 xml.encoding.html
-rw-r--r--      1385 2016-12-04 06:07 scream.examples.html
-rw-r--r--      3065 2016-12-04 06:07 pdo-4d.constants.html
-rw-r--r--      3474 2016-12-04 06:08 zookeeper.isrecoverable.html
-rw-r--r--      2640 2016-12-04 06:07 function.stats-rand-gen-t.html
-rw-r--r--      2850 2016-12-04 06:07 function.mailparse-msg-get-part.html
-rw-r--r--     19700 2016-12-04 06:07 mysqli.rollback.html
-rw-r--r--      3093 2016-12-04 06:07 gmagickdraw.setstrokecolor.html
-rw-r--r--      1331 2016-12-04 06:07 memtrack.examples.html
-rw-r--r--      5239 2016-12-04 06:07 function.imap-savebody.html
-rw-r--r--      2714 2016-12-04 06:07 function.trader-linearreg.html
-rw-r--r--      5512 2016-12-04 06:07 function.filesize.html
-rw-r--r--      4649 2016-12-04 06:07 imagick.oilpaintimage.html
-rw-r--r--      3892 2016-12-04 06:08 reflectionproperty.export.html
-rw-r--r--      7266 2016-12-04 06:08 function.classkit-method-copy.html
-rw-r--r--      4208 2016-12-04 06:08 function.xmlrpc-decode.html
-rw-r--r--      2789 2016-12-04 06:08 function.svn-fs-file-length.html
-rw-r--r--      2434 2016-12-04 06:07 imagick.getinterlacescheme.html
-rw-r--r--      2964 2016-12-04 06:07 function.ncurses-wvline.html
-rw-r--r--      2259 2016-12-04 06:08 ui-point.setx.html
-rw-r--r--      8870 2016-12-04 06:07 pdo.pgsqllobopen.html
-rw-r--r--      7189 2016-12-04 06:07 imagick.setsamplingfactors.html
-rw-r--r--      8957 2016-12-04 06:07 function.mysql-list-fields.html
-rw-r--r--      4460 2016-12-04 06:08 reflectionclass.newinstancewithoutconstructor.html
-rw-r--r--      3411 2016-12-04 06:08 function.fann-get-rprop-increase-factor.html
-rw-r--r--      3713 2016-12-04 06:07 mysqli-stmt.close.html
-rw-r--r--      1825 2016-12-04 06:08 intro.mqseries.html
-rw-r--r--      4459 2016-12-04 06:07 function.cairo-pattern-get-linear-points.html
-rw-r--r--      3241 2016-12-04 06:08 migration53.html
-rw-r--r--      6503 2016-12-04 06:07 function.fbsql-fetch-object.html
-rw-r--r--      4381 2016-12-04 06:08 fam.constants.html
-rw-r--r--      3427 2016-12-04 06:08 eventbase.gotexit.html
-rw-r--r--      2464 2016-12-04 06:08 yaf-loader.clone.html
-rw-r--r--      4719 2016-12-04 06:07 function.sin.html
-rw-r--r--      9449 2016-12-04 06:07 mysqlnd-ms.quickstart.configuration.html
-rw-r--r--      4355 2016-12-04 06:08 function.ldap-mod-replace.html
-rw-r--r--      2509 2016-12-04 06:07 pdo.intransaction.html
-rw-r--r--      2422 2016-12-04 06:07 imagickdraw.getgravity.html
-rw-r--r--      2736 2016-12-04 06:07 function.mcrypt-enc-get-key-size.html
-rw-r--r--      6350 2016-12-04 06:07 language.constants.predefined.html
-rw-r--r--      4504 2016-12-04 06:08 yaf-application.environ.html
-rw-r--r--      3555 2016-12-04 06:07 function.runkit-constant-remove.html
-rw-r--r--      7752 2016-12-04 06:07 mongodb.overview.html
-rw-r--r--      2547 2016-12-04 06:08 about.notes.html
-rw-r--r--      6502 2016-12-04 06:08 globiterator.construct.html
-rw-r--r--      1214 2016-12-04 06:08 chdb.constants.html
-rw-r--r--      2276 2016-12-04 06:08 function.event-free.html
-rw-r--r--      2306 2016-12-04 06:08 splfixedarray.key.html
-rw-r--r--      4677 2016-12-04 06:07 mongoregex.tostring.html
-rw-r--r--      8607 2016-12-04 06:07 intlchar.hasbinaryproperty.html
-rw-r--r--      3189 2016-12-04 06:07 function.trader-willr.html
-rw-r--r--      3896 2016-12-04 06:08 samconnection.commit.html
-rw-r--r--      1308 2016-12-04 06:08 apache.requirements.html
-rw-r--r--      6197 2016-12-04 06:08 class.yaf-bootstrap-abstract.html
-rw-r--r--      3520 2016-12-04 06:08 evloop.prepare.html
-rw-r--r--      3297 2016-12-04 06:08 userlandnaming.tips.html
-rw-r--r--      4713 2016-12-04 06:08 class.mutex.html
-rw-r--r--      5962 2016-12-04 06:07 imagick.roundcorners.html
-rw-r--r--      8441 2016-12-04 06:07 function.ibase-blob-import.html
-rw-r--r--      2961 2016-12-04 06:08 yaf-config-simple.offsetset.html
-rw-r--r--      1531 2016-12-04 06:08 ref.stomp.html
-rw-r--r--      4355 2016-12-04 06:07 function.tan.html
-rw-r--r--      2755 2016-12-04 06:08 recursivetreeiterator.rewind.html
-rw-r--r--     13149 2016-12-04 06:07 mysqli-result.fetch-row.html
-rw-r--r--      6596 2016-12-04 06:07 phar.setdefaultstub.html
-rw-r--r--      3278 2016-12-04 06:08 function.eio-init.html
-rw-r--r--      2225 2016-12-04 06:08 ui-controls-box.ispadded.html
-rw-r--r--      5762 2016-12-04 06:08 regexp.reference.internal-options.html
-rw-r--r--      7917 2016-12-04 06:07 mysqlnduhconnection.getsqlstate.html
-rw-r--r--      6501 2016-12-04 06:08 function.ps-add-note.html
-rw-r--r--      7980 2016-12-04 06:08 function.next.html
-rw-r--r--      7330 2016-12-04 06:07 book.ibase.html
-rw-r--r--      2057 2016-12-04 06:07 function.ocisavelob.html
-rw-r--r--      2565 2016-12-04 06:08 function.pdf-fill-imageblock.html
-rw-r--r--      2225 2016-12-04 06:08 function.pdf-scale.html
-rw-r--r--      8862 2016-12-04 06:07 mongodb-driver-writeresult.getupsertedcount.html
-rw-r--r--      3303 2016-12-04 06:07 gmagick.mapimage.html
-rw-r--r--      9933 2016-12-04 06:08 migration52.methods.html
-rw-r--r--      4622 2016-12-04 06:07 ziparchive.addemptydir.html
-rw-r--r--      3126 2016-12-04 06:07 function.ncurses-wmouse-trafo.html
-rw-r--r--      8272 2016-12-04 06:08 function.array-keys.html
-rw-r--r--      1372 2016-12-04 06:07 errorfunc.installation.html
-rw-r--r--      3546 2016-12-04 06:07 tokyotyrantiterator.current.html
-rw-r--r--      2963 2016-12-04 06:07 gmagick.setimageunits.html
-rw-r--r--     14155 2016-12-04 06:07 function.cubrid-execute.html
-rw-r--r--      2869 2016-12-04 06:08 function.svn-fs-dir-entries.html
-rw-r--r--      1710 2016-12-04 06:07 intro.oci8.html
-rw-r--r--      1549 2016-12-04 06:08 filter.filters.html
-rw-r--r--      3371 2016-12-04 06:08 eventbase.gotstop.html
-rw-r--r--      2294 2016-12-04 06:08 function.judy-version.html
-rw-r--r--      2620 2016-12-04 06:08 function.taint.html
-rw-r--r--      4794 2016-12-04 06:07 imagick.rollimage.html
-rw-r--r--      5077 2016-12-04 06:07 imagick.setimageproperty.html
-rw-r--r--      2871 2016-12-04 06:07 intltimezone.createtimezone.html
-rw-r--r--      4405 2016-12-04 06:07 function.odbc-gettypeinfo.html
-rw-r--r--      5648 2016-12-04 06:08 function.lcfirst.html
-rw-r--r--      2857 2016-12-04 06:08 spldoublylinkedlist.offsetexists.html
-rw-r--r--      2184 2016-12-04 06:08 function.pdf-get-majorversion.html
-rw-r--r--      3745 2016-12-04 06:08 harupage.arc.html
-rw-r--r--      2724 2016-12-04 06:07 gmagick.getimagerenderingintent.html
-rw-r--r--      2794 2016-12-04 06:08 function.fann-get-layer-array.html
-rw-r--r--     19328 2016-12-04 06:08 configure.about.html
-rw-r--r--      2292 2016-12-04 06:08 ui-controls-label.settext.html
-rw-r--r--      7846 2016-12-04 06:08 function.gupnp-context-timeout-add.html
-rw-r--r--      5959 2016-12-04 06:07 wincache.reroutes.html
-rw-r--r--      6672 2016-12-04 06:07 function.iconv-strpos.html
-rw-r--r--      2551 2016-12-04 06:08 function.eio-set-max-poll-reqs.html
-rw-r--r--     13601 2016-12-04 06:07 functions.variable-functions.html
-rw-r--r--      8346 2016-12-04 06:07 closure.bind.html
-rw-r--r--      2266 2016-12-04 06:08 function.pdf-pcos-get-number.html
-rw-r--r--      7243 2016-12-04 06:08 memcached.getserverbykey.html
-rw-r--r--     42621 2016-12-04 06:07 class.numberformatter.html
-rw-r--r--      5506 2016-12-04 06:08 simplexmliterator.haschildren.html
-rw-r--r--      1339 2016-12-04 06:08 expect.examples.html
-rw-r--r--      2189 2016-12-04 06:07 imagick.previousimage.html
-rw-r--r--      8907 2016-12-04 06:08 ds-sequence.reduce.html
-rw-r--r--      6054 2016-12-04 06:07 function.newt-form-add-component.html
-rw-r--r--      6040 2016-12-04 06:08 book.curl.html
-rw-r--r--     10558 2016-12-04 06:07 mongocommandcursor.createfromdocument.html
-rw-r--r--     11077 2016-12-04 06:07 mysqli.field-count.html
-rw-r--r--      2323 2016-12-04 06:08 event.delsignal.html
-rw-r--r--      8494 2016-12-04 06:08 function.strripos.html
-rw-r--r--      5230 2016-12-04 06:08 ds-set.intersect.html
-rw-r--r--      2399 2016-12-04 06:08 function.pdf-set-info.html
-rw-r--r--      5437 2016-12-04 06:08 yar-server.construct.html
-rw-r--r--      2792 2016-12-04 06:08 judy.offsetset.html
-rw-r--r--      3865 2016-12-04 06:07 mongodb.reseterror.html
-rw-r--r--      4342 2016-12-04 06:07 function.bcmod.html
-rw-r--r--      5806 2016-12-04 06:08 solrquery.addgroupquery.html
-rw-r--r--      4842 2016-12-04 06:08 domcharacterdata.deletedata.html
-rw-r--r--      4769 2016-12-04 06:08 splfileobject.setflags.html
-rw-r--r--      2952 2016-12-04 06:07 configuration.file.per-user.html
-rw-r--r--      1370 2016-12-04 06:08 stomp.resources.html
-rw-r--r--      5487 2016-12-04 06:08 function.ssh2-fingerprint.html
-rw-r--r--     13793 2016-12-04 06:08 function.filter-var.html
-rw-r--r--     12268 2016-12-04 06:07 function.cubrid-fetch-object.html
-rw-r--r--      2597 2016-12-04 06:07 function.m-transnew.html
-rw-r--r--      1559 2016-12-04 06:07 mysqlnd-mux.setup.html
-rw-r--r--      2535 2016-12-04 06:07 function.trader-ht-dcperiod.html
-rw-r--r--     17023 2016-12-04 06:07 mysqli-result.fetch-field.html
-rw-r--r--      2757 2016-12-04 06:08 ref.rrd.html
-rw-r--r--     15817 2016-12-04 06:08 yaf.appconfig.html
-rw-r--r--      4128 2016-12-04 06:08 function.rpm-close.html
-rw-r--r--      1973 2016-12-04 06:07 constants.newt.fd-flags.html
-rw-r--r--      4192 2016-12-04 06:07 function.fbsql-list-tables.html
-rw-r--r--      5278 2016-12-04 06:08 function.posix-geteuid.html
-rw-r--r--      3805 2016-12-04 06:07 mongo.setslaveokay.html
-rw-r--r--      8628 2016-12-04 06:08 gearmanworker.wait.html
-rw-r--r--     11487 2016-12-04 06:07 function.cubrid-put.html
-rw-r--r--      2891 2016-12-04 06:08 hwapi.hwstat.html
-rw-r--r--      4565 2016-12-04 06:08 yaf-application.getmodules.html
-rw-r--r--      2865 2016-12-04 06:07 mongocursor.current.html
-rw-r--r--      7888 2016-12-04 06:08 function.get-meta-tags.html
-rw-r--r--      3182 2016-12-04 06:07 function.sybase-free-result.html
-rw-r--r--      5655 2016-12-04 06:08 directoryiterator.iswritable.html
-rw-r--r--      2866 2016-12-04 06:07 function.ncurses-wmove.html
-rw-r--r--      8308 2016-12-04 06:07 function.maxdb-get-server-version.html
-rw-r--r--      4437 2016-12-04 06:08 sphinxclient.setgeoanchor.html
-rw-r--r--      4550 2016-12-04 06:07 function.ob-get-length.html
-rw-r--r--      3891 2016-12-04 06:08 function.fann-randomize-weights.html
-rw-r--r--      2684 2016-12-04 06:07 uconverter.getaliases.html
-rw-r--r--      2451 2016-12-04 06:08 svm.setoptions.html
-rw-r--r--      2395 2016-12-04 06:07 imagick.getimagesignature.html
-rw-r--r--      6082 2016-12-04 06:08 limititerator.getposition.html
-rw-r--r--      4492 2016-12-04 06:08 ui-controls-grid.append.html
-rw-r--r--      2657 2016-12-04 06:07 function.mysqli-get-metadata.html
-rw-r--r--      7213 2016-12-04 06:07 mongodb-driver-bulkwrite.count.html
-rw-r--r--      1621 2016-12-04 06:07 install.cloud.html
-rw-r--r--      9197 2016-12-04 06:08 function.time-nanosleep.html
-rw-r--r--     16025 2016-12-04 06:07 imagickkernel.addunitykernel.html
-rw-r--r--      3464 2016-12-04 06:08 function.gupnp-root-device-get-available.html
-rw-r--r--      5607 2016-12-04 06:07 imagick.compareimagelayers.html
-rw-r--r--      2818 2016-12-04 06:07 function.ncurses-slk-attroff.html
-rw-r--r--      5096 2016-12-04 06:07 datetimezone.getlocation.html
-rw-r--r--     12079 2016-12-04 06:07 runkit.sandbox-parent.html
-rw-r--r--      2883 2016-12-04 06:08 solrquery.gethighlightfragmenter.html
-rw-r--r--      5805 2016-12-04 06:07 weakref.construct.html
-rw-r--r--      1445 2016-12-04 06:08 curl.requirements.html
-rw-r--r--      2892 2016-12-04 06:07 function.mailparse-msg-create.html
-rw-r--r--     12772 2016-12-04 06:07 function.openssl-verify.html
-rw-r--r--      3464 2016-12-04 06:07 function.newt-vertical-scrollbar.html
-rw-r--r--      7040 2016-12-04 06:08 splobjectstorage.key.html
-rw-r--r--      2439 2016-12-04 06:07 gmagickdraw.getfontsize.html
-rw-r--r--      2891 2016-12-04 06:08 swfmovie.remove.html
-rw-r--r--      2603 2016-12-04 06:08 evembed.set.html
-rw-r--r--      3786 2016-12-04 06:08 samconnection.rollback.html
-rw-r--r--      6456 2016-12-04 06:08 yaf-application.getlasterrorno.html
-rw-r--r--      2682 2016-12-04 06:07 function.ncurses-panel-below.html
-rw-r--r--      1238 2016-12-04 06:07 sybase.constants.html
-rw-r--r--      3468 2016-12-04 06:07 function.ncurses-mvaddchnstr.html
-rw-r--r--      2801 2016-12-04 06:07 function.ob-get-level.html
-rw-r--r--      7330 2016-12-04 06:08 class.norewinditerator.html
-rw-r--r--      1642 2016-12-04 06:07 intl.requirements.html
-rw-r--r--      3579 2016-12-04 06:07 function.openal-context-process.html
-rw-r--r--      3986 2016-12-04 06:07 function.radius-config.html
-rw-r--r--      2055 2016-12-04 06:08 simplexmlelement.savexml.html
-rw-r--r--     13527 2016-12-04 06:08 class.evstat.html
-rw-r--r--      1349 2016-12-04 06:07 dbase.configuration.html
-rw-r--r--     17442 2016-12-04 06:08 swfbitmap.construct.html
-rw-r--r--      5909 2016-12-04 06:08 function.ftp-mkdir.html
-rw-r--r--      1356 2016-12-04 06:07 spplus.configuration.html
-rw-r--r--      9272 2016-12-04 06:07 imagickdraw.roundrectangle.html
-rw-r--r--     10612 2016-12-04 06:07 ref.paradox.html
-rw-r--r--     16914 2016-12-04 06:08 dom.constants.html
-rw-r--r--      2500 2016-12-04 06:07 function.ncurses-bottom-panel.html
-rw-r--r--      3723 2016-12-04 06:07 crack.examples.html
-rw-r--r--      6919 2016-12-04 06:07 ziparchive.addfile.html
-rw-r--r--      6222 2016-12-04 06:08 function.gupnp-device-action-callback-set.html
-rw-r--r--      1266 2016-12-04 06:08 fann.resources.html
-rw-r--r--      3118 2016-12-04 06:08 ds-priorityqueue.construct.html
-rw-r--r--      8575 2016-12-04 06:08 internals2.variables.arrays.html
-rw-r--r--      5410 2016-12-04 06:07 function.enchant-dict-describe.html
-rw-r--r--      8515 2016-12-04 06:08 function.classkit-method-add.html
-rw-r--r--      4579 2016-12-04 06:07 intlcalendar.getweekendtransition.html
-rw-r--r--      1489 2016-12-04 06:08 yaml.setup.html
-rw-r--r--      2753 2016-12-04 06:08 yaf-request-abstract.setrouted.html
-rw-r--r--      7306 2016-12-04 06:08 memcached.addserver.html
-rw-r--r--      1363 2016-12-04 06:08 gearman.configuration.html
-rw-r--r--     17943 2016-12-04 06:08 class.event.html
-rw-r--r--      8931 2016-12-04 06:07 intlcalendar.indaylighttime.html
-rw-r--r--      1377 2016-12-04 06:08 xmlwriter.configuration.html
-rw-r--r--      2528 2016-12-04 06:07 ref.uopz.html
-rw-r--r--      4485 2016-12-04 06:08 ref.xml.html
-rw-r--r--      3660 2016-12-04 06:08 harupage.curveto3.html
-rw-r--r--      8726 2016-12-04 06:08 swishsearch.setphrasedelimiter.html
-rw-r--r--      4235 2016-12-04 06:07 function.oci-new-collection.html
-rw-r--r--      6740 2016-12-04 06:08 function.geoip-db-get-all-info.html
-rw-r--r--      6298 2016-12-04 06:07 function.pg-copy-to.html
-rw-r--r--      2807 2016-12-04 06:07 function.newt-form-set-width.html
-rw-r--r--      3699 2016-12-04 06:07 mongogridfscursor.construct.html
-rw-r--r--      3083 2016-12-04 06:07 refs.remote.mail.html
-rw-r--r--      3006 2016-12-04 06:08 function.svn-fs-change-node-prop.html
-rw-r--r--      2941 2016-12-04 06:08 solrquery.settimeallowed.html
-rw-r--r--      4868 2016-12-04 06:08 function.stream-get-wrappers.html
-rw-r--r--      9056 2016-12-04 06:07 function.mysqlnd-qc-set-cache-condition.html
-rw-r--r--      8589 2016-12-04 06:08 soapvar.soapvar.html
-rw-r--r--      7122 2016-12-04 06:07 function.apcu-store.html
-rw-r--r--      2443 2016-12-04 06:07 function.ncurses-slk-noutrefresh.html
-rw-r--r--      6843 2016-12-04 06:08 function.soundex.html
-rw-r--r--     13551 2016-12-04 06:08 class.reflectionparameter.html
-rw-r--r--     12876 2016-12-04 06:07 function.maxdb-real-escape-string.html
-rw-r--r--      1476 2016-12-04 06:08 xmldiff.requirements.html
-rw-r--r--      4290 2016-12-04 06:07 ref.enchant.html
-rw-r--r--      2846 2016-12-04 06:08 function.fann-shuffle-train-data.html
-rw-r--r--      2899 2016-12-04 06:08 function.hwapi-content-new.html
-rw-r--r--      6613 2016-12-04 06:07 pdo.errorinfo.html
-rw-r--r--      3279 2016-12-04 06:07 function.trader-cdlinvertedhammer.html
-rw-r--r--      2701 2016-12-04 06:07 function.openssl-free-key.html
-rw-r--r--      7037 2016-12-04 06:08 tidynode.isjste.html
-rw-r--r--      3409 2016-12-04 06:08 eventbuffer.addbuffer.html
-rw-r--r--     10785 2016-12-04 06:08 function.curl-multi-exec.html
-rw-r--r--     10258 2016-12-04 06:07 function.imap-mail-compose.html
-rw-r--r--      4224 2016-12-04 06:07 function.gzclose.html
-rw-r--r--      1930 2016-12-04 06:08 snmp.requirements.html
-rw-r--r--      4491 2016-12-04 06:08 splfileinfo.gettype.html
-rw-r--r--      3658 2016-12-04 06:08 ev.suspend.html
-rw-r--r--      4566 2016-12-04 06:07 function.cairo-pattern-set-extend.html
-rw-r--r--      2996 2016-12-04 06:07 function.fbsql-field-len.html
-rw-r--r--     10017 2016-12-04 06:08 class.threaded.html
-rw-r--r--      1853 2016-12-04 06:08 internals2.opcodes.zend-jmp-set.html
-rw-r--r--      2164 2016-12-04 06:08 hwapi.reason-description.html
-rw-r--r--      2918 2016-12-04 06:08 varnishadmin.setparam.html
-rw-r--r--      2540 2016-12-04 06:08 solrquery.gettermsprefix.html
-rw-r--r--      4622 2016-12-04 06:07 function.cal-days-in-month.html
-rw-r--r--     10518 2016-12-04 06:07 phardata.converttoexecutable.html
-rw-r--r--      5777 2016-12-04 06:08 refs.ui.html
-rw-r--r--     19961 2016-12-04 06:07 class.tokyotyranttable.html
-rw-r--r--      2729 2016-12-04 06:08 migration55.html
-rw-r--r--      2266 2016-12-04 06:07 phar.fileformat.flags.html
-rw-r--r--     15700 2016-12-04 06:08 function.unserialize.html
-rw-r--r--      2868 2016-12-04 06:08 swfsprite.remove.html
-rw-r--r--      9402 2016-12-04 06:08 function.msg-receive.html
-rw-r--r--      4420 2016-12-04 06:07 function.cairo-surface-copy-page.html
-rw-r--r--      6771 2016-12-04 06:08 function.ps-begin-page.html
-rw-r--r--      2918 2016-12-04 06:08 harupage.getflatness.html
-rw-r--r--      5569 2016-12-04 06:08 function.strcmp.html
-rw-r--r--      2994 2016-12-04 06:08 reflectionfunctionabstract.getclosurethis.html
-rw-r--r--      3322 2016-12-04 06:08 gearmantask.sendworkload.html
-rw-r--r--      3059 2016-12-04 06:07 gmagickdraw.annotate.html
-rw-r--r--     11677 2016-12-04 06:07 phardata.buildfromiterator.html
-rw-r--r--      4923 2016-12-04 06:08 evloop.run.html
-rw-r--r--      3553 2016-12-04 06:08 function.fam-next-event.html
-rw-r--r--      2553 2016-12-04 06:07 imagick.deconstructimages.html
-rw-r--r--      3676 2016-12-04 06:08 book.pcre.html
-rw-r--r--      3381 2016-12-04 06:08 yaf-router.getroute.html
-rw-r--r--      1377 2016-12-04 06:08 libxml.requirements.html
-rw-r--r--      4153 2016-12-04 06:08 solrclient.deletebyid.html
-rw-r--r--      3063 2016-12-04 06:07 gmagick.writeimage.html
-rw-r--r--     10109 2016-12-04 06:07 function.maxdb-warning-count.html
-rw-r--r--      3593 2016-12-04 06:08 function.libxml-disable-entity-loader.html
-rw-r--r--      2477 2016-12-04 06:08 fannconnection.getfromneuron.html
-rw-r--r--      5151 2016-12-04 06:07 cairocontext.rotate.html
-rw-r--r--      2692 2016-12-04 06:07 function.ncurses-panel-above.html
-rw-r--r--      7430 2016-12-04 06:07 function.ingres-fetch-proc-return.html
-rw-r--r--      6463 2016-12-04 06:08 threaded.synchronized.html
-rw-r--r--      3531 2016-12-04 06:08 yaf-request-http.getpost.html
-rw-r--r--      6890 2016-12-04 06:07 function.imap-setflag-full.html
-rw-r--r--      8853 2016-12-04 06:07 phar.startbuffering.html
-rw-r--r--      2423 2016-12-04 06:08 yaf-loader.wakeup.html
-rw-r--r--      2828 2016-12-04 06:08 emptyiterator.current.html
-rw-r--r--      2361 2016-12-04 06:08 function.is-tainted.html
-rw-r--r--      7661 2016-12-04 06:08 tidy.root.html
-rw-r--r--      3644 2016-12-04 06:07 function.dngettext.html
-rw-r--r--     16024 2016-12-04 06:07 rarentry.getattr.html
-rw-r--r--      5752 2016-12-04 06:07 phar.loadphar.html
-rw-r--r--      2476 2016-12-04 06:08 internals2.pdo.building.html
-rw-r--r--      7897 2016-12-04 06:07 book.pdo.html
-rw-r--r--     11297 2016-12-04 06:07 ref.stats.html
-rw-r--r--      3389 2016-12-04 06:08 reflectionparameter.getdeclaringfunction.html
-rw-r--r--      3730 2016-12-04 06:08 reflectionfunctionabstract.getnumberofparameters.html
-rw-r--r--     20856 2016-12-04 06:08 swfdisplayitem.rotateto.html
-rw-r--r--      4917 2016-12-04 06:08 class.xmldiff-file.html
-rw-r--r--      6061 2016-12-04 06:08 domdocument.createentityreference.html
-rw-r--r--     10895 2016-12-04 06:07 pharfileinfo.iscompressedgz.html
-rw-r--r--      5409 2016-12-04 06:08 domdocument.createcomment.html
-rw-r--r--     13258 2016-12-04 06:07 function.file-put-contents.html
-rw-r--r--      3130 2016-12-04 06:08 harupage.setflatness.html
-rw-r--r--      2875 2016-12-04 06:08 book.url.html
-rw-r--r--      1609 2016-12-04 06:07 mysqlinfo.concepts.html
-rw-r--r--      9291 2016-12-04 06:07 imagickdraw.setclipunits.html
-rw-r--r--      2786 2016-12-04 06:07 imagick.morphimages.html
-rw-r--r--      4166 2016-12-04 06:08 function.ps-stringwidth.html
-rw-r--r--     17610 2016-12-04 06:07 function.maxdb-fetch-array.html
-rw-r--r--      4386 2016-12-04 06:08 function.ps-set-border-style.html
-rw-r--r--      2317 2016-12-04 06:07 ref.bc.html
-rw-r--r--      2527 2016-12-04 06:08 ui-controls-tab.hasmargin.html
-rw-r--r--      4464 2016-12-04 06:07 function.cairo-scaled-font-get-type.html
-rw-r--r--      2366 2016-12-04 06:07 imagickdraw.pathfinish.html
-rw-r--r--      4149 2016-12-04 06:07 function.odbc-fetch-object.html
-rw-r--r--      4967 2016-12-04 06:08 ref.ftp.html
-rw-r--r--      8971 2016-12-04 06:07 intlcalendar.geterrorcode.html
-rw-r--r--      2766 2016-12-04 06:08 solrquery.getgroupcachepercent.html
-rw-r--r--      5712 2016-12-04 06:07 intlcalendar.gettype.html
-rw-r--r--      2020 2016-12-04 06:07 ktaglib.installation.html
-rw-r--r--      2687 2016-12-04 06:07 dir.constants.html
-rw-r--r--      3023 2016-12-04 06:08 yaf-route-interface.assemble.html
-rw-r--r--      9851 2016-12-04 06:07 mongo.constants.html
-rw-r--r--      5666 2016-12-04 06:08 regex.examples.html
-rw-r--r--      2644 2016-12-04 06:07 function.ncurses-wcolor-set.html
-rw-r--r--      7052 2016-12-04 06:07 book.sqlite.html
-rw-r--r--     10218 2016-12-04 06:08 function.ldap-get-option.html
-rw-r--r--     13497 2016-12-04 06:08 class.eventbase.html
-rw-r--r--      2409 2016-12-04 06:08 ui-draw-stroke.getcap.html
-rw-r--r--      3028 2016-12-04 06:07 function.bcompiler-write-included-filename.html
-rw-r--r--      2571 2016-12-04 06:07 gmagick.getimagescene.html
-rw-r--r--      4464 2016-12-04 06:08 memcache.flush.html
-rw-r--r--      4752 2016-12-04 06:08 function.yp-match.html
-rw-r--r--      5812 2016-12-04 06:08 function.gupnp-root-device-new.html
-rw-r--r--      2642 2016-12-04 06:07 function.ncurses-wattroff.html
-rw-r--r--      5307 2016-12-04 06:07 function.fbsql-close.html
-rw-r--r--      4837 2016-12-04 06:07 class.mongoresultexception.html
-rw-r--r--      3010 2016-12-04 06:08 internals2.opcodes.sub.html
-rw-r--r--      4454 2016-12-04 06:07 function.cairo-font-options-status.html
-rw-r--r--      4941 2016-12-04 06:08 ds-queue.allocate.html
-rw-r--r--      3793 2016-12-04 06:08 function.posix-isatty.html
-rw-r--r--     13379 2016-12-04 06:07 function.max.html
-rw-r--r--      8073 2016-12-04 06:07 mysqli.quickstart.transactions.html
-rw-r--r--      3084 2016-12-04 06:08 function.fam-pending.html
-rw-r--r--      3044 2016-12-04 06:07 imagick.setimagechanneldepth.html
-rw-r--r--      3922 2016-12-04 06:07 mongodb-bson-minkey.construct.html
-rw-r--r--      7751 2016-12-04 06:07 mysqlnduhconnection.gethostinformation.html
-rw-r--r--      2955 2016-12-04 06:07 gmagick.setsamplingfactors.html
-rw-r--r--      1336 2016-12-04 06:07 filesystem.requirements.html
-rw-r--r--      2500 2016-12-04 06:08 function.yp-errno.html
-rw-r--r--      5339 2016-12-04 06:08 yaf-view-simple.clear.html
-rw-r--r--     19183 2016-12-04 06:08 migration51.references.html
-rw-r--r--      1284 2016-12-04 06:08 lua.resources.html
-rw-r--r--      4213 2016-12-04 06:07 function.ingres-commit.html
-rw-r--r--      5148 2016-12-04 06:08 function.array-sum.html
-rw-r--r--      7016 2016-12-04 06:08 swfshape.construct.html
-rw-r--r--      6849 2016-12-04 06:08 reflectionclass.getname.html
-rw-r--r--     20834 2016-12-04 06:07 zip.constants.html
-rw-r--r--     19997 2016-12-04 06:08 eventhttp.construct.html
-rw-r--r--      5262 2016-12-04 06:07 cairocontext.settolerance.html
-rw-r--r--      2532 2016-12-04 06:08 function.eio-nready.html
-rw-r--r--      5529 2016-12-04 06:08 splobjectstorage.count.html
-rw-r--r--      4848 2016-12-04 06:07 cairoscaledfont.construct.html
-rw-r--r--      2681 2016-12-04 06:07 oggvorbis.constants.html
-rw-r--r--      3432 2016-12-04 06:08 function.yaz-addinfo.html
-rw-r--r--      5621 2016-12-04 06:08 solrquery.setgroupoffset.html
-rw-r--r--      3943 2016-12-04 06:07 mongo.tutorial.indexes.html
-rw-r--r--     12610 2016-12-04 06:07 function.imagedashedline.html
-rw-r--r--      2920 2016-12-04 06:08 posix.constants.access.html
-rw-r--r--      5234 2016-12-04 06:07 cairopattern.setmatrix.html
-rw-r--r--     23144 2016-12-04 06:07 phar.using.intro.html
-rw-r--r--      3033 2016-12-04 06:07 function.stats-rand-gen-iuniform.html
-rw-r--r--      9697 2016-12-04 06:07 tokyotyrantquery.count.html
-rw-r--r--      3316 2016-12-04 06:07 oci-lob.export.html
-rw-r--r--     81966 2016-12-04 06:07 language.types.string.html
-rw-r--r--      4800 2016-12-04 06:07 ziparchive.renameindex.html
-rw-r--r--      1315 2016-12-04 06:08 strings.requirements.html
-rw-r--r--      2964 2016-12-04 06:07 imagick.readimagefile.html
-rw-r--r--      6539 2016-12-04 06:07 function.uopz-compose.html
-rw-r--r--      3631 2016-12-04 06:08 function.fann-set-sarprop-step-error-shift.html
-rw-r--r--      3110 2016-12-04 06:08 internals2.opcodes.div.html
-rw-r--r--      3017 2016-12-04 06:07 function.hypot.html
-rw-r--r--      5102 2016-12-04 06:07 mongo.pooldebug.html
-rw-r--r--      6490 2016-12-04 06:07 pdo.pgsqllobunlink.html
-rw-r--r--      6678 2016-12-04 06:07 function.fbsql-database-password.html
-rw-r--r--      8231 2016-12-04 06:07 function.runkit-method-add.html
-rw-r--r--     17294 2016-12-04 06:08 class.ds-sequence.html
-rw-r--r--      3255 2016-12-04 06:08 function.ps-end-page.html
-rw-r--r--      2543 2016-12-04 06:07 function.mysqli-fetch.html
-rw-r--r--      3315 2016-12-04 06:07 function.stats-cdf-f.html
-rw-r--r--      3850 2016-12-04 06:07 cairofontoptions.merge.html
-rw-r--r--      2089 2016-12-04 06:07 book.fribidi.html
-rw-r--r--      4654 2016-12-04 06:08 function.event-buffer-set-callback.html
-rw-r--r--     21389 2016-12-04 06:07 pdostatement.fetchall.html
-rw-r--r--      3353 2016-12-04 06:07 function.readline-info.html
-rw-r--r--      2998 2016-12-04 06:07 intltimezone.geterrorcode.html
-rw-r--r--      5970 2016-12-04 06:07 ziparchive.statname.html
-rw-r--r--      2780 2016-12-04 06:08 function.svn-fs-apply-text.html
-rw-r--r--      3155 2016-12-04 06:07 gmagick.cropthumbnailimage.html
-rw-r--r--      9869 2016-12-04 06:07 install.macosx.bundled.html
-rw-r--r--      8250 2016-12-04 06:07 function.imap-rfc822-parse-adrlist.html
-rw-r--r--      6062 2016-12-04 06:08 migration51.databases.html
-rw-r--r--      7185 2016-12-04 06:07 function.tempnam.html
-rw-r--r--      7045 2016-12-04 06:08 function.ctype-graph.html
-rw-r--r--      3167 2016-12-04 06:07 function.newt-listbox-append-entry.html
-rw-r--r--      3490 2016-12-04 06:07 function.msql-num-fields.html
-rw-r--r--      4324 2016-12-04 06:08 recursivecallbackfilteriterator.getchildren.html
-rw-r--r--      4979 2016-12-04 06:07 class.divisionbyzeroerror.html
-rw-r--r--      3388 2016-12-04 06:08 hwapi.content.html
-rw-r--r--      1905 2016-12-04 06:08 internals2.opcodes.declare-inherited-class-delayed.html
-rw-r--r--      7825 2016-12-04 06:08 function.is-a.html
-rw-r--r--      1821 2016-12-04 06:07 function.imap-fetchtext.html
-rw-r--r--      3528 2016-12-04 06:08 function.shm-has-var.html
-rw-r--r--      4624 2016-12-04 06:08 splfileobject.fgetc.html
-rw-r--r--     62811 2016-12-04 06:07 book.imagick.html
-rw-r--r--      2981 2016-12-04 06:07 mongocursorinterface.dead.html
-rw-r--r--      4622 2016-12-04 06:07 cairosolidpattern.construct.html
-rw-r--r--      3287 2016-12-04 06:07 function.trader-cdlinneck.html
-rw-r--r--      3270 2016-12-04 06:08 intro.ming.html
-rw-r--r--      2425 2016-12-04 06:08 solrquery.getfacetqueries.html
-rw-r--r--      1315 2016-12-04 06:08 session-pgsql.constants.html
-rw-r--r--      4459 2016-12-04 06:07 mongo.getslave.html
-rw-r--r--      7009 2016-12-04 06:08 reflectiongenerator.gettrace.html
-rw-r--r--      1376 2016-12-04 06:08 ref.tcpwrap.html
-rw-r--r--      2038 2016-12-04 06:08 function.pdf-end-template.html
-rw-r--r--     12807 2016-12-04 06:07 intlcalendar.getskippedwalltimeoption.html
-rw-r--r--      6627 2016-12-04 06:07 phar.unlinkarchive.html
-rw-r--r--      1342 2016-12-04 06:08 sync.configuration.html
-rw-r--r--      5200 2016-12-04 06:08 norewinditerator.rewind.html
-rw-r--r--      3374 2016-12-04 06:07 function.odbc-longreadlen.html
-rw-r--r--      7806 2016-12-04 06:08 migration53.new-features.html
-rw-r--r--      3920 2016-12-04 06:07 function.openssl-x509-export-to-file.html
-rw-r--r--     11697 2016-12-04 06:08 book.stream.html
-rw-r--r--      2054 2016-12-04 06:07 sybase.installation.html
-rw-r--r--      4831 2016-12-04 06:07 dateperiod.getdateinterval.html
-rw-r--r--      8004 2016-12-04 06:07 function.mysql-free-result.html
-rw-r--r--      2576 2016-12-04 06:08 solrquery.gethighlight.html
-rw-r--r--      3248 2016-12-04 06:08 function.ps-setgray.html
-rw-r--r--      2443 2016-12-04 06:08 ui-control.setparent.html
-rw-r--r--      6339 2016-12-04 06:07 intlchar.charmirror.html
-rw-r--r--      2406 2016-12-04 06:07 imagick.getimagetickspersecond.html
-rw-r--r--      2969 2016-12-04 06:07 readline.configuration.html
-rw-r--r--      6295 2016-12-04 06:08 solrclient.request.html
-rw-r--r--      2229 2016-12-04 06:08 swfsprite.construct.html
-rw-r--r--      4635 2016-12-04 06:07 function.cairo-format-stride-for-width.html
-rw-r--r--      7450 2016-12-04 06:07 tokyotyranttable.putcat.html
-rw-r--r--      5203 2016-12-04 06:07 function.xattr-supported.html
-rw-r--r--      3502 2016-12-04 06:07