"Fossies" - the Fresh Open Source Software Archive

Contents of php_manual_en.tar.gz (28 Mar 06:07, 11718245 Bytes)

About: PHP is a server-side html-embedded scripting language. Documentation (multiple HTML-files; English language).



Fossies path:  /linux/www/php_manual_en.tar.gz   [Download | CLOC analysis]
VirusTotal check: Ok
Alternative downloads:  tar.bz2 | tar.xz | zip
Member paths+URLs:  Shortened | full
Member sort order:  docs related | original | size (top100) | date | path | name | ext | top-path files

drwxr-xr-x         0 2017-03-28 06:07 
-rw-r--r--      2741 2017-03-28 06:05 function.ncurses-halfdelay.html
-rw-r--r--      7336 2017-03-28 06:06 function.mb-convert-encoding.html
-rw-r--r--      4900 2017-03-28 06:06 maxdb.constants.html
-rw-r--r--      4400 2017-03-28 06:06 function.ps-set-border-dash.html
-rw-r--r--      2540 2017-03-28 06:05 constants.newt.reasons.html
-rw-r--r--      1342 2017-03-28 06:05 hash.configuration.html
-rw-r--r--      2270 2017-03-28 06:06 function.pdf-stringwidth.html
-rw-r--r--      4169 2017-03-28 06:06 gmagick.frameimage.html
-rw-r--r--      3119 2017-03-28 06:07 internals2.opcodes.assign-ref.html
-rw-r--r--      4961 2017-03-28 06:06 book.enchant.html
-rw-r--r--      8120 2017-03-28 06:06 function.grapheme-stripos.html
-rw-r--r--      3016 2017-03-28 06:06 imagickdraw.pathlinetohorizontalabsolute.html
-rw-r--r--      3220 2017-03-28 06:07 internals2.counter.counter-class.bumpvalue.html
-rw-r--r--      3805 2017-03-28 06:06 function.dcngettext.html
-rw-r--r--      3209 2017-03-28 06:06 function.imap-num-recent.html
-rw-r--r--      3406 2017-03-28 06:07 function.svn-client-version.html
-rw-r--r--      2398 2017-03-28 06:06 book.password.html
-rw-r--r--      3946 2017-03-28 06:07 internals2.opcodes.declare-class.html
-rw-r--r--      4297 2017-03-28 06:05 refs.compression.html
-rw-r--r--      6699 2017-03-28 06:06 function.ibase-fetch-object.html
-rw-r--r--      8737 2017-03-28 06:07 ds-map.get.html
-rw-r--r--      5330 2017-03-28 06:07 memcached.replacebykey.html
-rw-r--r--     13004 2017-03-28 06:06 mysqli-stmt.error.html
-rw-r--r--      4683 2017-03-28 06:05 function.error-get-last.html
-rw-r--r--     22019 2017-03-28 06:06 imap.constants.html
-rw-r--r--      3768 2017-03-28 06:07 sdo-das-xml.loadstring.html
-rw-r--r--      5254 2017-03-28 06:07 ds-deque.rotate.html
-rw-r--r--      9855 2017-03-28 06:06 tokyotyrantquery.next.html
-rw-r--r--     10060 2017-03-28 06:06 function.mt-rand.html
-rw-r--r--      2695 2017-03-28 06:06 function.trader-rocr.html
-rw-r--r--      5606 2017-03-28 06:07 function.md5-file.html
-rw-r--r--      6288 2017-03-28 06:06 function.rewind.html
-rw-r--r--      1342 2017-03-28 06:07 intro.yar.html
-rw-r--r--      2621 2017-03-28 06:06 function.mysqli-bind-result.html
-rw-r--r--      9222 2017-03-28 06:06 function.imageellipse.html
-rw-r--r--      2430 2017-03-28 06:06 yaf-config-simple.toarray.html
-rw-r--r--      7606 2017-03-28 06:06 splobjectstorage.setinfo.html
-rw-r--r--      2237 2017-03-28 06:06 imagick.installation.html
-rw-r--r--      2668 2017-03-28 06:07 internals2.counter.html
-rw-r--r--     11901 2017-03-28 06:07 function.array-replace-recursive.html
-rw-r--r--      7812 2017-03-28 06:06 function.pg-escape-literal.html
-rw-r--r--      3135 2017-03-28 06:07 xsl.examples-collection.html
-rw-r--r--      2614 2017-03-28 06:06 stream.contexts.html
-rw-r--r--      2922 2017-03-28 06:06 class.yaf-exception-routerfailed.html
-rw-r--r--      4243 2017-03-28 06:06 function.sqlite-next.html
-rw-r--r--      5270 2017-03-28 06:05 class.typeerror.html
-rw-r--r--      3159 2017-03-28 06:06 book.exec.html
-rw-r--r--      2548 2017-03-28 06:05 function.newt-entry-get-value.html
-rw-r--r--      2660 2017-03-28 06:07 intro.session-pgsql.html
-rw-r--r--      1238 2017-03-28 06:07 ssdeep.constants.html
-rw-r--r--      3207 2017-03-28 06:05 function.gzrewind.html
-rw-r--r--      4209 2017-03-28 06:07 ds-set.toarray.html
-rw-r--r--      3484 2017-03-28 06:06 function.dio-read.html
-rw-r--r--      3380 2017-03-28 06:05 function.apd-dump-regular-resources.html
-rw-r--r--      6974 2017-03-28 06:06 appenditerator.getinneriterator.html
-rw-r--r--      2851 2017-03-28 06:07 reflectionclass.gettraitaliases.html
-rw-r--r--      6218 2017-03-28 06:06 function.imagebmp.html
-rw-r--r--      3262 2017-03-28 06:06 function.trader-cdltristar.html
-rw-r--r--      3190 2017-03-28 06:06 streamwrapper.stream-close.html
-rw-r--r--      6264 2017-03-28 06:06 function.mysql-info.html
-rw-r--r--      6222 2017-03-28 06:06 mongocursor.doquery.html
-rw-r--r--      3357 2017-03-28 06:07 function.session-abort.html
-rw-r--r--      9274 2017-03-28 06:06 function.pg-send-query.html
-rw-r--r--      3352 2017-03-28 06:07 refs.basic.text.html
-rw-r--r--     13520 2017-03-28 06:07 index.html
-rw-r--r--      1745 2017-03-28 06:07 function.strchr.html
-rw-r--r--      3799 2017-03-28 06:07 sphinxclient.addquery.html
-rw-r--r--      6233 2017-03-28 06:05 function.wincache-ucache-exists.html
-rw-r--r--      5446 2017-03-28 06:07 memcached.incrementbykey.html
-rw-r--r--      1616 2017-03-28 06:06 dbx.resources.html
-rw-r--r--      2166 2017-03-28 06:07 ui-point.gety.html
-rw-r--r--      5743 2017-03-28 06:06 function.sqlsrv-close.html
-rw-r--r--      2255 2017-03-28 06:06 mysqlnd-memcache.installation.html
-rw-r--r--      6399 2017-03-28 06:06 imagick.unsharpmaskimage.html
-rw-r--r--      1554 2017-03-28 06:06 libevent.setup.html
-rw-r--r--      1575 2017-03-28 06:06 event.requirements.html
-rw-r--r--      2772 2017-03-28 06:05 function.ncurses-insstr.html
-rw-r--r--      3494 2017-03-28 06:07 internals2.opcodes.add-var.html
-rw-r--r--      8925 2017-03-28 06:05 language.namespaces.dynamic.html
-rw-r--r--      1505 2017-03-28 06:06 ifx.setup.html
-rw-r--r--      3076 2017-03-28 06:06 harupage.setwidth.html
-rw-r--r--      1988 2017-03-28 06:07 solrquery.getexpandsortfields.html
-rw-r--r--      1942 2017-03-28 06:06 function.pdf-set-text-rendering.html
-rw-r--r--      2364 2017-03-28 06:06 imagickdraw.getclipunits.html
-rw-r--r--      3451 2017-03-28 06:07 function.hebrevc.html
-rw-r--r--      2138 2017-03-28 06:06 function.pdf-setlinewidth.html
-rw-r--r--      5310 2017-03-28 06:07 function.strpbrk.html
-rw-r--r--      3430 2017-03-28 06:07 ui-draw-pen.fill.html
-rw-r--r--      5186 2017-03-28 06:06 function.ps-setcolor.html
-rw-r--r--      9922 2017-03-28 06:05 language.namespaces.nsconstants.html
-rw-r--r--      1287 2017-03-28 06:06 dir.requirements.html
-rw-r--r--      3360 2017-03-28 06:07 ds-map.capacity.html
-rw-r--r--      6110 2017-03-28 06:07 function.chr.html
-rw-r--r--      3074 2017-03-28 06:06 class.mongodb-driver-cursorid.html
-rw-r--r--     21890 2017-03-28 06:07 class.domelement.html
-rw-r--r--      2752 2017-03-28 06:06 v8js.getpendingexception.html
-rw-r--r--      2938 2017-03-28 06:06 eventbufferevent.sslgetcipherversion.html
-rw-r--r--      6349 2017-03-28 06:06 intlchar.isjavaidstart.html
-rw-r--r--     11968 2017-03-28 06:06 function.fgetcsv.html
-rw-r--r--     17590 2017-03-28 06:07 function.extract.html
-rw-r--r--      5722 2017-03-28 06:06 mongocollection.setwriteconcern.html
-rw-r--r--      4427 2017-03-28 06:06 mongodb-bson-regex.unserialize.html
-rw-r--r--     26939 2017-03-28 06:05 language.oop5.overloading.html
-rw-r--r--     10834 2017-03-28 06:06 mysqli.poll.html
-rw-r--r--      3353 2017-03-28 06:06 class.yaf-route-interface.html
-rw-r--r--      2049 2017-03-28 06:06 function.pdf-stroke.html
-rw-r--r--      2536 2017-03-28 06:06 yaf-session.isset.html
-rw-r--r--     11533 2017-03-28 06:07 stomp.examples.html
-rw-r--r--      2717 2017-03-28 06:06 gmagick.getimageprofile.html
-rw-r--r--      9051 2017-03-28 06:05 pharfileinfo.iscompressed.html
-rw-r--r--      3054 2017-03-28 06:06 function.event-base-loop.html
-rw-r--r--      3060 2017-03-28 06:07 reflectionparameter.isarray.html
-rw-r--r--      2558 2017-03-28 06:06 curl.configuration.html
-rw-r--r--     12008 2017-03-28 06:06 class.splstack.html
-rw-r--r--      6823 2017-03-28 06:06 filesystemiterator.setflags.html
-rw-r--r--     12832 2017-03-28 06:06 imagick.setprogressmonitor.html
-rw-r--r--      1657 2017-03-28 06:06 mongo.setup.html
-rw-r--r--      4855 2017-03-28 06:07 internals2.opcodes.init-static-method-call.html
-rw-r--r--      3740 2017-03-28 06:06 limititerator.current.html
-rw-r--r--      3102 2017-03-28 06:06 function.fdf-close.html
-rw-r--r--      2726 2017-03-28 06:06 recursivetreeiterator.endchildren.html
-rw-r--r--      7459 2017-03-28 06:06 yaf.tutorials.html
-rw-r--r--      5959 2017-03-28 06:06 swftext.construct.html
-rw-r--r--      2813 2017-03-28 06:07 sdo-dataobject.clear.html
-rw-r--r--      8312 2017-03-28 06:06 mysqlnd.plugin.api.html
-rw-r--r--      3096 2017-03-28 06:06 function.event-buffer-base-set.html
-rw-r--r--     22282 2017-03-28 06:07 function.preg-replace.html
-rw-r--r--      5261 2017-03-28 06:06 intlchar.isisocontrol.html
-rw-r--r--     16439 2017-03-28 06:07 regexp.reference.escape.html
-rw-r--r--      3496 2017-03-28 06:07 about.phpversions.html
-rw-r--r--      4633 2017-03-28 06:06 function.stream-get-line.html
-rw-r--r--      2862 2017-03-28 06:07 function.rrd-tune.html
-rw-r--r--      3054 2017-03-28 06:06 function.event-buffer-enable.html
-rw-r--r--      7536 2017-03-28 06:06 class.mongodb-driver-exception-bulkwriteexception.html
-rw-r--r--      7104 2017-03-28 06:05 ziparchive.setexternalattributesname.html
-rw-r--r--      1301 2017-03-28 06:07 svm.resources.html
-rw-r--r--      3627 2017-03-28 06:06 splpriorityqueue.setextractflags.html
-rw-r--r--      1637 2017-03-28 06:07 classkit.installation.html
-rw-r--r--      5616 2017-03-28 06:06 appenditerator.append.html
-rw-r--r--      7649 2017-03-28 06:07 migration51.oop.html
-rw-r--r--      4113 2017-03-28 06:07 function.xmlwriter-flush.html
-rw-r--r--      3592 2017-03-28 06:06 arrayiterator.append.html
-rw-r--r--      4755 2017-03-28 06:07 rrdupdater.update.html
-rw-r--r--      6537 2017-03-28 06:07 book.xmlwriter.html
-rw-r--r--      3186 2017-03-28 06:06 function.trader-atr.html
-rw-r--r--      2836 2017-03-28 06:06 gmagickdraw.settextdecoration.html
-rw-r--r--      3749 2017-03-28 06:06 gmagick.cropimage.html
-rw-r--r--     12401 2017-03-28 06:06 function.sqlite-create-function.html
-rw-r--r--      3183 2017-03-28 06:07 solrquery.setfacetmissing.html
-rw-r--r--      4250 2017-03-28 06:05 function.get-cfg-var.html
-rw-r--r--      3396 2017-03-28 06:06 ref.pdo-ibm.html
-rw-r--r--      3309 2017-03-28 06:06 filesystemiterator.getflags.html
-rw-r--r--      5743 2017-03-28 06:06 imagick.rotateimage.html
-rw-r--r--      2598 2017-03-28 06:06 v8jsexception.getjssourceline.html
-rw-r--r--      5311 2017-03-28 06:07 internals2.memory.persistence.html
-rw-r--r--      5857 2017-03-28 06:05 context.mongodb.html
-rw-r--r--      3027 2017-03-28 06:07 reflectionparameter.tostring.html
-rw-r--r--      4080 2017-03-28 06:06 mongocollection.setslaveokay.html
-rw-r--r--      4611 2017-03-28 06:06 function.ps-set-border-color.html
-rw-r--r--     20034 2017-03-28 06:05 rar.examples.html
-rw-r--r--      9445 2017-03-28 06:06 datetime.settimestamp.html
-rw-r--r--      2108 2017-03-28 06:06 intro.judy.html
-rw-r--r--      5075 2017-03-28 06:07 oauth.setrsacertificate.html
-rw-r--r--      7154 2017-03-28 06:07 book.oauth.html
-rw-r--r--      5717 2017-03-28 06:07 ds-sequence.find.html
-rw-r--r--      3344 2017-03-28 06:07 function.hebrev.html
-rw-r--r--      3017 2017-03-28 06:06 harupage.moveto.html
-rw-r--r--      2498 2017-03-28 06:07 solrquery.getfacetdatefields.html
-rw-r--r--      2790 2017-03-28 06:06 recursiveiteratoriterator.getdepth.html
-rw-r--r--      9285 2017-03-28 06:06 cairocontext.setfontface.html
-rw-r--r--      1530 2017-03-28 06:05 opcache.setup.html
-rw-r--r--      2452 2017-03-28 06:07 varnishadmin.connect.html
-rw-r--r--      3932 2017-03-28 06:07 domdocument.relaxngvalidatesource.html
-rw-r--r--     12846 2017-03-28 06:07 function.get-html-translation-table.html
-rw-r--r--      6833 2017-03-28 06:07 internals2.pdo.pdo-stmt-t.html
-rw-r--r--    133093 2017-03-28 06:06 imagick.constants.html
-rw-r--r--      2896 2017-03-28 06:06 class.yaf-exception-loadfailed-view.html
-rw-r--r--      9372 2017-03-28 06:05 arrayaccess.offsetexists.html
-rw-r--r--      7946 2017-03-28 06:07 function.xml-set-element-handler.html
-rw-r--r--      8497 2017-03-28 06:06 function.imagechar.html
-rw-r--r--      1294 2017-03-28 06:07 pcre.requirements.html
-rw-r--r--      4308 2017-03-28 06:06 thread.getcreatorid.html
-rw-r--r--      3489 2017-03-28 06:06 function.enchant-dict-is-in-session.html
-rw-r--r--      2724 2017-03-28 06:06 openssl.key-types.html
-rw-r--r--      1524 2017-03-28 06:06 dbplus.setup.html
-rw-r--r--      7354 2017-03-28 06:06 arrayobject.natcasesort.html
-rw-r--r--      3235 2017-03-28 06:06 function.is-infinite.html
-rw-r--r--      2715 2017-03-28 06:07 solrserverexception.getinternalinfo.html
-rw-r--r--      5627 2017-03-28 06:07 internals2.opcodes.fetch-func-arg.html
-rw-r--r--      2971 2017-03-28 06:06 spltype.construct.html
-rw-r--r--      6419 2017-03-28 06:06 intlchar.getintpropertyminvalue.html
-rw-r--r--      3320 2017-03-28 06:06 function.stats-rand-gen-noncenral-chisquare.html
-rw-r--r--     14523 2017-03-28 06:06 function.cubrid-get-db-parameter.html
-rw-r--r--      1815 2017-03-28 06:06 function.pdf-open-tiff.html
-rw-r--r--      4851 2017-03-28 06:06 cairocontext.pathextents.html
-rw-r--r--      3899 2017-03-28 06:06 function.dbplus-aql.html
-rw-r--r--      3251 2017-03-28 06:06 evtimer.again.html
-rw-r--r--      3124 2017-03-28 06:06 imagick.profileimage.html
-rw-r--r--      2612 2017-03-28 06:07 varnishadmin.banurl.html
-rw-r--r--      5486 2017-03-28 06:05 phardata.addemptydir.html
-rw-r--r--     10168 2017-03-28 06:05 language.generators.overview.html
-rw-r--r--      2716 2017-03-28 06:06 evwatcher.invoke.html
-rw-r--r--      1431 2017-03-28 06:05 intro.scream.html
-rw-r--r--      3430 2017-03-28 06:06 function.fann-save-train.html
-rw-r--r--      4530 2017-03-28 06:06 function.cairo-surface-get-font-options.html
-rw-r--r--      6135 2017-03-28 06:07 function.get-resource-type.html
-rw-r--r--      8990 2017-03-28 06:06 class.swftextfield.html
-rw-r--r--     14818 2017-03-28 06:06 maxdb.examples-basic.html
-rw-r--r--      7140 2017-03-28 06:06 function.pg-meta-data.html
-rw-r--r--      4261 2017-03-28 06:05 htscanner.configuration.html
-rw-r--r--      2607 2017-03-28 06:06 yaf-controller-abstract.getview.html
-rw-r--r--      3748 2017-03-28 06:06 harudestination.setfitr.html
-rw-r--r--      4918 2017-03-28 06:06 function.pspell-config-ignore.html
-rw-r--r--      1950 2017-03-28 06:06 function.pdf-end-font.html
-rw-r--r--      1883 2017-03-28 06:07 internals2.ze1.intro.html
-rw-r--r--      1249 2017-03-28 06:06 filepro.constants.html
-rw-r--r--      2716 2017-03-28 06:06 function.pdf-setcolor.html
-rw-r--r--      4967 2017-03-28 06:06 imagick.setimageiterations.html
-rw-r--r--     22554 2017-03-28 06:06 mongocollection.aggregatecursor.html
-rw-r--r--      2324 2017-03-28 06:06 function.pdf-load-image.html
-rw-r--r--     19739 2017-03-28 06:06 swfshape.setline.html
-rw-r--r--      4850 2017-03-28 06:06 cairocontext.getlinejoin.html
-rw-r--r--      8841 2017-03-28 06:06 function.oci-field-type-raw.html
-rw-r--r--      6831 2017-03-28 06:06 intlcalendar.fromdatetime.html
-rw-r--r--      6608 2017-03-28 06:06 cond.wait.html
-rw-r--r--      3553 2017-03-28 06:06 function.msql-drop-db.html
-rw-r--r--      3005 2017-03-28 06:06 function.stats-cdf-exponential.html
-rw-r--r--      2917 2017-03-28 06:07 hwapi.attribute-langdepvalue.html
-rw-r--r--      2413 2017-03-28 06:05 function.ncurses-slk-restore.html
-rw-r--r--      8792 2017-03-28 06:06 function.xdiff-file-patch.html
-rw-r--r--      6455 2017-03-28 06:06 function.mssql-fetch-batch.html
-rw-r--r--      1835 2017-03-28 06:06 ref.rpmreader.html
-rw-r--r--      3555 2017-03-28 06:06 function.fann-set-cascade-min-out-epochs.html
-rw-r--r--     14633 2017-03-28 06:06 function.imap-createmailbox.html
-rw-r--r--      2152 2017-03-28 06:06 function.ocifreecollection.html
-rw-r--r--      4421 2017-03-28 06:07 ds-map.reversed.html
-rw-r--r--      4991 2017-03-28 06:07 soapclient.gettypes.html
-rw-r--r--      2609 2017-03-28 06:07 internals2.pdo.html
-rw-r--r--      2406 2017-03-28 06:06 yaf-session.current.html
-rw-r--r--      2050 2017-03-28 06:06 function.ocinumcols.html
-rw-r--r--      3022 2017-03-28 06:07 solrquery.setfacetmincount.html
-rw-r--r--      2555 2017-03-28 06:07 solrquery.setquery.html
-rw-r--r--      1711 2017-03-28 06:07 internals2.counter.setup.html
-rw-r--r--      2759 2017-03-28 06:07 domnode.issamenode.html
-rw-r--r--      3796 2017-03-28 06:06 class.cairolinecap.html
-rw-r--r--      3965 2017-03-28 06:07 ds-sequence.reverse.html
-rw-r--r--      7226 2017-03-28 06:05 wrappers.audio.html
-rw-r--r--      2987 2017-03-28 06:07 sdo-das-xml-document.setxmldeclaration.html
-rw-r--r--      2652 2017-03-28 06:06 function.fann-get-num-output.html
-rw-r--r--      2689 2017-03-28 06:06 function.trader-midpoint.html
-rw-r--r--      2771 2017-03-28 06:07 sdo-das-changesummary.endlogging.html
-rw-r--r--      2823 2017-03-28 06:06 mysqlnd-uh.changes-one-o.html
-rw-r--r--      5169 2017-03-28 06:06 class.splstring.html
-rw-r--r--      3767 2017-03-28 06:06 function.odbc-exec.html
-rw-r--r--      2999 2017-03-28 06:06 gmagick.cyclecolormapimage.html
-rw-r--r--      3194 2017-03-28 06:06 function.ps-end-template.html
-rw-r--r--      5026 2017-03-28 06:05 reserved.variables.globals.html
-rw-r--r--      3266 2017-03-28 06:07 function.yaz-database.html
-rw-r--r--      4396 2017-03-28 06:05 exception.construct.html
-rw-r--r--      2624 2017-03-28 06:07 migration5.oop.html
-rw-r--r--     17712 2017-03-28 06:05 rararchive.open.html
-rw-r--r--      4646 2017-03-28 06:06 function.sybase-fetch-assoc.html
-rw-r--r--      9187 2017-03-28 06:06 function.db2-fetch-object.html
-rw-r--r--      6448 2017-03-28 06:06 function.gmp-sqrtrem.html
-rw-r--r--      4264 2017-03-28 06:07 function.gupnp-service-info-get-introspection.html
-rw-r--r--      2389 2017-03-28 06:07 book.win32ps.html
-rw-r--r--      3271 2017-03-28 06:07 migration55.classes.html
-rw-r--r--     11180 2017-03-28 06:06 mysqli.insert-id.html
-rw-r--r--      5957 2017-03-28 06:06 function.imap-sort.html
-rw-r--r--      1700 2017-03-28 06:07 ds-vector.count.html
-rw-r--r--      2843 2017-03-28 06:06 eventlistener.disable.html
-rw-r--r--      3113 2017-03-28 06:07 sdo-das-changesummary.getchangeddataobjects.html
-rw-r--r--      3315 2017-03-28 06:06 function.curl-multi-getcontent.html
-rw-r--r--      2820 2017-03-28 06:06 intltimezone.countequivalentids.html
-rw-r--r--      2661 2017-03-28 06:06 book.shmop.html
-rw-r--r--      3476 2017-03-28 06:06 mongo.tutorial.connecting.html
-rw-r--r--      2178 2017-03-28 06:07 ui-control.destroy.html
-rw-r--r--      2723 2017-03-28 06:05 function.ncurses-bkgd.html
-rw-r--r--      2212 2017-03-28 06:07 ui-controls-form.ispadded.html
-rw-r--r--      5123 2017-03-28 06:07 reflectionclass.iscloneable.html
-rw-r--r--      3863 2017-03-28 06:06 function.ps-symbol-name.html
-rw-r--r--     11198 2017-03-28 06:06 function.sqlite-exec.html
-rw-r--r--      3562 2017-03-28 06:05 function.newt-checkbox-tree-multi.html
-rw-r--r--      8623 2017-03-28 06:06 mysqlnduhconnection.getfieldcount.html
-rw-r--r--      1547 2017-03-28 06:06 openssl.setup.html
-rw-r--r--      2649 2017-03-28 06:06 intltimezone.gettzdataversion.html
-rw-r--r--      5714 2017-03-28 06:06 function.mysql-set-charset.html
-rw-r--r--      6140 2017-03-28 06:06 book.posix.html
-rw-r--r--      5284 2017-03-28 06:07 function.ldap-first-attribute.html
-rw-r--r--      5824 2017-03-28 06:06 function.cairo-pattern-add-color-stop-rgba.html
-rw-r--r--      1328 2017-03-28 06:06 imagick.resources.html
-rw-r--r--      4757 2017-03-28 06:06 mongodb-bson-timestamp.tostring.html
-rw-r--r--      4097 2017-03-28 06:06 function.oci-client-version.html
-rw-r--r--      3916 2017-03-28 06:06 cairogradientpattern.getcolorstopcount.html
-rw-r--r--     15165 2017-03-28 06:06 book.datetime.html
-rw-r--r--      1609 2017-03-28 06:06 tokyo-tyrant.setup.html
-rw-r--r--     16489 2017-03-28 06:06 mysqli-result.current-field.html
-rw-r--r--      8488 2017-03-28 06:05 features.remote-files.html
-rw-r--r--      3913 2017-03-28 06:06 function.enchant-broker-set-dict-path.html
-rw-r--r--      3010 2017-03-28 06:07 function.svn-fs-props-changed.html
-rw-r--r--      2506 2017-03-28 06:06 class.countable.html
-rw-r--r--      1486 2017-03-28 06:06 judy.setup.html
-rw-r--r--      8379 2017-03-28 06:06 mongodb-driver-manager.getservers.html
-rw-r--r--      1370 2017-03-28 06:06 password.configuration.html
-rw-r--r--      2763 2017-03-28 06:06 gearmanclient.geterrno.html
-rw-r--r--      5371 2017-03-28 06:06 intlchar.ismirrored.html
-rw-r--r--      3384 2017-03-28 06:07 ui-draw-path.newfigurewitharc.html
-rw-r--r--      2618 2017-03-28 06:06 function.stats-absolute-deviation.html
-rw-r--r--      3643 2017-03-28 06:07 function.variant-cast.html
-rw-r--r--      3005 2017-03-28 06:06 iteratoriterator.construct.html
-rw-r--r--      8323 2017-03-28 06:05 class.serializable.html
-rw-r--r--      1313 2017-03-28 06:07 intro.svm.html
-rw-r--r--      4565 2017-03-28 06:06 syncsharedmemory.size.html
-rw-r--r--      7430 2017-03-28 06:06 function.iconv-substr.html
-rw-r--r--      3588 2017-03-28 06:07 internals2.counter.function.counter-get-value.html
-rw-r--r--      6730 2017-03-28 06:05 closure.call.html
-rw-r--r--     12779 2017-03-28 06:07 memcache.addserver.html
-rw-r--r--      4922 2017-03-28 06:06 iconv.configuration.html
-rw-r--r--      3784 2017-03-28 06:07 function.stomp-connect-error.html
-rw-r--r--      2121 2017-03-28 06:06 function.pdf-setflat.html
-rw-r--r--      4930 2017-03-28 06:07 ds-priorityqueue.allocate.html
-rw-r--r--      5420 2017-03-28 06:06 cairocontext.instroke.html
-rw-r--r--      3083 2017-03-28 06:05 function.zip-close.html
-rw-r--r--      2373 2017-03-28 06:06 function.vpopmail-error.html
-rw-r--r--      5578 2017-03-28 06:07 reflectionfunctionabstract.isclosure.html
-rw-r--r--      3549 2017-03-28 06:06 mongocursor.limit.html
-rw-r--r--      5420 2017-03-28 06:07 ds-set.sum.html
-rw-r--r--      5712 2017-03-28 06:06 ref.gmp.html
-rw-r--r--     17274 2017-03-28 06:05 install.unix.sun.html
-rw-r--r--      1925 2017-03-28 06:06 mysqlnd-qc.changes.html
-rw-r--r--      2991 2017-03-28 06:06 function.stats-dens-cauchy.html
-rw-r--r--      3588 2017-03-28 06:06 function.ps-open-file.html
-rw-r--r--     13353 2017-03-28 06:06 function.ingres-set-environment.html
-rw-r--r--     16525 2017-03-28 06:06 mysqli.affected-rows.html
-rw-r--r--      2871 2017-03-28 06:05 function.ncurses-slk-set.html
-rw-r--r--      2940 2017-03-28 06:07 solrquery.setmltmindocfrequency.html
-rw-r--r--      1772 2017-03-28 06:06 intro.gmagick.html
-rw-r--r--      2455 2017-03-28 06:06 splpriorityqueue.key.html
-rw-r--r--      6226 2017-03-28 06:07 xsltprocessor.transformtouri.html
-rw-r--r--      7604 2017-03-28 06:06 function.db2-table-privileges.html
-rw-r--r--      1315 2017-03-28 06:07 tcpwrap.requirements.html
-rw-r--r--      8168 2017-03-28 06:05 ziparchive.addglob.html
-rw-r--r--      3112 2017-03-28 06:07 function.long2ip.html
-rw-r--r--      3088 2017-03-28 06:07 solrquery.addsortfield.html
-rw-r--r--      2679 2017-03-28 06:06 function.vpopmail-alias-add.html
-rw-r--r--      3131 2017-03-28 06:07 internals2.counter.counter-class.setcounterclass.html
-rw-r--r--      1652 2017-03-28 06:05 constants.newt.listbox-flags.html
-rw-r--r--      2812 2017-03-28 06:05 function.newt-wait-for-key.html
-rw-r--r--      2447 2017-03-28 06:07 ui-controls-entry.construct.html
-rw-r--r--      4914 2017-03-28 06:06 function.ps-place-image.html
-rw-r--r--     10634 2017-03-28 06:07 function.session-create-id.html
-rw-r--r--     25509 2017-03-28 06:07 book.ds.html
-rw-r--r--      1492 2017-03-28 06:07 pcre.setup.html
-rw-r--r--      2712 2017-03-28 06:05 function.newt-set-help-callback.html
-rw-r--r--      3052 2017-03-28 06:06 yaf-request-simple.construct.html
-rw-r--r--      2384 2017-03-28 06:06 imagick.getimageiterations.html
-rw-r--r--      5678 2017-03-28 06:07 class.ui-draw-brush-lineargradient.html
-rw-r--r--      4900 2017-03-28 06:05 install.windows.recommended.html
-rw-r--r--      3021 2017-03-28 06:07 function.ldap-free-result.html
-rw-r--r--     11430 2017-03-28 06:07 function.each.html
-rw-r--r--      3574 2017-03-28 06:07 function.yaz-range.html
-rw-r--r--      2214 2017-03-28 06:07 ui-window.onclosing.html
-rw-r--r--      2554 2017-03-28 06:06 judy.offsetget.html
-rw-r--r--     10744 2017-03-28 06:06 cairocontext.getcurrentpoint.html
-rw-r--r--      2740 2017-03-28 06:06 imagick.displayimages.html
-rw-r--r--      1464 2017-03-28 06:06 gmagick.setup.html
-rw-r--r--      2803 2017-03-28 06:07 function.svn-fs-revision-root.html
-rw-r--r--      6632 2017-03-28 06:06 function.log-cmd-update.html
-rw-r--r--      8420 2017-03-28 06:06 function.imagecropauto.html
-rw-r--r--      2696 2017-03-28 06:06 function.bson-encode.html
-rw-r--r--      3065 2017-03-28 06:07 solrquery.addfacetdateother.html
-rw-r--r--      4639 2017-03-28 06:06 mysqli.persistconns.html
-rw-r--r--      6252 2017-03-28 06:07 memcache.getserverstatus.html
-rw-r--r--     10785 2017-03-28 06:07 function.socket-set-option.html
-rw-r--r--      3632 2017-03-28 06:07 xmlreader.setrelaxngschema.html
-rw-r--r--     11310 2017-03-28 06:06 numberformatter.gettextattribute.html
-rw-r--r--      2906 2017-03-28 06:06 intlbreakiterator.following.html
-rw-r--r--      8071 2017-03-28 06:07 filter.filters.validate.html
-rw-r--r--      2369 2017-03-28 06:05 id3v2tag.getframelist.html
-rw-r--r--     13149 2017-03-28 06:06 function.ps-begin-pattern.html
-rw-r--r--      2583 2017-03-28 06:06 yaf-request-abstract.isput.html
-rw-r--r--      3864 2017-03-28 06:06 function.spl-autoload.html
-rw-r--r--      2029 2017-03-28 06:05 features.commandline.html
-rw-r--r--      3177 2017-03-28 06:06 function.fbsql-free-result.html
-rw-r--r--     16734 2017-03-28 06:06 mysqli-result.fetch-field-direct.html
-rw-r--r--      3200 2017-03-28 06:06 eventutil.getlastsocketerror.html
-rw-r--r--      4451 2017-03-28 06:07 class.ds-collection.html
-rw-r--r--      6595 2017-03-28 06:07 function.strval.html
-rw-r--r--      2690 2017-03-28 06:06 function.fann-get-num-layers.html
-rw-r--r--      4166 2017-03-28 06:06 ref.pcntl.html
-rw-r--r--      3837 2017-03-28 06:05 function.crack-opendict.html
-rw-r--r--      4651 2017-03-28 06:06 syncsemaphore.lock.html
-rw-r--r--      4763 2017-03-28 06:06 function.decoct.html
-rw-r--r--      4871 2017-03-28 06:06 class.cairopatterntype.html
-rw-r--r--      4027 2017-03-28 06:05 function.radius-salt-encrypt-attr.html
-rw-r--r--      2647 2017-03-28 06:06 yaf-request-abstract.getparams.html
-rw-r--r--      4488 2017-03-28 06:06 mysqli.client-info.html
-rw-r--r--      3033 2017-03-28 06:06 harupage.gettextmatrix.html
-rw-r--r--      4083 2017-03-28 06:06 cairopdfsurface.setsize.html
-rw-r--r--      2812 2017-03-28 06:06 function.trader-linearreg-slope.html
-rw-r--r--      3030 2017-03-28 06:06 mime-magic.installation.html
-rw-r--r--      3923 2017-03-28 06:06 gmagickdraw.arc.html
-rw-r--r--      3182 2017-03-28 06:06 imagickdraw.pathmovetoabsolute.html
-rw-r--r--     15132 2017-03-28 06:07 reflectionproperty.construct.html
-rw-r--r--      5581 2017-03-28 06:06 geoip.constants.html
-rw-r--r--      3466 2017-03-28 06:05 phar.isvalidpharfilename.html
-rw-r--r--      8946 2017-03-28 06:06 yaml.constants.html
-rw-r--r--      5959 2017-03-28 06:06 function.log-cmd-insert.html
-rw-r--r--      8645 2017-03-28 06:06 class.appenditerator.html
-rw-r--r--      2482 2017-03-28 06:06 sem.configuration.html
-rw-r--r--      5940 2017-03-28 06:06 class.filteriterator.html
-rw-r--r--      3109 2017-03-28 06:07 solrquery.sethighlightregexmaxanalyzedchars.html
-rw-r--r--      6424 2017-03-28 06:06 intlchar.getintpropertymaxvalue.html
-rw-r--r--      2801 2017-03-28 06:06 function.trader-sub.html
-rw-r--r--      2369 2017-03-28 06:06 function.ibase-service-attach.html
-rw-r--r--      7879 2017-03-28 06:07 class.solrparams.html
-rw-r--r--     15496 2017-03-28 06:06 mysqlnd-uh.quickstart.proxy-installation.html
-rw-r--r--      2906 2017-03-28 06:06 harudoc.usejpencodings.html
-rw-r--r--      2022 2017-03-28 06:06 function.pdf-get-apiname.html
-rw-r--r--     13132 2017-03-28 06:06 swfgradient.construct.html
-rw-r--r--      6202 2017-03-28 06:07 regexp.reference.onlyonce.html
-rw-r--r--      2932 2017-03-28 06:06 gearmanclient.echo.html
-rw-r--r--      7672 2017-03-28 06:05 function.mcrypt-create-iv.html
-rw-r--r--      1489 2017-03-28 06:06 fileinfo.resources.html
-rw-r--r--      2873 2017-03-28 06:07 migration51.datetime.html
-rw-r--r--      3356 2017-03-28 06:06 function.ingres-autocommit-state.html
-rw-r--r--      7517 2017-03-28 06:07 quickhashintset.add.html
-rw-r--r--      5134 2017-03-28 06:06 cairogradientpattern.addcolorstoprgba.html
-rw-r--r--      4981 2017-03-28 06:07 ds-sequence.push.html
-rw-r--r--      1533 2017-03-28 06:05 inclued.setup.html
-rw-r--r--      3508 2017-03-28 06:06 function.imap-close.html
-rw-r--r--      3608 2017-03-28 06:06 mongocursor.dead.html
-rw-r--r--      4456 2017-03-28 06:06 mongolog.getlevel.html
-rw-r--r--      1313 2017-03-28 06:05 opcache.requirements.html
-rw-r--r--      5349 2017-03-28 06:06 function.ftp-pwd.html
-rw-r--r--      2998 2017-03-28 06:06 function.stats-dens-laplace.html
-rw-r--r--      7262 2017-03-28 06:06 class.resourcebundle.html
-rw-r--r--      2489 2017-03-28 06:06 imagick.readimage.html
-rw-r--r--      2606 2017-03-28 06:06 mongo.manual.html
-rw-r--r--      6676 2017-03-28 06:06 function.fbsql-error.html
-rw-r--r--      2012 2017-03-28 06:06 xdiff.installation.html
-rw-r--r--      3643 2017-03-28 06:06 mongodb-bson-maxkey.serialize.html
-rw-r--r--     14105 2017-03-28 06:06 function.stream-socket-server.html
-rw-r--r--      3832 2017-03-28 06:05 function.ncurses-prefresh.html
-rw-r--r--      7988 2017-03-28 06:06 splobjectstorage.getinfo.html
-rw-r--r--      7690 2017-03-28 06:07 migration71.other-changes.html
-rw-r--r--      3187 2017-03-28 06:06 function.fdf-error.html
-rw-r--r--      3409 2017-03-28 06:06 gearmanworker.unregister.html
-rw-r--r--      6991 2017-03-28 06:07 reflectionmethod.invokeargs.html
-rw-r--r--     12225 2017-03-28 06:06 class.mongowritebatch.html
-rw-r--r--      3175 2017-03-28 06:06 event.free.html
-rw-r--r--      5863 2017-03-28 06:06 splobjectstorage.valid.html
-rw-r--r--     19663 2017-03-28 06:05 language.variables.external.html
-rw-r--r--      1301 2017-03-28 06:06 shmop.requirements.html
-rw-r--r--      1490 2017-03-28 06:06 event.setup.html
-rw-r--r--      3323 2017-03-28 06:07 function.memcache-debug.html
-rw-r--r--     11838 2017-03-28 06:05 class.errorexception.html
-rw-r--r--      7763 2017-03-28 06:07 ds-deque.sort.html
-rw-r--r--      2014 2017-03-28 06:06 intro.event.html
-rw-r--r--      2931 2017-03-28 06:06 imagick.getimagecolormapcolor.html
-rw-r--r--      4880 2017-03-28 06:07 ds-queue.push.html
-rw-r--r--      7536 2017-03-28 06:05 function.wincache-ucache-clear.html
-rw-r--r--      2629 2017-03-28 06:06 function.imap-headers.html
-rw-r--r--      8650 2017-03-28 06:07 samconnection.peekall.html
-rw-r--r--      6205 2017-03-28 06:06 imagick.haldclutimage.html
-rw-r--r--      6392 2017-03-28 06:05 class.ktaglib-mpeg-audioproperties.html
-rw-r--r--      6749 2017-03-28 06:06 tokyotyrant.fwmkeys.html
-rw-r--r--      3944 2017-03-28 06:06 cairosurfacepattern.setfilter.html
-rw-r--r--      9534 2017-03-28 06:06 function.dba-open.html
-rw-r--r--      2558 2017-03-28 06:06 gearmanjob.setreturn.html
-rw-r--r--      6163 2017-03-28 06:06 imagick.gaussianblurimage.html
-rw-r--r--      2451 2017-03-28 06:06 imagickdraw.render.html
-rw-r--r--      2890 2017-03-28 06:06 function.trader-trange.html
-rw-r--r--      4628 2017-03-28 06:07 ds-set.allocate.html
-rw-r--r--      2666 2017-03-28 06:06 function.vpopmail-add-alias-domain.html
-rw-r--r--      4048 2017-03-28 06:06 arrayiterator.key.html
-rw-r--r--      3292 2017-03-28 06:06 arrayiterator.asort.html
-rw-r--r--      2342 2017-03-28 06:07 solrdocument.destruct.html
-rw-r--r--      4702 2017-03-28 06:07 function.ssh2-auth-agent.html
-rw-r--r--      6472 2017-03-28 06:07 samconnection.peek.html
-rw-r--r--      1448 2017-03-28 06:06 rpmreader.resources.html
-rw-r--r--      2489 2017-03-28 06:06 splpriorityqueue.valid.html
-rw-r--r--      4150 2017-03-28 06:07 function.ord.html
-rw-r--r--      2642 2017-03-28 06:07 svn.installation.html
-rw-r--r--      4867 2017-03-28 06:06 function.cairo-pattern-create-rgb.html
-rw-r--r--      7892 2017-03-28 06:06 function.mssql-field-length.html
-rw-r--r--      3125 2017-03-28 06:06 function.imap-utf8.html
-rw-r--r--      2734 2017-03-28 06:05 function.ncurses-scr-dump.html
-rw-r--r--      4116 2017-03-28 06:06 pdo.pgsqlcopyfromarray.html
-rw-r--r--      1722 2017-03-28 06:05 features.gc.html
-rw-r--r--      3005 2017-03-28 06:05 function.ncurses-has-il.html
-rw-r--r--      3746 2017-03-28 06:07 function.gupnp-context-unhost-path.html
-rw-r--r--     14762 2017-03-28 06:06 function.cubrid-pconnect-with-url.html
-rw-r--r--      4896 2017-03-28 06:07 function.xmlwriter-write-dtd-attlist.html
-rw-r--r--      1523 2017-03-28 06:07 libxml.setup.html
-rw-r--r--      2475 2017-03-28 06:06 function.trader-tan.html
-rw-r--r--     15900 2017-03-28 06:06 function.stream-socket-client.html
-rw-r--r--     10524 2017-03-28 06:06 function.mysql-db-query.html
-rw-r--r--      3855 2017-03-28 06:07 ds-set.first.html
-rw-r--r--      3142 2017-03-28 06:07 function.gupnp-service-action-return.html
-rw-r--r--      1287 2017-03-28 06:06 sem.requirements.html
-rw-r--r--      6196 2017-03-28 06:06 imagickpixel.getcolor.html
-rw-r--r--      4463 2017-03-28 06:07 sam.errors.html
-rw-r--r--      2164 2017-03-28 06:06 function.pdf-close-image.html
-rw-r--r--      3276 2017-03-28 06:06 imagick.getimagedistortion.html
-rw-r--r--      7975 2017-03-28 06:06 eventhttp.setdefaultcallback.html
-rw-r--r--     25122 2017-03-28 06:06 swfbutton.construct.html
-rw-r--r--      5406 2017-03-28 06:07 zookeeper.delete.html
-rw-r--r--      4580 2017-03-28 06:05 function.ob-get-contents.html
-rw-r--r--      3497 2017-03-28 06:06 function.password-get-info.html
-rw-r--r--      1501 2017-03-28 06:07 varnish.examples.html
-rw-r--r--      9667 2017-03-28 06:05 language.oop5.object-comparison.html
-rw-r--r--      3574 2017-03-28 06:06 cairomatrix.invert.html
-rw-r--r--      4484 2017-03-28 06:07 function.ldap-get-entries.html
-rw-r--r--      5411 2017-03-28 06:05 memtrack.ini.html
-rw-r--r--      2378 2017-03-28 06:07 ui-controls-button.construct.html
-rw-r--r--      1536 2017-03-28 06:07 win32ps.setup.html
-rw-r--r--      2417 2017-03-28 06:06 imagickdraw.getfillcolor.html
-rw-r--r--      1307 2017-03-28 06:05 apcu.resources.html
-rw-r--r--      6514 2017-03-28 06:06 imagick.textureimage.html
-rw-r--r--      5815 2017-03-28 06:06 mongodb-driver-server.getport.html
-rw-r--r--      3575 2017-03-28 06:07 book.sdodasrel.html
-rw-r--r--     12264 2017-03-28 06:06 imagickdraw.setstrokemiterlimit.html
-rw-r--r--     14023 2017-03-28 06:06 class.spldoublylinkedlist.html
-rw-r--r--      4529 2017-03-28 06:05 rarentry.isdirectory.html
-rw-r--r--      5633 2017-03-28 06:06 function.imagefontheight.html
-rw-r--r--      2411 2017-03-28 06:05 rarentry.getfiletime.html
-rw-r--r--      7199 2017-03-28 06:06 mongodb-driver-writeconcernerror.getcode.html
-rw-r--r--      4389 2017-03-28 06:06 function.mhash-keygen-s2k.html
-rw-r--r--      3573 2017-03-28 06:06 function.fann-set-sarprop-weight-decay-shift.html
-rw-r--r--      2446 2017-03-28 06:06 splpriorityqueue.next.html
-rw-r--r--      3484 2017-03-28 06:06 recursivefilteriterator.haschildren.html
-rw-r--r--      8442 2017-03-28 06:06 function.pg-fetch-assoc.html
-rw-r--r--      5266 2017-03-28 06:06 evwatcher.keepalive.html
-rw-r--r--      3010 2017-03-28 06:07 function.wddx-serialize-value.html
-rw-r--r--      5607 2017-03-28 06:06 mongo.connecting.persistent.html
-rw-r--r--      2739 2017-03-28 06:06 mysql.html
-rw-r--r--      2718 2017-03-28 06:06 swftextfield.setfont.html
-rw-r--r--      2647 2017-03-28 06:06 yaf-route-static.match.html
-rw-r--r--      2517 2017-03-28 06:06 harudoc.construct.html
-rw-r--r--      5488 2017-03-28 06:07 class.ui-draw-text-font-descriptor.html
-rw-r--r--      8606 2017-03-28 06:07 refs.xml.html
-rw-r--r--      4853 2017-03-28 06:07 class.zmqcontext.html
-rw-r--r--      2884 2017-03-28 06:07 internals2.opcodes.cast.html
-rw-r--r--      2225 2017-03-28 06:07 ui-window.save.html
-rw-r--r--      4395 2017-03-28 06:05 function.newt-form-run.html
-rw-r--r--      4670 2017-03-28 06:06 function.ps-set-value.html
-rw-r--r--     10486 2017-03-28 06:06 intlcalendar.settimezone.html
-rw-r--r--      1522 2017-03-28 06:06 iconv.setup.html
-rw-r--r--      6255 2017-03-28 06:06 function.imagecolorclosesthwb.html
-rw-r--r--      5731 2017-03-28 06:06 mongocommandcursor.rewind.html
-rw-r--r--     15643 2017-03-28 06:06 mysqli.use-result.html
-rw-r--r--      8539 2017-03-28 06:05 security.errors.html
-rw-r--r--      7130 2017-03-28 06:06 mongodb-driver-readconcern.construct.html
-rw-r--r--      6204 2017-03-28 06:06 function.pg-end-copy.html
-rw-r--r--     12529 2017-03-28 06:06 function.imagesetstyle.html
-rw-r--r--      5616 2017-03-28 06:06 function.cairo-pattern-create-radial.html
-rw-r--r--      5071 2017-03-28 06:07 domdocument.createdocumentfragment.html
-rw-r--r--      4879 2017-03-28 06:07 domnode.insertbefore.html
-rw-r--r--      4050 2017-03-28 06:05 exception.getfile.html
-rw-r--r--      2617 2017-03-28 06:07 solrinputdocument.getboost.html
-rw-r--r--      1940 2017-03-28 06:07 function.socket-set-blocking.html
-rw-r--r--      3196 2017-03-28 06:07 sdo-model-type.issequencedtype.html
-rw-r--r--      8738 2017-03-28 06:06 function.sqlsrv-num-fields.html
-rw-r--r--      1377 2017-03-28 06:06 intro.msql.html
-rw-r--r--      1498 2017-03-28 06:06 ming.setup.html
-rw-r--r--      5439 2017-03-28 06:06 function.gnupg-setsignmode.html
-rw-r--r--     11566 2017-03-28 06:07 bbcode.constants.html
-rw-r--r--      2234 2017-03-28 06:07 ui-window.open.html
-rw-r--r--     14203 2017-03-28 06:06 book.mongodb.html
-rw-r--r--      5174 2017-03-28 06:06 function.ingres-num-rows.html
-rw-r--r--      1824 2017-03-28 06:06 ref.bson.html
-rw-r--r--     17711 2017-03-28 06:06 function.mysql-connect.html
-rw-r--r--      1267 2017-03-28 06:06 judy.resources.html
-rw-r--r--      1239 2017-03-28 06:06 intro.sqlite3.html
-rw-r--r--      5606 2017-03-28 06:06 imagick.setfont.html
-rw-r--r--      3564 2017-03-28 06:06 cairosurface.flush.html
-rw-r--r--      2070 2017-03-28 06:07 solrquery.getexpandquery.html
-rw-r--r--      3078 2017-03-28 06:05 function.ncurses-noecho.html
-rw-r--r--      1861 2017-03-28 06:06 function.msql-fieldtype.html
-rw-r--r--      2508 2017-03-28 06:06 yaf-config-ini.readonly.html
-rw-r--r--      1660 2017-03-28 06:07 sockets.installation.html
-rw-r--r--      5735 2017-03-28 06:05 wrappers.glob.html
-rw-r--r--     17881 2017-03-28 06:06 function.db2-lob-read.html
-rw-r--r--     16086 2017-03-28 06:06 intldateformatter.islenient.html
-rw-r--r--      1809 2017-03-28 06:06 enchant.installation.html
-rw-r--r--      8747 2017-03-28 06:06 class.gearmantask.html
-rw-r--r--      4217 2017-03-28 06:05 error.getline.html
-rw-r--r--      5381 2017-03-28 06:06 tokyotyrant.out.html
-rw-r--r--      2818 2017-03-28 06:06 yaf-config-ini.construct.html
-rw-r--r--     13451 2017-03-28 06:07 yar-concurrent-client.loop.html
-rw-r--r--     11606 2017-03-28 06:07 class.solrqueryresponse.html
-rw-r--r--      5419 2017-03-28 06:06 mongodb-bson-objectid.construct.html
-rw-r--r--      6814 2017-03-28 06:07 rrd.examples-oop.html
-rw-r--r--      5166 2017-03-28 06:07 function.ssh2-sftp.html
-rw-r--r--      4050 2017-03-28 06:07 book.msession.html
-rw-r--r--      4014 2017-03-28 06:07 function.xmlwriter-end-element.html
-rw-r--r--      2554 2017-03-28 06:06 imagick.getimageattribute.html
-rw-r--r--      2897 2017-03-28 06:07 sdo-dataobject.getcontainer.html
-rw-r--r--      3360 2017-03-28 06:05 constants.newt.components-flags.html
-rw-r--r--      2779 2017-03-28 06:07 solrinputdocument.deletefield.html
-rw-r--r--     29975 2017-03-28 06:06 function.imagefilter.html
-rw-r--r--      2585 2017-03-28 06:06 swftext.setheight.html
-rw-r--r--      2922 2017-03-28 06:05 function.m-numrows.html
-rw-r--r--      3378 2017-03-28 06:06 function.ps-restore.html
-rw-r--r--      5955 2017-03-28 06:06 imagick.cropimage.html
-rw-r--r--      1833 2017-03-28 06:06 intro.json.html
-rw-r--r--     43125 2017-03-28 06:05 class.rarentry.html
-rw-r--r--      5349 2017-03-28 06:07 function.snmpget.html
-rw-r--r--     29429 2017-03-28 06:06 mysqli.quickstart.statements.html
-rw-r--r--     10904 2017-03-28 06:06 intldateformatter.getlocale.html
-rw-r--r--      5483 2017-03-28 06:06 mongodb.getwriteconcern.html
-rw-r--r--      4018 2017-03-28 06:06 imagickdraw.pathcurvetoquadraticbezierrelative.html
-rw-r--r--      2697 2017-03-28 06:06 function.event-buffer-read.html
-rw-r--r--      8436 2017-03-28 06:06 function.mysql-errno.html
-rw-r--r--      3231 2017-03-28 06:07 sdo-das-setting.getlistindex.html
-rw-r--r--      3270 2017-03-28 06:06 function.event-buffer-priority-set.html
-rw-r--r--      8572 2017-03-28 06:07 solrclient.construct.html
-rw-r--r--      6190 2017-03-28 06:06 function.curl-init.html
-rw-r--r--      3235 2017-03-28 06:06 function.imap-num-msg.html
-rw-r--r--      7052 2017-03-28 06:06 cairocontext.clipextents.html
-rw-r--r--      6250 2017-03-28 06:05 phar.offsetexists.html
-rw-r--r--      6007 2017-03-28 06:06 imagick.newimage.html
-rw-r--r--      1548 2017-03-28 06:07 xmlreader.requirements.html
-rw-r--r--      6447 2017-03-28 06:06 mongocollection.setreadpreference.html
-rw-r--r--      5686 2017-03-28 06:06 pgsql.configuration.html
-rw-r--r--      3673 2017-03-28 06:07 oauthprovider.callconsumerhandler.html
-rw-r--r--      1315 2017-03-28 06:05 weakref.requirements.html
-rw-r--r--      4859 2017-03-28 06:06 transliterator.createfromrules.html
-rw-r--r--      7829 2017-03-28 06:05 phar.extractto.html
-rw-r--r--      2009 2017-03-28 06:07 ui.installation.html
-rw-r--r--      6466 2017-03-28 06:07 zookeeper.set.html
-rw-r--r--      1862 2017-03-28 06:06 function.imap-create.html
-rw-r--r--      2460 2017-03-28 06:07 solrquery.gettermslowerbound.html
-rw-r--r--      2784 2017-03-28 06:06 imagick.setsize.html
-rw-r--r--      4320 2017-03-28 06:06 syncreaderwriter.writelock.html
-rw-r--r--      2420 2017-03-28 06:06 mysqli-warning.construct.html
-rw-r--r--      5689 2017-03-28 06:05 function.blenc-encrypt.html
-rw-r--r--      5434 2017-03-28 06:05 function.bzwrite.html
-rw-r--r--      1918 2017-03-28 06:07 sca.requirements.html
-rw-r--r--      1307 2017-03-28 06:06 chdb.resources.html
-rw-r--r--      3647 2017-03-28 06:06 evprepare.construct.html
-rw-r--r--      9601 2017-03-28 06:05 function.wincache-ocache-fileinfo.html
-rw-r--r--      1684 2017-03-28 06:07 stomp.installation.html
-rw-r--r--      4376 2017-03-28 06:06 function.sqlite-close.html
-rw-r--r--      4227 2017-03-28 06:06 function.msql-list-fields.html
-rw-r--r--      4101 2017-03-28 06:05 language.pseudo-types.html
-rw-r--r--     53554 2017-03-28 06:07 book.solr.html
-rw-r--r--      1349 2017-03-28 06:07 ctype.configuration.html
-rw-r--r--      6881 2017-03-28 06:06 appenditerator.getiteratorindex.html
-rw-r--r--      5068 2017-03-28 06:06 gearmanclient.addserver.html
-rw-r--r--      2629 2017-03-28 06:05 function.newt-listbox-get-selection.html
-rw-r--r--     27503 2017-03-28 06:06 eventlistener.construct.html
-rw-r--r--      4733 2017-03-28 06:06 class.mongogridfscursor.html
-rw-r--r--      8586 2017-03-28 06:07 ds-map.ksorted.html
-rw-r--r--     10340 2017-03-28 06:07 quickhashstringinthash.loadfromfile.html
-rw-r--r--      3701 2017-03-28 06:06 function.sybase-min-error-severity.html
-rw-r--r--      3486 2017-03-28 06:06 function.imageaffine.html
-rw-r--r--      6964 2017-03-28 06:06 yaf-route-simple.assemble.html
-rw-r--r--      8835 2017-03-28 06:06 imagickdraw.setclippath.html
-rw-r--r--      6574 2017-03-28 06:06 intlchar.isulowercase.html
-rw-r--r--      6285 2017-03-28 06:07 function.ctype-cntrl.html
-rw-r--r--     11560 2017-03-28 06:06 class.yaf-router.html
-rw-r--r--      5524 2017-03-28 06:06 function.fann-set-callback.html
-rw-r--r--      3659 2017-03-28 06:07 function.use-soap-error-handler.html
-rw-r--r--      1815 2017-03-28 06:06 function.read-exif-data.html
-rw-r--r--      3771 2017-03-28 06:06 function.trader-adosc.html
-rw-r--r--      2315 2017-03-28 06:06 imagick.getimagedelay.html
-rw-r--r--      2688 2017-03-28 06:05 id3v2attachedpictureframe.getdescription.html
-rw-r--r--      2536 2017-03-28 06:07 varnishadmin.ban.html
-rw-r--r--      6204 2017-03-28 06:05 function.wincache-ucache-inc.html
-rw-r--r--      8558 2017-03-28 06:06 imagick.adaptiveresizeimage.html
-rw-r--r--      5861 2017-03-28 06:06 yaf-response-abstract.appendbody.html
-rw-r--r--      2256 2017-03-28 06:07 ui-controls-radio.onselected.html
-rw-r--r--      6082 2017-03-28 06:06 class.overflowexception.html
-rw-r--r--      5902 2017-03-28 06:06 class.yaf-registry.html
-rw-r--r--      2341 2017-03-28 06:06 imagickdraw.poppattern.html
-rw-r--r--      3861 2017-03-28 06:06 function.stats-rand-gen-noncentral-f.html
-rw-r--r--      2563 2017-03-28 06:06 harudoc.reseterror.html
-rw-r--r--      2383 2017-03-28 06:06 ref.fam.html
-rw-r--r--      7600 2017-03-28 06:05 phar.configuration.html
-rw-r--r--      2571 2017-03-28 06:06 mbstring.installation.html
-rw-r--r--      7300 2017-03-28 06:06 function.maxdb-stat.html
-rw-r--r--      5085 2017-03-28 06:07 simplexmlelement.count.html
-rw-r--r--      6152 2017-03-28 06:06 class.badfunctioncallexception.html
-rw-r--r--      1972 2017-03-28 06:05 book.memtrack.html
-rw-r--r--      9521 2017-03-28 06:06 function.cubrid-set-drop.html
-rw-r--r--      3737 2017-03-28 06:06 expect.constants.html
-rw-r--r--      7055 2017-03-28 06:07 reflectiontype.isbuiltin.html
-rw-r--r--      6781 2017-03-28 06:06 function.pg-last-oid.html
-rw-r--r--      2882 2017-03-28 06:07 sessionhandlerinterface.close.html
-rw-r--r--      2408 2017-03-28 06:06 imagick.getsizeoffset.html
-rw-r--r--      1348 2017-03-28 06:06 yaml.callbacks.html
-rw-r--r--      1268 2017-03-28 06:06 exec.constants.html
-rw-r--r--      2929 2017-03-28 06:06 gearmanjob.unique.html
-rw-r--r--      2467 2017-03-28 06:07 function.rrd-last.html
-rw-r--r--      2739 2017-03-28 06:07 ref.apache.html
-rw-r--r--      3033 2017-03-28 06:07 rrdcreator.addarchive.html
-rw-r--r--      2346 2017-03-28 06:06 imagickpixel.getindex.html
-rw-r--r--      2739 2017-03-28 06:07 hwapi.content-read.html
-rw-r--r--      8889 2017-03-28 06:06 imagickdraw.translate.html
-rw-r--r--      4944 2017-03-28 06:06 cond.destroy.html
-rw-r--r--      6783 2017-03-28 06:06 function.chown.html
-rw-r--r--      4128 2017-03-28 06:06 syncmutex.unlock.html
-rw-r--r--      6715 2017-03-28 06:06 fdf.examples.html
-rw-r--r--      1565 2017-03-28 06:06 mongo.batch.html
-rw-r--r--      3336 2017-03-28 06:06 function.trader-cdlclosingmarubozu.html
-rw-r--r--      1506 2017-03-28 06:05 security.sessions.html
-rw-r--r--      2947 2017-03-28 06:07 solrcollapsefunction.setfield.html
-rw-r--r--      3645 2017-03-28 06:06 function.openssl-error-string.html
-rw-r--r--      4863 2017-03-28 06:06 cairopattern.getmatrix.html
-rw-r--r--     11561 2017-03-28 06:06 function.db2-fetch-array.html
-rw-r--r--      5914 2017-03-28 06:06 mongodb-driver-server.getinfo.html
-rw-r--r--      2556 2017-03-28 06:07 ui-controls-label.gettext.html
-rw-r--r--      2113 2017-03-28 06:06 function.ocicolumnisnull.html
-rw-r--r--      3191 2017-03-28 06:07 varnish.example.log.html
-rw-r--r--      1500 2017-03-28 06:06 intro.proctitle.html
-rw-r--r--      9077 2017-03-28 06:05 pharfileinfo.setmetadata.html
-rw-r--r--      8810 2017-03-28 06:07 ds-vector.reduce.html
-rw-r--r--      1678 2017-03-28 06:07 ds-stack.count.html
-rw-r--r--      8015 2017-03-28 06:06 function.mkdir.html
-rw-r--r--      4422 2017-03-28 06:06 function.cairo-ps-surface-get-eps.html
-rw-r--r--      1846 2017-03-28 06:06 function.msql-createdb.html
-rw-r--r--      3312 2017-03-28 06:06 function.dbplus-freealllocks.html
-rw-r--r--      2806 2017-03-28 06:05 id3v2attachedpictureframe.setpicture.html
-rw-r--r--      4400 2017-03-28 06:05 function.return.html
-rw-r--r--      3131 2017-03-28 06:06 tokyotyranttable.setindex.html
-rw-r--r--     10387 2017-03-28 06:07 hwapi.object.html
-rw-r--r--      8610 2017-03-28 06:06 imagick.annotateimage.html
-rw-r--r--      4475 2017-03-28 06:06 eventbuffer.readfrom.html
-rw-r--r--      4185 2017-03-28 06:06 class.mysqli-warning.html
-rw-r--r--      6727 2017-03-28 06:07 domnode.removechild.html
-rw-r--r--      2327 2017-03-28 06:05 iterator.current.html
-rw-r--r--      3745 2017-03-28 06:06 gearmanclient.runtasks.html
-rw-r--r--      1973 2017-03-28 06:05 constants.newt.sense-flags.html
-rw-r--r--      2795 2017-03-28 06:07 solrcollapsefunction.gethint.html
-rw-r--r--     69743 2017-03-28 06:06 function.db2-set-option.html
-rw-r--r--      6110 2017-03-28 06:06 function.mb-ereg.html
-rw-r--r--      3073 2017-03-28 06:06 harudestination.setfitbh.html
-rw-r--r--      4921 2017-03-28 06:06 yaf-application.getconfig.html
-rw-r--r--      3058 2017-03-28 06:06 intltimezone.createenumeration.html
-rw-r--r--      6848 2017-03-28 06:06 intlcalendar.todatetime.html
-rw-r--r--      3050 2017-03-28 06:06 imagick.cropthumbnailimage.html
-rw-r--r--      3416 2017-03-28 06:06 book.dba.html
-rw-r--r--     13055 2017-03-28 06:06 imagick.forwardfouriertransformimage.html
-rw-r--r--     10472 2017-03-28 06:07 function.xml-set-object.html
-rw-r--r--      5069 2017-03-28 06:07 function.xml-set-default-handler.html
-rw-r--r--      7112 2017-03-28 06:07 function.array-combine.html
-rw-r--r--      5081 2017-03-28 06:06 function.mysqlnd-qc-get-available-handlers.html
-rw-r--r--      7850 2017-03-28 06:06 function.openssl-spki-new.html
-rw-r--r--      2527 2017-03-28 06:06 harufont.getfontname.html
-rw-r--r--      1507 2017-03-28 06:07 intro.rrd.html
-rw-r--r--      4528 2017-03-28 06:07 ds-deque.construct.html
-rw-r--r--      4565 2017-03-28 06:07 ds-vector.allocate.html
-rw-r--r--      1702 2017-03-28 06:07 internals2.counter.examples.html
-rw-r--r--      4114 2017-03-28 06:05 generator.getreturn.html
-rw-r--r--     11424 2017-03-28 06:06 mongodb.tutorial.library.html
-rw-r--r--      4478 2017-03-28 06:06 function.getcwd.html
-rw-r--r--      4396 2017-03-28 06:07 ds-deque.copy.html
-rw-r--r--      6831 2017-03-28 06:06 intlchar.islower.html
-rw-r--r--      3022 2017-03-28 06:06 evtimer.set.html
-rw-r--r--      1502 2017-03-28 06:06 ref.intl.idn.html
-rw-r--r--      5660 2017-03-28 06:07 win32ps.examples-process.html
-rw-r--r--      1556 2017-03-28 06:06 intro.cubrid.html
-rw-r--r--      2730 2017-03-28 06:05 function.openal-buffer-create.html
-rw-r--r--      7130 2017-03-28 06:07 function.svn-checkout.html
-rw-r--r--      2936 2017-03-28 06:07 internals2.opcodes.assign-bw-and.html
-rw-r--r--      1356 2017-03-28 06:05 radius.configuration.html
-rw-r--r--      7202 2017-03-28 06:06 function.basename.html
-rw-r--r--      6419 2017-03-28 06:07 function.method-exists.html
-rw-r--r--      6947 2017-03-28 06:06 cairocontext.relcurveto.html
-rw-r--r--      3170 2017-03-28 06:06 function.msql-affected-rows.html
-rw-r--r--      7588 2017-03-28 06:05 phardata.decompress.html
-rw-r--r--      2534 2017-03-28 06:06 yaf-exception.getprevious.html
-rw-r--r--      3642 2017-03-28 06:06 harudoc.readfromstream.html
-rw-r--r--      2626 2017-03-28 06:06 yaf-response-abstract.tostring.html
-rw-r--r--     13089 2017-03-28 06:06 class.mongocommandcursor.html
-rw-r--r--      4160 2017-03-28 06:07 book.mnogosearch.html
-rw-r--r--      1703 2017-03-28 06:06 intro.yaf.html
-rw-r--r--     22300 2017-03-28 06:06 class.filesystemiterator.html
-rw-r--r--      1534 2017-03-28 06:06 ingres.setup.html
-rw-r--r--      2045 2017-03-28 06:06 function.pdf-fill.html
-rw-r--r--      3044 2017-03-28 06:06 yaf-view-interface.display.html
-rw-r--r--      3175 2017-03-28 06:06 streamwrapper.stream-truncate.html
-rw-r--r--      5687 2017-03-28 06:06 mysql.examples-basic.html
-rw-r--r--      3287 2017-03-28 06:06 function.gmp-rootrem.html
-rw-r--r--      6428 2017-03-28 06:06 function.odbc-prepare.html
-rw-r--r--      3567 2017-03-28 06:07 function.apache-reset-timeout.html
-rw-r--r--      8929 2017-03-28 06:05 class.exception.html
-rw-r--r--      2664 2017-03-28 06:06 imagick.getquantumrange.html
-rw-r--r--      1510 2017-03-28 06:07 swish.setup.html
-rw-r--r--     25339 2017-03-28 06:05 class.ziparchive.html
-rw-r--r--      2617 2017-03-28 06:06 function.oci-cancel.html
-rw-r--r--      2331 2017-03-28 06:06 function.pdf-begin-template-ext.html
-rw-r--r--      2810 2017-03-28 06:07 reflectionfunction.getclosure.html
-rw-r--r--      2765 2017-03-28 06:06 cachingiterator.offsetunset.html
-rw-r--r--      4895 2017-03-28 06:07 function.gupnp-context-get-host-ip.html
-rw-r--r--      2571 2017-03-28 06:06 yaf-request-simple.getpost.html
-rw-r--r--     11269 2017-03-28 06:06 yaf.configuration.html
-rw-r--r--      6093 2017-03-28 06:07 function.strlen.html
-rw-r--r--      7151 2017-03-28 06:07 stomp.setreadtimeout.html
-rw-r--r--      2209 2017-03-28 06:07 svm.construct.html
-rw-r--r--     27775 2017-03-28 06:05 install.fpm.configuration.html
-rw-r--r--      8493 2017-03-28 06:06 mysqlnduhconnection.getlastmessage.html
-rw-r--r--      4575 2017-03-28 06:05 scream.examples-simple.html
-rw-r--r--      6048 2017-03-28 06:06 splqueue.construct.html
-rw-r--r--      3592 2017-03-28 06:07 domelement.getelementsbytagname.html
-rw-r--r--      1846 2017-03-28 06:06 function.recode.html
-rw-r--r--      3120 2017-03-28 06:06 recursivedirectoryiterator.haschildren.html
-rw-r--r--      2908 2017-03-28 06:06 function.fann-get-total-neurons.html
-rw-r--r--      5485 2017-03-28 06:06 gearmanclient.setclientcallback.html
-rw-r--r--      4551 2017-03-28 06:05 function.error-clear-last.html
-rw-r--r--      3008 2017-03-28 06:06 mongodate.tostring.html
-rw-r--r--      8779 2017-03-28 06:07 ds-deque.reduce.html
-rw-r--r--      6111 2017-03-28 06:06 syncsemaphore.construct.html
-rw-r--r--      5631 2017-03-28 06:07 book.sockets.html
-rw-r--r--      1335 2017-03-28 06:07 xml.configuration.html
-rw-r--r--      1554 2017-03-28 06:06 vpopmail.setup.html
-rw-r--r--      6049 2017-03-28 06:06 intlchar.isidstart.html
-rw-r--r--      7208 2017-03-28 06:06 function.escapeshellcmd.html
-rw-r--r--      2474 2017-03-28 06:06 yaf-registry.del.html
-rw-r--r--      3253 2017-03-28 06:06 harudoc.loadjpeg.html
-rw-r--r--      1337 2017-03-28 06:06 math.installation.html
-rw-r--r--      3914 2017-03-28 06:07 function.com-message-pump.html
-rw-r--r--      1356 2017-03-28 06:06 dbplus.configuration.html
-rw-r--r--      2817 2017-03-28 06:06 datetime.constants.html
-rw-r--r--      3111 2017-03-28 06:05 apcuiterator.current.html
-rw-r--r--      3662 2017-03-28 06:06 limititerator.rewind.html
-rw-r--r--      9997 2017-03-28 06:06 pdostatement.bindvalue.html
-rw-r--r--      3086 2017-03-28 06:06 gmagick.getimageblueprimary.html
-rw-r--r--      2463 2017-03-28 06:07 ui-area.scrollto.html
-rw-r--r--      2536 2017-03-28 06:07 ui-controls-multilineentry.setreadonly.html
-rw-r--r--      7387 2017-03-28 06:05 function.apc-cache-info.html
-rw-r--r--     16382 2017-03-28 06:06 function.cubrid-commit.html
-rw-r--r--      4906 2017-03-28 06:07 function.variant-int.html
-rw-r--r--      7970 2017-03-28 06:06 function.urlencode.html
-rw-r--r--      4269 2017-03-28 06:06 splfileobject.ftell.html
-rw-r--r--      1335 2017-03-28 06:05 readline.resources.html
-rw-r--r--      2566 2017-03-28 06:07 varnishadmin.setcompat.html
-rw-r--r--      5880 2017-03-28 06:06 directoryiterator.isfile.html
-rw-r--r--      6447 2017-03-28 06:06 function.mb-convert-variables.html
-rw-r--r--      2910 2017-03-28 06:06 function.trader-typprice.html
-rw-r--r--      8045 2017-03-28 06:07 function.strstr.html
-rw-r--r--     13309 2017-03-28 06:05 wrappers.ssh2.html
-rw-r--r--     15974 2017-03-28 06:06 class.tokyotyrantiterator.html
-rw-r--r--      4232 2017-03-28 06:06 function.sqlite-valid.html
-rw-r--r--      3071 2017-03-28 06:06 ref.dbase.html
-rw-r--r--      2972 2017-03-28 06:07 solrquery.setfacetdategap.html
-rw-r--r--      3371 2017-03-28 06:06 function.trader-cdlrisefall3methods.html
-rw-r--r--      2033 2017-03-28 06:06 swffont.getleading.html
-rw-r--r--      5312 2017-03-28 06:07 reflectionmethod.getdeclaringclass.html
-rw-r--r--      3037 2017-03-28 06:07 zmqsocket.bind.html
-rw-r--r--     20922 2017-03-28 06:06 function.json-decode.html
-rw-r--r--      2633 2017-03-28 06:06 harupage.closepath.html
-rw-r--r--      1827 2017-03-28 06:06 function.pdf-open-jpeg.html
-rw-r--r--      1569 2017-03-28 06:06 mysqlnd-qc.setup.html
-rw-r--r--      1600 2017-03-28 06:07 migration55.extensions-other.html
-rw-r--r--      5016 2017-03-28 06:07 sam.messages.html
-rw-r--r--      6791 2017-03-28 06:05 function.radius-get-tagged-attr-data.html
-rw-r--r--      7627 2017-03-28 06:06 mongo.tutorial.findone.html
-rw-r--r--      6213 2017-03-28 06:06 function.ingres-field-type.html
-rw-r--r--      3082 2017-03-28 06:06 imagick.setresourcelimit.html
-rw-r--r--      3792 2017-03-28 06:06 cairogradientpattern.getextend.html
-rw-r--r--      7630 2017-03-28 06:06 function.image-type-to-mime-type.html
-rw-r--r--      1335 2017-03-28 06:06 lua.configuration.html
-rw-r--r--      6612 2017-03-28 06:06 class.mongodb-bson-utcdatetime.html
-rw-r--r--      2950 2017-03-28 06:06 eventhttprequest.getinputbuffer.html
-rw-r--r--      3740 2017-03-28 06:06 openssl.certparams.html
-rw-r--r--      2906 2017-03-28 06:06 function.fann-run.html
-rw-r--r--      3179 2017-03-28 06:06 mysqli-driver.embedded-server-start.html
-rw-r--r--      3622 2017-03-28 06:06 function.ftok.html
-rw-r--r--      2194 2017-03-28 06:06 function.pdf-delete-table.html
-rw-r--r--      2533 2017-03-28 06:06 function.pdf-fit-textline.html
-rw-r--r--      7813 2017-03-28 06:06 function.mysql-drop-db.html
-rw-r--r--      6298 2017-03-28 06:07 ref.xmlwriter.html
-rw-r--r--      1655 2017-03-28 06:06 lapack.installation.html
-rw-r--r--     35139 2017-03-28 06:06 book.yaf.html
-rw-r--r--      2197 2017-03-28 06:06 ming.install.html
-rw-r--r--      6946 2017-03-28 06:06 function.pg-copy-from.html
-rw-r--r--      6400 2017-03-28 06:06 mongoclient.setreadpreference.html
-rw-r--r--      3590 2017-03-28 06:06 imagick.getimageartifact.html
-rw-r--r--      2716 2017-03-28 06:07 hwapi.move.html
-rw-r--r--      5120 2017-03-28 06:07 sdo.examples-basic.html
-rw-r--r--      1363 2017-03-28 06:07 varnish.configuration.html
-rw-r--r--      2320 2017-03-28 06:05 function.newt-cursor-off.html
-rw-r--r--      3849 2017-03-28 06:06 function.maxdb-more-results.html
-rw-r--r--      2606 2017-03-28 06:06 function.bson-decode.html
-rw-r--r--      2574 2017-03-28 06:07 solrdocument.offsetunset.html
-rw-r--r--     15364 2017-03-28 06:06 yaf-route-rewrite.construct.html
-rw-r--r--      5529 2017-03-28 06:06 class.mongogridfsfile.html
-rw-r--r--      3971 2017-03-28 06:06 function.expm1.html
-rw-r--r--      6594 2017-03-28 06:06 mongodb-driver-readconcern.getlevel.html
-rw-r--r--      1919 2017-03-28 06:06 intro.haru.html
-rw-r--r--      4741 2017-03-28 06:06 imagick.shaveimage.html
-rw-r--r--      1370 2017-03-28 06:06 vpopmail.configuration.html
-rw-r--r--      1601 2017-03-28 06:07 win32service.setup.html
-rw-r--r--      1414 2017-03-28 06:06 yaml.requirements.html
-rw-r--r--      8955 2017-03-28 06:05 function.wincache-fcache-fileinfo.html
-rw-r--r--      7272 2017-03-28 06:06 function.geoip-region-name-by-code.html
-rw-r--r--      3694 2017-03-28 06:06 cairoimagesurface.getstride.html
-rw-r--r--      7977 2017-03-28 06:06 intlcalendar.setfirstdayofweek.html
-rw-r--r--      3371 2017-03-28 06:07 function.ldap-escape.html
-rw-r--r--      3685 2017-03-28 06:07 function.variant-neg.html
-rw-r--r--      1570 2017-03-28 06:07 net-gopher.setup.html
-rw-r--r--      2872 2017-03-28 06:07 internals2.opcodes.bw-not.html
-rw-r--r--      5115 2017-03-28 06:06 function.imageinterlace.html
-rw-r--r--      3447 2017-03-28 06:06 function.acos.html
-rw-r--r--     10713 2017-03-28 06:06 function.db2-prepare.html
-rw-r--r--      6489 2017-03-28 06:06 function.pg-lo-read.html
-rw-r--r--      3531 2017-03-28 06:07 function.socket-recvmsg.html
-rw-r--r--      4727 2017-03-28 06:05 function.ncurses-color-content.html
-rw-r--r--      1342 2017-03-28 06:05 bcompiler.resources.html
-rw-r--r--     12725 2017-03-28 06:06 collator.setstrength.html
-rw-r--r--      4033 2017-03-28 06:06 class.emptyiterator.html
-rw-r--r--      3400 2017-03-28 06:06 gearmanjob.sendwarning.html
-rw-r--r--      3942 2017-03-28 06:07 function.ldap-modify.html
-rw-r--r--      4459 2017-03-28 06:06 function.fann-create-standard-array.html
-rw-r--r--      7347 2017-03-28 06:05 phar.addfromstring.html
-rw-r--r--     11007 2017-03-28 06:06 function.mssql-field-seek.html
-rw-r--r--      1563 2017-03-28 06:06 datetime.setup.html
-rw-r--r--      3999 2017-03-28 06:07 domnode.c14nfile.html
-rw-r--r--      3843 2017-03-28 06:07 internals2.opcodes.jmp.html
-rw-r--r--      5786 2017-03-28 06:07 regexp.reference.subpatterns.html
-rw-r--r--      5237 2017-03-28 06:05 function.gzuncompress.html
-rw-r--r--      2583 2017-03-28 06:07 com.examples.arrays.html
-rw-r--r--      2704 2017-03-28 06:07 solrdocument.get.html
-rw-r--r--      6357 2017-03-28 06:06 mongodb-driver-writeerror.getcode.html
-rw-r--r--      2706 2017-03-28 06:06 imagick.setimagescene.html
-rw-r--r--      9918 2017-03-28 06:06 tokyotyrantquery.valid.html
-rw-r--r--      5727 2017-03-28 06:06 function.recode-file.html
-rw-r--r--      2654 2017-03-28 06:06 function.odbc-rollback.html
-rw-r--r--      3234 2017-03-28 06:06 function.fann-get-rprop-delta-min.html
-rw-r--r--      7728 2017-03-28 06:06 ref.mysql.html
-rw-r--r--      9138 2017-03-28 06:06 function.pg-update.html
-rw-r--r--      1349 2017-03-28 06:06 cyrus.configuration.html
-rw-r--r--      2546 2017-03-28 06:07 function.ldap-dn2ufn.html
-rw-r--r--      1328 2017-03-28 06:06 openssl.resources.html
-rw-r--r--      6708 2017-03-28 06:07 class.ui-controls-button.html
-rw-r--r--      2404 2017-03-28 06:07 ui-controls-entry.isreadonly.html
-rw-r--r--      3888 2017-03-28 06:06 yaf-response-abstract.clearbody.html
-rw-r--r--      3106 2017-03-28 06:07 stomp.hasframe.html
-rw-r--r--      7610 2017-03-28 06:05 intro-whatcando.html
-rw-r--r--     11286 2017-03-28 06:06 function.eio-open.html
-rw-r--r--      9531 2017-03-28 06:07 function.rtrim.html
-rw-r--r--      6698 2017-03-28 06:07 migration56.changed-functions.html
-rw-r--r--      4347 2017-03-28 06:06 mysqli.init.html
-rw-r--r--      8523 2017-03-28 06:07 internals2.structure.lifecycle.html
-rw-r--r--      2511 2017-03-28 06:07 ref.ctype.html
-rw-r--r--      4443 2017-03-28 06:06 function.msg-set-queue.html
-rw-r--r--      3455 2017-03-28 06:06 function.ibase-affected-rows.html
-rw-r--r--     39800 2017-03-28 06:06 book.cairo.html
-rw-r--r--      2724 2017-03-28 06:07 memcached.installation.html
-rw-r--r--      8312 2017-03-28 06:06 mongodb.getcollectioninfo.html
-rw-r--r--      2755 2017-03-28 06:06 eventhttpconnection.getbase.html
-rw-r--r--      2830 2017-03-28 06:06 gmagick.setimagegamma.html
-rw-r--r--      4282 2017-03-28 06:06 intlcalendar.getminimum.html
-rw-r--r--      5105 2017-03-28 06:07 memcached.getdelayedbykey.html
-rw-r--r--      1495 2017-03-28 06:06 pdo.setup.html
-rw-r--r--      6518 2017-03-28 06:06 function.mysql-get-proto-info.html
-rw-r--r--      4644 2017-03-28 06:06 function.ceil.html
-rw-r--r--      8725 2017-03-28 06:05 phar.buildfromdirectory.html
-rw-r--r--      3773 2017-03-28 06:06 function.fdf-set-version.html
-rw-r--r--     35854 2017-03-28 06:06 function.mb-decode-numericentity.html
-rw-r--r--      7968 2017-03-28 06:06 function.fnmatch.html
-rw-r--r--      3132 2017-03-28 06:05 install.pecl.static.html
-rw-r--r--      8263 2017-03-28 06:07 regexp.reference.repetition.html
-rw-r--r--      5251 2017-03-28 06:06 ref.msql.html
-rw-r--r--      2759 2017-03-28 06:05 throwable.gettraceasstring.html
-rw-r--r--      4340 2017-03-28 06:07 function.gupnp-context-new.html
-rw-r--r--      2614 2017-03-28 06:07 ref.mqseries.html
-rw-r--r--      6545 2017-03-28 06:05 function.mcrypt-get-iv-size.html
-rw-r--r--      3102 2017-03-28 06:06 gmagick.readimageblob.html
-rw-r--r--      2578 2017-03-28 06:07 internals2.opcodes.ext-stmt.html
-rw-r--r--      4564 2017-03-28 06:06 function.iptcparse.html
-rw-r--r--      8965 2017-03-28 06:07 function.wordwrap.html
-rw-r--r--      2661 2017-03-28 06:07 hwapi.user.html
-rw-r--r--      3339 2017-03-28 06:06 imagick.combineimages.html
-rw-r--r--      3391 2017-03-28 06:05 function.mcrypt-enc-is-block-algorithm-mode.html
-rw-r--r--      2767 2017-03-28 06:06 emptyiterator.key.html
-rw-r--r--      4908 2017-03-28 06:06 function.cairo-matrix-transform-point.html
-rw-r--r--      3308 2017-03-28 06:06 function.trader-cdlengulfing.html
-rw-r--r--      6805 2017-03-28 06:05 function.getenv.html
-rw-r--r--      4897 2017-03-28 06:05 security.variables.html
-rw-r--r--      3144 2017-03-28 06:06 imap.requirements.html
-rw-r--r--      4677 2017-03-28 06:06 class.mongowriteconcernexception.html
-rw-r--r--      2505 2017-03-28 06:06 imagickpixel.setindex.html
-rw-r--r--      2290 2017-03-28 06:06 imagick.getimagecompressionquality.html
-rw-r--r--      6502 2017-03-28 06:06 tokyotyrant.putnr.html
-rw-r--r--     20971 2017-03-28 06:06 fann.constants.html
-rw-r--r--      4562 2017-03-28 06:07 reflectionclass.getextensionname.html
-rw-r--r--      7396 2017-03-28 06:07 simplexmlelement.xpath.html
-rw-r--r--      2672 2017-03-28 06:06 yaf-response-abstract.setredirect.html
-rw-r--r--      7972 2017-03-28 06:06 mongodb-driver-cursor.settypemap.html
-rw-r--r--     18852 2017-03-28 06:07 function.ldap-modify-batch.html
-rw-r--r--      2199 2017-03-28 06:05 tag.gettitle.html
-rw-r--r--      8448 2017-03-28 06:07 function.is-scalar.html
-rw-r--r--      5773 2017-03-28 06:07 book.network.html
-rw-r--r--      5888 2017-03-28 06:06 function.log-write-batch.html
-rw-r--r--      4341 2017-03-28 06:05 wincache.installation.html
-rw-r--r--     19460 2017-03-28 06:05 function.ob-start.html
-rw-r--r--      3107 2017-03-28 06:07 ui-executor.setinterval.html
-rw-r--r--      2456 2017-03-28 06:06 curlfile.setpostfilename.html
-rw-r--r--      6177 2017-03-28 06:07 function.headers-list.html
-rw-r--r--      1294 2017-03-28 06:06 msql.requirements.html
-rw-r--r--     20371 2017-03-28 06:06 mongodb-driver-manager.executebulkwrite.html
-rw-r--r--      2390 2017-03-28 06:06 yaf-loader.construct.html
-rw-r--r--      8453 2017-03-28 06:06 function.cubrid-get-client-info.html
-rw-r--r--      3572 2017-03-28 06:06 callbackfilteriterator.accept.html
-rw-r--r--      4807 2017-03-28 06:06 mongodb-bson-regex.getflags.html
-rw-r--r--      2215 2017-03-28 06:05 tag.getartist.html
-rw-r--r--     20977 2017-03-28 06:07 class.ds-map.html
-rw-r--r--      2054 2017-03-28 06:06 pdf.installation.html
-rw-r--r--      3815 2017-03-28 06:06 mysqlnd.plugin.obtaining.html
-rw-r--r--      8467 2017-03-28 06:06 imagick.frameimage.html
-rw-r--r--      2930 2017-03-28 06:06 intlbreakiterator.getpartsiterator.html
-rw-r--r--      2107 2017-03-28 06:07 history.html
-rw-r--r--     10772 2017-03-28 06:05 function.version-compare.html
-rw-r--r--      2074 2017-03-28 06:06 mongodb.setup.html
-rw-r--r--      2012 2017-03-28 06:06 function.date-interval-format.html
-rw-r--r--     10549 2017-03-28 06:06 function.easter-date.html
-rw-r--r--      4080 2017-03-28 06:05 function.main.html
-rw-r--r--      3021 2017-03-28 06:05 function.ncurses-assume-default-colors.html
-rw-r--r--      3085 2017-03-28 06:06 intro.cairo.html
-rw-r--r--      2943 2017-03-28 06:05 function.m-verifysslcert.html
-rw-r--r--      2217 2017-03-28 06:07 ui-size.getheight.html
-rw-r--r--     11983 2017-03-28 06:06 function.mssql-bind.html
-rw-r--r--      4346 2017-03-28 06:07 class.domnamednodemap.html
-rw-r--r--      3258 2017-03-28 06:07 internals2.counter.function.counter-bump.html
-rw-r--r--      4459 2017-03-28 06:07 function.svn-delete.html
-rw-r--r--      5615 2017-03-28 06:06 function.gregoriantojd.html
-rw-r--r--      2918 2017-03-28 06:06 recursivetreeiterator.enditeration.html
-rw-r--r--      1462 2017-03-28 06:05 crack.resources.html
-rw-r--r--      6990 2017-03-28 06:07 function.var-dump.html
-rw-r--r--      3010 2017-03-28 06:06 multipleiterator.next.html
-rw-r--r--      2229 2017-03-28 06:07 ui-window.setmargin.html
-rw-r--r--      2708 2017-03-28 06:06 function.log10.html
-rw-r--r--      8508 2017-03-28 06:06 function.system.html
-rw-r--r--      5098 2017-03-28 06:05 function.bzcompress.html
-rw-r--r--     12891 2017-03-28 06:06 function.sqlsrv-connect.html
-rw-r--r--      3561 2017-03-28 06:05 function.openal-listener-set.html
-rw-r--r--      4188 2017-03-28 06:07 function.apache-child-terminate.html
-rw-r--r--      4493 2017-03-28 06:06 function.openssl-pkey-export.html
-rw-r--r--      6328 2017-03-28 06:06 arrayobject.ksort.html
-rw-r--r--      1916 2017-03-28 06:07 function.socket-getopt.html
-rw-r--r--      9522 2017-03-28 06:07 class.ui-controls-multilineentry.html
-rw-r--r--      1533 2017-03-28 06:05 oggvorbis.requirements.html
-rw-r--r--     10021 2017-03-28 06:07 function.array-intersect-key.html
-rw-r--r--      6405 2017-03-28 06:07 xsltprocessor.transformtoxml.html
-rw-r--r--      9365 2017-03-28 06:06 class.cairopdfsurface.html
-rw-r--r--     22724 2017-03-28 06:06 book.gmagick.html
-rw-r--r--      6079 2017-03-28 06:07 history.php.related.html
-rw-r--r--      3459 2017-03-28 06:07 reflectionfunctionabstract.getextension.html
-rw-r--r--      4139 2017-03-28 06:07 intro.sdo.html
-rw-r--r--     11208 2017-03-28 06:07 filter.examples.validation.html
-rw-r--r--      7647 2017-03-28 06:06 ref.stream.html
-rw-r--r--      9733 2017-03-28 06:06 function.stream-wrapper-register.html
-rw-r--r--      4246 2017-03-28 06:06 yaf-route-interface.route.html
-rw-r--r--      3148 2017-03-28 06:06 gmagick.separateimagechannel.html
-rw-r--r--      7204 2017-03-28 06:06 function.curl-unescape.html
-rw-r--r--      4077 2017-03-28 06:06 gearmanworker.setid.html
-rw-r--r--      4885 2017-03-28 06:06 splfixedarray.getsize.html
-rw-r--r--      7128 2017-03-28 06:06 mysqlnd.plugin.html
-rw-r--r--      3685 2017-03-28 06:07 internals2.opcodes.assign-dim.html
-rw-r--r--      8622 2017-03-28 06:06 function.db2-foreign-keys.html
-rw-r--r--      4480 2017-03-28 06:06 function.cairo-image-surface-get-format.html
-rw-r--r--      5360 2017-03-28 06:06 splfileobject.setmaxlinelen.html
-rw-r--r--      1305 2017-03-28 06:06 gender.examples.html
-rw-r--r--      2497 2017-03-28 06:06 harufont.getascent.html
-rw-r--r--      2805 2017-03-28 06:06 gmagickdraw.setstrokewidth.html
-rw-r--r--      2449 2017-03-28 06:06 gmagick.flipimage.html
-rw-r--r--      5174 2017-03-28 06:06 function.bccomp.html
-rw-r--r--      1795 2017-03-28 06:07 function.ldap-close.html
-rw-r--r--      4626 2017-03-28 06:06 function.cairo-scaled-font-get-font-matrix.html
-rw-r--r--      4052 2017-03-28 06:06 function.sqlite-prev.html
-rw-r--r--      9607 2017-03-28 06:07 solrclient.getbyids.html
-rw-r--r--      8243 2017-03-28 06:06 function.mysql-ping.html
-rw-r--r--      3209 2017-03-28 06:06 gearmanjob.senddata.html
-rw-r--r--      4981 2017-03-28 06:06 image.installation.html
-rw-r--r--     10054 2017-03-28 06:05 functions.user-defined.html
-rw-r--r--      6192 2017-03-28 06:06 mongocollection.createdbref.html
-rw-r--r--      7130 2017-03-28 06:06 intlchar.charname.html
-rw-r--r--      4177 2017-03-28 06:06 harupage.curveto.html
-rw-r--r--      4694 2017-03-28 06:06 cairoimagesurface.getheight.html
-rw-r--r--      4904 2017-03-28 06:06 cairocontext.showpage.html
-rw-r--r--      7740 2017-03-28 06:06 imagick.sigmoidalcontrastimage.html
-rw-r--r--      7183 2017-03-28 06:06 mysqlnduhconnection.txcommit.html
-rw-r--r--      2828 2017-03-28 06:06 gmagick.getimageredprimary.html
-rw-r--r--      1883 2017-03-28 06:06 intro.ifx.html
-rw-r--r--      3335 2017-03-28 06:06 infiniteiterator.next.html
-rw-r--r--      2336 2017-03-28 06:07 ui-draw-path.newfigure.html
-rw-r--r--      5325 2017-03-28 06:07 solrclient.ping.html
-rw-r--r--      2477 2017-03-28 06:06 gmagick.enhanceimage.html
-rw-r--r--      4187 2017-03-28 06:07 ds-deque.reversed.html
-rw-r--r--      1858 2017-03-28 06:06 function.msql-fieldtable.html
-rw-r--r--     14060 2017-03-28 06:06 mysqlnd-qc.constants.html
-rw-r--r--      8768 2017-03-28 06:06 gearmanclient.jobstatus.html
-rw-r--r--      2564 2017-03-28 06:07 varnishadmin.setident.html
-rw-r--r--      8647 2017-03-28 06:06 function.fbsql-query.html
-rw-r--r--      2391 2017-03-28 06:06 yaf-session.construct.html
-rw-r--r--      2027 2017-03-28 06:07 migration51.integer-parameters.html
-rw-r--r--      3048 2017-03-28 06:07 function.yp-all.html
-rw-r--r--      2103 2017-03-28 06:06 function.pdf-closepath-stroke.html
-rw-r--r--      1322 2017-03-28 06:07 classkit.requirements.html
-rw-r--r--      3572 2017-03-28 06:05 mcve.installation.html
-rw-r--r--      1328 2017-03-28 06:07 varnish.resources.html
-rw-r--r--      9583 2017-03-28 06:06 function.maxdb-num-fields.html
-rw-r--r--      5752 2017-03-28 06:07 oauthprovider.tokenhandler.html
-rw-r--r--      1633 2017-03-28 06:07 wddx.installation.html
-rw-r--r--      2313 2017-03-28 06:06 swfmovie.addfont.html
-rw-r--r--      8641 2017-03-28 06:06 mbstring.overload.html
-rw-r--r--      8109 2017-03-28 06:07 reflectionclass.hasmethod.html
-rw-r--r--      2405 2017-03-28 06:06 eventbase.reinit.html
-rw-r--r--      8883 2017-03-28 06:06 mongocursor.setflag.html
-rw-r--r--      3967 2017-03-28 06:06 splenum.getconstlist.html
-rw-r--r--      6037 2017-03-28 06:06 function.escapeshellarg.html
-rw-r--r--      6810 2017-03-28 06:06 function.db2-conn-error.html
-rw-r--r--      4200 2017-03-28 06:06 function.fdf-set-javascript-action.html
-rw-r--r--      4503 2017-03-28 06:06 function.cairo-font-options-get-antialias.html
-rw-r--r--      4017 2017-03-28 06:06 function.msql-list-tables.html
-rw-r--r--      2492 2017-03-28 06:06 function.trader-sinh.html
-rw-r--r--     16177 2017-03-28 06:07 migration55.new-features.html
-rw-r--r--      2102 2017-03-28 06:06 function.trader-errno.html
-rw-r--r--      4398 2017-03-28 06:06 function.imap-timeout.html
-rw-r--r--      3290 2017-03-28 06:07 solrobject.construct.html
-rw-r--r--      2956 2017-03-28 06:06 function.fann-length-train-data.html
-rw-r--r--      2185 2017-03-28 06:07 ui-controls-spin.getvalue.html
-rw-r--r--      1342 2017-03-28 06:06 judy.configuration.html
-rw-r--r--      4541 2017-03-28 06:06 intl.examples.basic.html
-rw-r--r--      3860 2017-03-28 06:06 mongo.context.html
-rw-r--r--      2683 2017-03-28 06:06 function.trader-tema.html
-rw-r--r--      7022 2017-03-28 06:05 function.wincache-rplist-meminfo.html
-rw-r--r--      4390 2017-03-28 06:06 function.cairo-pattern-get-rgba.html
-rw-r--r--      3358 2017-03-28 06:07 function.yaz-schema.html
-rw-r--r--      2765 2017-03-28 06:07 solrquery.getfacetdateend.html
-rw-r--r--      2223 2017-03-28 06:06 curlfile.getmimetype.html
-rw-r--r--      2554 2017-03-28 06:06 yaf-application.getappdirectory.html
-rw-r--r--      2901 2017-03-28 06:06 arrayiterator.getflags.html
-rw-r--r--      2640 2017-03-28 06:07 reference.pcre.pattern.syntax.html
-rw-r--r--      6794 2017-03-28 06:06 class.mongodb-driver-exception-runtimeexception.html
-rw-r--r--     10110 2017-03-28 06:06 mysqlnduhconnection.setserveroption.html
-rw-r--r--      1365 2017-03-28 06:07 funchand.installation.html
-rw-r--r--      1697 2017-03-28 06:06 mysqli.requirements.html
-rw-r--r--      7578 2017-03-28 06:05 control-structures.elseif.html
-rw-r--r--      7903 2017-03-28 06:06 function.gmdate.html
-rw-r--r--      9178 2017-03-28 06:07 domimplementation.createdocumenttype.html
-rw-r--r--      2857 2017-03-28 06:07 solrquery.getfacetmincount.html
-rw-r--r--      6314 2017-03-28 06:06 function.ftp-size.html
-rw-r--r--      6244 2017-03-28 06:07 class.ui-exception-invalidargumentexception.html
-rw-r--r--      2948 2017-03-28 06:07 function.filter-has-var.html
-rw-r--r--      6814 2017-03-28 06:06 gnupg.examples-clearsign.html
-rw-r--r--      2468 2017-03-28 06:06 gearmantask.isknown.html
-rw-r--r--      5662 2017-03-28 06:06 function.db2-close.html
-rw-r--r--      1774 2017-03-28 06:06 ref.parsekit.html
-rw-r--r--      1496 2017-03-28 06:06 eio.setup.html
-rw-r--r--      9340 2017-03-28 06:06 intldateformatter.geterrormessage.html
-rw-r--r--      5774 2017-03-28 06:06 function.mb-strpos.html
-rw-r--r--      6373 2017-03-28 06:06 tokyotyrant.putshl.html
-rw-r--r--      1289 2017-03-28 06:07 ldap.examples.html
-rw-r--r--      3991 2017-03-28 06:07 domelement.setattributenode.html
-rw-r--r--      2388 2017-03-28 06:05 function.ncurses-werase.html
-rw-r--r--      3975 2017-03-28 06:06 cairosvgsurface.versiontostring.html
-rw-r--r--      6898 2017-03-28 06:06 arrayobject.getiteratorclass.html
-rw-r--r--      2599 2017-03-28 06:05 ziparchive.getstatusstring.html
-rw-r--r--      1531 2017-03-28 06:07 xmlrpc.setup.html
-rw-r--r--      5902 2017-03-28 06:06 book.gmp.html
-rw-r--r--      5211 2017-03-28 06:07 samconnection.errno.html
-rw-r--r--      6737 2017-03-28 06:06 tidynode.isasp.html
-rw-r--r--      1295 2017-03-28 06:06 proctitle.requirements.html
-rw-r--r--      3391 2017-03-28 06:07 reflectionproperty.isprotected.html
-rw-r--r--      4980 2017-03-28 06:07 ds-set.merge.html
-rw-r--r--      2614 2017-03-28 06:06 filteriterator.valid.html
-rw-r--r--      5579 2017-03-28 06:06 arrayobject.count.html
-rw-r--r--      1349 2017-03-28 06:07 net-gopher.resources.html
-rw-r--r--      7235 2017-03-28 06:06 function.cubrid-num-rows.html
-rw-r--r--      2647 2017-03-28 06:06 evwatcher.start.html
-rw-r--r--     20368 2017-03-28 06:06 function.oci-close.html
-rw-r--r--     13104 2017-03-28 06:06 json.constants.html
-rw-r--r--      8067 2017-03-28 06:07 class.solrillegalargumentexception.html
-rw-r--r--      2784 2017-03-28 06:06 swfbitmap.getheight.html
-rw-r--r--      2926 2017-03-28 06:06 gearmantask.tasknumerator.html
-rw-r--r--      2631 2017-03-28 06:05 iterator.key.html
-rw-r--r--      6979 2017-03-28 06:06 tokyotyrantiterator.construct.html
-rw-r--r--      2711 2017-03-28 06:06 gearmanjob.workloadsize.html
-rw-r--r--      4209 2017-03-28 06:07 function.get-declared-interfaces.html
-rw-r--r--      4265 2017-03-28 06:06 function.dio-stat.html
-rw-r--r--     11171 2017-03-28 06:06 numberformatter.setsymbol.html
-rw-r--r--      2464 2017-03-28 06:06 function.vpopmail-del-domain-ex.html
-rw-r--r--     32566 2017-03-28 06:06 mongocollection.aggregate.html
-rw-r--r--      2946 2017-03-28 06:06 gmagick.queryformats.html
-rw-r--r--      1562 2017-03-28 06:07 xmlreader.setup.html
-rw-r--r--      2871 2017-03-28 06:07 book.session-pgsql.html
-rw-r--r--      2226 2017-03-28 06:06 function.pdf-create-fieldgroup.html
-rw-r--r--      9158 2017-03-28 06:06 book.mbstring.html
-rw-r--r--      5911 2017-03-28 06:06 function.gnupg-encrypt.html
-rw-r--r--      2156 2017-03-28 06:06 imagick.getcompression.html
-rw-r--r--      1715 2017-03-28 06:07 com.installation.html
-rw-r--r--      3396 2017-03-28 06:06 function.mailparse-msg-parse-file.html
-rw-r--r--      3149 2017-03-28 06:06 mongocommandcursor.next.html
-rw-r--r--      2765 2017-03-28 06:06 gmagickdraw.setfillopacity.html
-rw-r--r--      2096 2017-03-28 06:07 function.ui-draw-text-font-fontfamilies.html
-rw-r--r--      5587 2017-03-28 06:06 function.gmp-strval.html
-rw-r--r--      3480 2017-03-28 06:06 function.ps-stroke.html
-rw-r--r--      3739 2017-03-28 06:06 function.trader-stochrsi.html
-rw-r--r--      2311 2017-03-28 06:07 solrobject.destruct.html
-rw-r--r--      7495 2017-03-28 06:05 function.kadm5-init-with-password.html
-rw-r--r--      3134 2017-03-28 06:06 evstat.prev.html
-rw-r--r--     28892 2017-03-28 06:06 function.db2-exec.html
-rw-r--r--      1567 2017-03-28 06:07 memcached.setup.html
-rw-r--r--      3455 2017-03-28 06:05 features.dtrace.introduction.html
-rw-r--r--      3739 2017-03-28 06:07 domelement.hasattribute.html
-rw-r--r--      8279 2017-03-28 06:06 locale.filtermatches.html
-rw-r--r--      1435 2017-03-28 06:07 internals2.counter.resources.html
-rw-r--r--      9279 2017-03-28 06:07 domdocument.savexml.html
-rw-r--r--      4025 2017-03-28 06:05 error.getmessage.html
-rw-r--r--      1205 2017-03-28 06:05 lzf.constants.html
-rw-r--r--      1582 2017-03-28 06:05 language.basic-syntax.html
-rw-r--r--      2705 2017-03-28 06:06 gmagick.getimagefilename.html
-rw-r--r--      8440 2017-03-28 06:07 class.soapfault.html
-rw-r--r--      5785 2017-03-28 06:05 wrappers.data.html
-rw-r--r--      4978 2017-03-28 06:06 mongoregex.construct.html
-rw-r--r--      2357 2017-03-28 06:07 ui-controls-check.construct.html
-rw-r--r--     10118 2017-03-28 06:05 pharfileinfo.setcompressedgz.html
-rw-r--r--      3104 2017-03-28 06:07 solrdocument.haschilddocuments.html
-rw-r--r--      2695 2017-03-28 06:06 swfaction.construct.html
-rw-r--r--      7743 2017-03-28 06:05 pharfileinfo.delmetadata.html
-rw-r--r--      7925 2017-03-28 06:07 sdo-das-relational.executequery.html
-rw-r--r--      1714 2017-03-28 06:05 oggvorbis.installation.html
-rw-r--r--      2716 2017-03-28 06:07 intro.filter.html
-rw-r--r--      3522 2017-03-28 06:06 tokyotyrantiterator.next.html
-rw-r--r--      3891 2017-03-28 06:06 mysqlnd.install.html
-rw-r--r--      2746 2017-03-28 06:05 function.ncurses-slk-color.html
-rw-r--r--      8288 2017-03-28 06:06 imagick.queryformats.html
-rw-r--r--      3843 2017-03-28 06:07 sca.createdataobject.html
-rw-r--r--      3045 2017-03-28 06:06 function.ps-include-file.html
-rw-r--r--      1939 2017-03-28 06:06 function.pdf-set-horiz-scaling.html
-rw-r--r--      2308 2017-03-28 06:07 ui-controls-grid.setpadded.html
-rw-r--r--      8479 2017-03-28 06:06 function.msql-fetch-object.html
-rw-r--r--      3312 2017-03-28 06:05 error.construct.html
-rw-r--r--      2611 2017-03-28 06:06 yaf-request-abstract.isoptions.html
-rw-r--r--      2440 2017-03-28 06:07 svmmodel.getsvrprobability.html
-rw-r--r--      2743 2017-03-28 06:06 judy.next.html
-rw-r--r--      2965 2017-03-28 06:06 fannconnection.construct.html
-rw-r--r--      2774 2017-03-28 06:06 function.vpopmail-add-domain.html
-rw-r--r--      7664 2017-03-28 06:07 quickhashintstringhash.loadfromstring.html
-rw-r--r--      2685 2017-03-28 06:06 function.ming-setscale.html
-rw-r--r--      3049 2017-03-28 06:06 function.ps-setoverprintmode.html
-rw-r--r--      4034 2017-03-28 06:06 class.mongoint32.html
-rw-r--r--      2229 2017-03-28 06:06 function.pdf-add-thumbnail.html
-rw-r--r--      3847 2017-03-28 06:06 function.fann-scale-input.html
-rw-r--r--      2264 2017-03-28 06:06 function.pdf-create-action.html
-rw-r--r--     16783 2017-03-28 06:07 class.reflectionfunction.html
-rw-r--r--      5041 2017-03-28 06:06 splfileobject.getcsvcontrol.html
-rw-r--r--      9224 2017-03-28 06:05 language.operators.assignment.html
-rw-r--r--      3690 2017-03-28 06:06 haruencoder.getbytetype.html
-rw-r--r--      4694 2017-03-28 06:07 function.str-repeat.html
-rw-r--r--      5453 2017-03-28 06:06 function.pg-untrace.html
-rw-r--r--      1489 2017-03-28 06:05 rar.setup.html
-rw-r--r--      5588 2017-03-28 06:06 directoryiterator.rewind.html
-rw-r--r--      6181 2017-03-28 06:07 memcache.pconnect.html
-rw-r--r--      3224 2017-03-28 06:06 function.stats-cdf-cauchy.html
-rw-r--r--      4736 2017-03-28 06:06 cairocontext.construct.html
-rw-r--r--     12840 2017-03-28 06:06 function.cubrid-lob2-seek64.html
-rw-r--r--      2756 2017-03-28 06:07 zmqdevice.setidletimeout.html
-rw-r--r--      2271 2017-03-28 06:07 function.msession-get.html
-rw-r--r--      2650 2017-03-28 06:07 book.bbcode.html
-rw-r--r--      3207 2017-03-28 06:07 function.ssdeep-fuzzy-compare.html
-rw-r--r--      5795 2017-03-28 06:06 function.eio-poll.html
-rw-r--r--      2616 2017-03-28 06:06 yaf-session.offsetunset.html
-rw-r--r--      4728 2017-03-28 06:06 function.cairo-ps-surface-dsc-comment.html
-rw-r--r--      2710 2017-03-28 06:06 sqlite3.busytimeout.html
-rw-r--r--      2430 2017-03-28 06:07 varnishadmin.getpanic.html
-rw-r--r--      5626 2017-03-28 06:07 ds-vector.find.html
-rw-r--r--      1954 2017-03-28 06:06 function.pdf-set-leading.html
-rw-r--r--      2758 2017-03-28 06:07 oauth.setsslchecks.html
-rw-r--r--      1715 2017-03-28 06:07 migration53.new-stream-filters.html
-rw-r--r--      8560 2017-03-28 06:06 function.mysql-db-name.html
-rw-r--r--      4819 2017-03-28 06:06 gearmanclient.setwarningcallback.html
-rw-r--r--     10886 2017-03-28 06:06 function.sqlsrv-cancel.html
-rw-r--r--     22619 2017-03-28 06:06 ref.fann.html
-rw-r--r--      3682 2017-03-28 06:06 imagick.contraststretchimage.html
-rw-r--r--     10362 2017-03-28 06:06 function.cubrid-fetch.html
-rw-r--r--      6496 2017-03-28 06:06 function.pg-get-notify.html
-rw-r--r--      3278 2017-03-28 06:06 function.trader-cdlkicking.html
-rw-r--r--      5063 2017-03-28 06:06 function.gmp-sign.html
-rw-r--r--      3642 2017-03-28 06:06 msql.configuration.html
-rw-r--r--      7903 2017-03-28 06:07 function.svn-commit.html
-rw-r--r--      7778 2017-03-28 06:06 function.ingres-fetch-object.html
-rw-r--r--      3608 2017-03-28 06:06 cairosurface.getcontent.html
-rw-r--r--      7833 2017-03-28 06:07 class.ui-draw-color.html
-rw-r--r--      8747 2017-03-28 06:06 class.mongoid.html
-rw-r--r--      5005 2017-03-28 06:06 cairocontext.getfontmatrix.html
-rw-r--r--      2981 2017-03-28 06:05 function.ncurses-mvinch.html
-rw-r--r--      2537 2017-03-28 06:06 function.ibase-errcode.html
-rw-r--r--      8601 2017-03-28 06:07 network.constants.html
-rw-r--r--      3165 2017-03-28 06:06 mysqlnduhconnection.shutdownserver.html
-rw-r--r--      3958 2017-03-28 06:06 function.imap-undelete.html
-rw-r--r--      3232 2017-03-28 06:07 function.udm-clear-search-limits.html
-rw-r--r--      3239 2017-03-28 06:06 function.trader-cdlhangingman.html
-rw-r--r--      6659 2017-03-28 06:06 tokyotyrantquery.hint.html
-rw-r--r--      5269 2017-03-28 06:06 function.fdf-add-doc-javascript.html
-rw-r--r--      8851 2017-03-28 06:07 simplexmlelement.getdocnamespaces.html
-rw-r--r--      3097 2017-03-28 06:07 solrdocument.merge.html
-rw-r--r--     16121 2017-03-28 06:05 language.operators.type.html
-rw-r--r--     13721 2017-03-28 06:07 simplexmlelement.children.html
-rw-r--r--      2736 2017-03-28 06:07 xsltprocessor.getsecurityprefs.html
-rw-r--r--      1332 2017-03-28 06:06 ming.configuration.html
-rw-r--r--     16009 2017-03-28 06:06 function.ingres-connect.html
-rw-r--r--      2962 2017-03-28 06:06 gmagick.setfilename.html
-rw-r--r--     23274 2017-03-28 06:06 book.fann.html
-rw-r--r--      8568 2017-03-28 06:07 ds-map.sorted.html
-rw-r--r--     16748 2017-03-28 06:06 function.ingres-unbuffered-query.html
-rw-r--r--      3039 2017-03-28 06:07 zmqsocket.recvmulti.html
-rw-r--r--      4929 2017-03-28 06:06 function.mb-strlen.html
-rw-r--r--      2592 2017-03-28 06:06 yaf-request-abstract.ishead.html
-rw-r--r--      4731 2017-03-28 06:06 ref.gnupg.html
-rw-r--r--      5532 2017-03-28 06:07 book.simplexml.html
-rw-r--r--      8437 2017-03-28 06:06 locale.getdisplaylanguage.html
-rw-r--r--      5601 2017-03-28 06:06 function.gnupg-setarmor.html
-rw-r--r--      7940 2017-03-28 06:07 class.solrclientexception.html
-rw-r--r--      2399 2017-03-28 06:07 ui-controls-radio.setselected.html
-rw-r--r--      2398 2017-03-28 06:07 solrpingresponse.destruct.html
-rw-r--r--      2364 2017-03-28 06:06 function.pdf-show-xy.html
-rw-r--r--      9002 2017-03-28 06:06 ming.examples.swfsprite-basic.html
-rw-r--r--      1843 2017-03-28 06:06 book.mime-magic.html
-rw-r--r--      1748 2017-03-28 06:05 intro.mcrypt.html
-rw-r--r--      7844 2017-03-28 06:07 stomp.construct.html
-rw-r--r--      2789 2017-03-28 06:06 function.ibase-free-result.html
-rw-r--r--      3305 2017-03-28 06:05 phardata.setalias.html
-rw-r--r--      5252 2017-03-28 06:07 migration70.changed-functions.html
-rw-r--r--      2671 2017-03-28 06:07 intro.sockets.html
-rw-r--r--      1470 2017-03-28 06:07 session.examples.html
-rw-r--r--      4951 2017-03-28 06:07 quickhashstringinthash.construct.html
-rw-r--r--      4462 2017-03-28 06:06 function.geoip-domain-by-name.html
-rw-r--r--      2735 2017-03-28 06:06 gmagickdraw.setfont.html
-rw-r--r--      6044 2017-03-28 06:06 intro.image.html
-rw-r--r--      3107 2017-03-28 06:07 about.howtohelp.html
-rw-r--r--      2885 2017-03-28 06:06 yaf-request-abstract.setcontrollername.html
-rw-r--r--      6192 2017-03-28 06:06 class.globiterator.html
-rw-r--r--      2498 2017-03-28 06:06 function.trader-cosh.html
-rw-r--r--      3408 2017-03-28 06:07 reflectionparameter.isdefaultvalueavailable.html
-rw-r--r--      7868 2017-03-28 06:05 phardata.extractto.html
-rw-r--r--      1824 2017-03-28 06:05 function.user-error.html
-rw-r--r--     12620 2017-03-28 06:07 class.ui-window.html
-rw-r--r--      1416 2017-03-28 06:07 ref.solr.html
-rw-r--r--      3121 2017-03-28 06:07 function.snmp-set-oid-numeric-print.html
-rw-r--r--      6723 2017-03-28 06:06 tidynode.istext.html
-rw-r--r--      2852 2017-03-28 06:07 migration56.html
-rw-r--r--      3076 2017-03-28 06:07 solrquery.setfacetoffset.html
-rw-r--r--      2477 2017-03-28 06:07 varnishadmin.disconnect.html
-rw-r--r--      8364 2017-03-28 06:06 imagick.transformimagecolorspace.html
-rw-r--r--      3028 2017-03-28 06:06 imagick.setimageindex.html
-rw-r--r--     11068 2017-03-28 06:06 function.ifx-query.html
-rw-r--r--      5473 2017-03-28 06:06 tokyo-tyrant.installation.html
-rw-r--r--      9228 2017-03-28 06:06 imagick.setimageclipmask.html
-rw-r--r--      3140 2017-03-28 06:07 function.svn-mkdir.html
-rw-r--r--      3302 2017-03-28 06:06 function.stats-dens-pmf-hypergeometric.html
-rw-r--r--      3635 2017-03-28 06:06 function.fann-num-output-train-data.html
-rw-r--r--      7191 2017-03-28 06:06 function.sqlite-changes.html
-rw-r--r--      2712 2017-03-28 06:06 hrtime-stopwatch.getlastelapsedticks.html
-rw-r--r--      3688 2017-03-28 06:07 oauthprovider.calltimestampnoncehandler.html
-rw-r--r--      6633 2017-03-28 06:06 function.posix-access.html
-rw-r--r--      4165 2017-03-28 06:07 zookeeper.construct.html
-rw-r--r--      2106 2017-03-28 06:06 function.pdf-delete.html
-rw-r--r--      3302 2017-03-28 06:06 function.ps-get-buffer.html
-rw-r--r--      3066 2017-03-28 06:06 swfbutton.sethit.html
-rw-r--r--      2577 2017-03-28 06:06 datetimeimmutable.setdate.html
-rw-r--r--      3567 2017-03-28 06:07 function.getservbyport.html
-rw-r--r--      3459 2017-03-28 06:05 install.fpm.html
-rw-r--r--      5304 2017-03-28 06:07 function.inet-pton.html
-rw-r--r--      3727 2017-03-28 06:07 internals2.opcodes.do-fcall-by-name.html
-rw-r--r--      4332 2017-03-28 06:06 worker.unstack.html
-rw-r--r--      5248 2017-03-28 06:07 domnode.replacechild.html
-rw-r--r--      2854 2017-03-28 06:07 hwapi.object-remove.html
-rw-r--r--      3315 2017-03-28 06:07 reflectionfunctionabstract.getdoccomment.html
-rw-r--r--      4877 2017-03-28 06:06 function.fdf-open-string.html
-rw-r--r--      6202 2017-03-28 06:06 splfixedarray.fromarray.html
-rw-r--r--      3465 2017-03-28 06:07 internals2.opcodes.jmpnz-ex.html
-rw-r--r--      3395 2017-03-28 06:06 function.dbplus-sql.html
-rw-r--r--      4339 2017-03-28 06:06 function.posix-times.html
-rw-r--r--      6097 2017-03-28 06:06 function.rmdir.html
-rw-r--r--      1568 2017-03-28 06:05 oggvorbis.setup.html
-rw-r--r--      1957 2017-03-28 06:06 mysqlnd-mux.requirements.html
-rw-r--r--      7194 2017-03-28 06:06 mysqlnduhconnection.txrollback.html
-rw-r--r--      1398 2017-03-28 06:07 memcache.resources.html
-rw-r--r--      1605 2017-03-28 06:07 migration53.undeprecated.html
-rw-r--r--     29584 2017-03-28 06:06 eio.examples.html
-rw-r--r--      1451 2017-03-28 06:07 memcached.callbacks.html
-rw-r--r--      8059 2017-03-28 06:06 function.mb-detect-order.html
-rw-r--r--      4755 2017-03-28 06:06 function.cairo-ps-surface-restrict-to-level.html
-rw-r--r--      4067 2017-03-28 06:06 function.inotify-add-watch.html
-rw-r--r--      2681 2017-03-28 06:06 gmagick.getimagecolors.html
-rw-r--r--      3733 2017-03-28 06:06 function.ps-moveto.html
-rw-r--r--      2899 2017-03-28 06:06 harudoc.output.html
-rw-r--r--      4200 2017-03-28 06:06 function.fbsql-change-user.html
-rw-r--r--      8320 2017-03-28 06:06 ref.ibm-db2.html
-rw-r--r--      3986 2017-03-28 06:06 function.tidy-save-config.html
-rw-r--r--      1304 2017-03-28 06:06 spl-types.resources.html
-rw-r--r--      2741 2017-03-28 06:06 function.trader-maxindex.html
-rw-r--r--      3118 2017-03-28 06:07 solrdocument.getchilddocuments.html
-rw-r--r--      3328 2017-03-28 06:06 function.fann-get-sarprop-weight-decay-shift.html
-rw-r--r--      1300 2017-03-28 06:05 apc.resources.html
-rw-r--r--      2607 2017-03-28 06:06 v8jsexception.getjslinenumber.html
-rw-r--r--      2605 2017-03-28 06:06 yaf-config-ini.get.html
-rw-r--r--      2597 2017-03-28 06:06 imagick.getimageredprimary.html
-rw-r--r--      4082 2017-03-28 06:06 mongodb.setslaveokay.html
-rw-r--r--      4371 2017-03-28 06:07 internals2.buildsys.skeleton.html
-rw-r--r--      3665 2017-03-28 06:06 ibm-db2.installation.html
-rw-r--r--      3625 2017-03-28 06:06 mysqlnd-ms.rwsplit.html
-rw-r--r--      4154 2017-03-28 06:06 thread.join.html
-rw-r--r--      2671 2017-03-28 06:06 function.trader-dema.html
-rw-r--r--      6601 2017-03-28 06:06 function.ftp-pasv.html
-rw-r--r--     12652 2017-03-28 06:05 phar.compressfiles.html
-rw-r--r--      4099 2017-03-28 06:06 function.mailparse-msg-extract-whole-part-file.html
-rw-r--r--      4703 2017-03-28 06:06 imagick.edgeimage.html
-rw-r--r--      1796 2017-03-28 06:05 constants.newt.args-flags.html
-rw-r--r--      4965 2017-03-28 06:06 splfileinfo.getpath.html
-rw-r--r--      2897 2017-03-28 06:06 function.fam-open.html
-rw-r--r--      6243 2017-03-28 06:06 imagick.adaptivethresholdimage.html
-rw-r--r--      3306 2017-03-28 06:07 internals2.opcodes.add-char.html
-rw-r--r--      7471 2017-03-28 06:06 mongodb-driver-writeconcernerror.getinfo.html
-rw-r--r--      2464 2017-03-28 06:06 harupage.endtext.html
-rw-r--r--      3851 2017-03-28 06:07 function.xmlrpc-is-fault.html
-rw-r--r--      9867 2017-03-28 06:07 function.ctype-digit.html
-rw-r--r--      3539 2017-03-28 06:07 function.gupnp-context-get-subscription-timeout.html
-rw-r--r--      4308 2017-03-28 06:06 function.cairo-font-face-get-type.html
-rw-r--r--      4250 2017-03-28 06:06 function.curl-multi-remove-handle.html
-rw-r--r--      3069 2017-03-28 06:06 function.pg-connect-poll.html
-rw-r--r--      7562 2017-03-28 06:06 function.iconv-mime-decode.html
-rw-r--r--     17323 2017-03-28 06:06 function.imagegif.html
-rw-r--r--      1468 2017-03-28 06:07 bbcode.resources.html
-rw-r--r--     21923 2017-03-28 06:07 class.sphinxclient.html
-rw-r--r--      7672 2017-03-28 06:06 cairocontext.copypathflat.html
-rw-r--r--      4920 2017-03-28 06:05 book.runkit.html
-rw-r--r--      5782 2017-03-28 06:07 ds-sequence.map.html
-rw-r--r--      8376 2017-03-28 06:06 mysqlnd-uh.quickstart.query-monitoring.html
-rw-r--r--      2985 2017-03-28 06:06 yaf-route-regex.route.html
-rw-r--r--      4529 2017-03-28 06:06 imagick.identifyformat.html
-rw-r--r--      2284 2017-03-28 06:07 function.msession-create.html
-rw-r--r--      5706 2017-03-28 06:07 solrquery.setgrouplimit.html
-rw-r--r--    170815 2017-03-28 06:07 resource.html
-rw-r--r--      2242 2017-03-28 06:05 intro.radius.html
-rw-r--r--      2937 2017-03-28 06:07 zmqcontext.getopt.html
-rw-r--r--      6749 2017-03-28 06:07 internals2.opcodes.case.html
-rw-r--r--     25129 2017-03-28 06:06 mongo.writeconcerns.html
-rw-r--r--      2386 2017-03-28 06:07 solrqueryresponse.destruct.html
-rw-r--r--      3620 2017-03-28 06:06 function.trader-cdleveningdojistar.html
-rw-r--r--      5466 2017-03-28 06:07 zookeeper.exists.html
-rw-r--r--      7918 2017-03-28 06:05 function.ncurses-init-pair.html
-rw-r--r--      2521 2017-03-28 06:06 yaf-config-abstract.toarray.html
-rw-r--r--      9033 2017-03-28 06:07 internals2.counter.examples.extended.html
-rw-r--r--     10771 2017-03-28 06:06 numberformatter.getsymbol.html
-rw-r--r--      2992 2017-03-28 06:07 class.rrdupdater.html
-rw-r--r--      2607 2017-03-28 06:06 judy.last.html
-rw-r--r--      6573 2017-03-28 06:06 function.mysqlnd-ms-xa-gc.html
-rw-r--r--      5066 2017-03-28 06:07 function.apache-getenv.html
-rw-r--r--      2671 2017-03-28 06:06 recursivetreeiterator.next.html
-rw-r--r--      6161 2017-03-28 06:07 simplexmliterator.getchildren.html
-rw-r--r--      6069 2017-03-28 06:06 class.runtimeexception.html
-rw-r--r--      2578 2017-03-28 06:05 kadm5.installation.html
-rw-r--r--      3753 2017-03-28 06:05 language.operators.html
-rw-r--r--      7905 2017-03-28 06:06 function.cubrid-lob-export.html
-rw-r--r--      3144 2017-03-28 06:06 gmagick.charcoalimage.html
-rw-r--r--      8906 2017-03-28 06:07 function.yaz-connect.html
-rw-r--r--      1836 2017-03-28 06:06 ingres.resources.html
-rw-r--r--     12850 2017-03-28 06:06 class.cairopssurface.html
-rw-r--r--     10050 2017-03-28 06:06 mysqlnduhconnection.listfields.html
-rw-r--r--      4317 2017-03-28 06:07 ref.snmp.html
-rw-r--r--      1535 2017-03-28 06:05 memtrack.setup.html
-rw-r--r--      2401 2017-03-28 06:07 hwapi.error-count.html
-rw-r--r--      3189 2017-03-28 06:06 function.ps-show2.html
-rw-r--r--     18806 2017-03-28 06:06 class.mongocursorexception.html
-rw-r--r--      2696 2017-03-28 06:05 weakmap.offsetget.html
-rw-r--r--      3925 2017-03-28 06:06 swftextfield.setcolor.html
-rw-r--r--      8706 2017-03-28 06:06 odbc.configuration.html
-rw-r--r--      2467 2017-03-28 06:07 zmqsocket.getpersistentid.html
-rw-r--r--      3253 2017-03-28 06:06 function.dbplus-close.html
-rw-r--r--      4014 2017-03-28 06:06 streamwrapper.stream-eof.html
-rw-r--r--      2228 2017-03-28 06:06 mongodb.--tostring.html
-rw-r--r--      3215 2017-03-28 06:06 eventbufferevent.write.html
-rw-r--r--      2826 2017-03-28 06:05 function.ncurses-slk-attron.html
-rw-r--r--     20809 2017-03-28 06:07 function.preg-match.html
-rw-r--r--      4282 2017-03-28 06:06 function.mb-preferred-mime-name.html
-rw-r--r--      3779 2017-03-28 06:06 mongodb-bson-utcdatetime.serialize.html
-rw-r--r--     10978 2017-03-28 06:06 recursiveregexiterator.construct.html
-rw-r--r--      6753 2017-03-28 06:06 tidynode.iscomment.html
-rw-r--r--      6547 2017-03-28 06:06 function.xattr-list.html
-rw-r--r--      3055 2017-03-28 06:06 function.stats-dens-normal.html
-rw-r--r--      2940 2017-03-28 06:07 solrquery.addmltqueryfield.html
-rw-r--r--      3241 2017-03-28 06:06 function.trader-cdldojistar.html
-rw-r--r--      1308 2017-03-28 06:07 bbcode.requirements.html
-rw-r--r--      9385 2017-03-28 06:06 sybase.configuration.html
-rw-r--r--      2360 2017-03-28 06:07 solrquery.getquery.html
-rw-r--r--      6695 2017-03-28 06:06 function.mb-strimwidth.html
-rw-r--r--      1342 2017-03-28 06:07 solr.configuration.html
-rw-r--r--      7983 2017-03-28 06:06 mysqlnduhconnection.selectdb.html
-rw-r--r--      1322 2017-03-28 06:05 memtrack.requirements.html
-rw-r--r--     19303 2017-03-28 06:06 oci8.installation.html
-rw-r--r--      2787 2017-03-28 06:05 function.ncurses-has-key.html
-rw-r--r--      6513 2017-03-28 06:06 class.mongodb-driver-writeconcern.html
-rw-r--r--      2168 2017-03-28 06:05 tag.getyear.html
-rw-r--r--      3117 2017-03-28 06:06 yaf-application.app.html
-rw-r--r--      6319 2017-03-28 06:07 reflectionfunction.invoke.html
-rw-r--r--      5242 2017-03-28 06:06 ref.pdo-4d.sql4d.html
-rw-r--r--     14864 2017-03-28 06:06 function.fwrite.html
-rw-r--r--      1349 2017-03-28 06:05 outcontrol.resources.html
-rw-r--r--      6770 2017-03-28 06:06 function.copy.html
-rw-r--r--      3135 2017-03-28 06:06 function.trader-bop.html
-rw-r--r--      6439 2017-03-28 06:06 function.passthru.html
-rw-r--r--      2788 2017-03-28 06:06 intlbreakiterator.next.html
-rw-r--r--      3931 2017-03-28 06:06 spldoublylinkedlist.setiteratormode.html
-rw-r--r--     10504 2017-03-28 06:06 function.maxdb-info.html
-rw-r--r--      2600 2017-03-28 06:06 function.pdf-fit-table.html
-rw-r--r--      2206 2017-03-28 06:06 function.pdf-define-layer.html
-rw-r--r--      6433 2017-03-28 06:07 reflectionfunctionabstract.getreturntype.html
-rw-r--r--      5173 2017-03-28 06:05 mcrypt.constants.html
-rw-r--r--      8363 2017-03-28 06:06 appenditerator.key.html
-rw-r--r--      2928 2017-03-28 06:06 haruoutline.setopened.html
-rw-r--r--      3920 2017-03-28 06:06 function.jewishtojd.html
-rw-r--r--      2631 2017-03-28 06:06 intltimezone.getrawoffset.html
-rw-r--r--      1497 2017-03-28 06:05 hash.setup.html
-rw-r--r--      3296 2017-03-28 06:06 harudoc.resetstream.html
-rw-r--r--      5379 2017-03-28 06:06 event.addtimer.html
-rw-r--r--      8095 2017-03-28 06:05 features.gc.collecting-cycles.html
-rw-r--r--      6612 2017-03-28 06:05 class.apcuiterator.html
-rw-r--r--      3165 2017-03-28 06:07 oauth.getlastresponseinfo.html
-rw-r--r--      5230 2017-03-28 06:07 solrdismaxquery.setuserfields.html
-rw-r--r--      2676 2017-03-28 06:07 solrquery.gettermsincludeupperbound.html
-rw-r--r--     17283 2017-03-28 06:06 streamwrapper.dir-readdir.html
-rw-r--r--     71295 2017-03-28 06:06 function.oci-fetch-array.html
-rw-r--r--      7453 2017-03-28 06:06 intlchar.totitle.html
-rw-r--r--      4349 2017-03-28 06:06 function.fann-set-output-scaling-params.html
-rw-r--r--      2443 2017-03-28 06:07 ui-window.error.html
-rw-r--r--      8404 2017-03-28 06:06 locale.getdisplayregion.html
-rw-r--r--      2539 2017-03-28 06:07 ui-draw-stroke.setjoin.html
-rw-r--r--      3690 2017-03-28 06:06 function.fann-get-rprop-delta-zero.html
-rw-r--r--      5836 2017-03-28 06:06 function.imagepsextendfont.html
-rw-r--r--      1239 2017-03-28 06:06 shmop.constants.html
-rw-r--r--     17606 2017-03-28 06:06 function.imagefilledarc.html
-rw-r--r--      3272 2017-03-28 06:06 trader.configuration.html
-rw-r--r--      1245 2017-03-28 06:06 stats.constants.html
-rw-r--r--      2487 2017-03-28 06:06 gmagickdraw.getfontstyle.html
-rw-r--r--      5411 2017-03-28 06:06 function.shmop-write.html
-rw-r--r--      4230 2017-03-28 06:07 snmp.geterror.html
-rw-r--r--      2361 2017-03-28 06:05 function.ncurses-getch.html
-rw-r--r--      4201 2017-03-28 06:07 solrdismaxquery.setqueryalt.html
-rw-r--r--      4719 2017-03-28 06:06 cond.signal.html
-rw-r--r--      5376 2017-03-28 06:07 domdocumentfragment.appendxml.html
-rw-r--r--      1684 2017-03-28 06:07 intro.bbcode.html
-rw-r--r--     10094 2017-03-28 06:06 class.evprepare.html
-rw-r--r--      2839 2017-03-28 06:07 solrquery.getfacetoffset.html
-rw-r--r--      2863 2017-03-28 06:05 function.newt-textbox-set-height.html
-rw-r--r--      4780 2017-03-28 06:05 intro.wincache.html
-rw-r--r--      2803 2017-03-28 06:06 function.ibase-gen-id.html
-rw-r--r--      1542 2017-03-28 06:05 ncurses.setup.html
-rw-r--r--     13025 2017-03-28 06:06 function.yaml-emit.html
-rw-r--r--      6570 2017-03-28 06:06 evchild.construct.html
-rw-r--r--      9310 2017-03-28 06:06 mysql.configuration.html
-rw-r--r--     30606 2017-03-28 06:06 pgsql.constants.html
-rw-r--r--      3691 2017-03-28 06:06 function.ibase-close.html
-rw-r--r--      2980 2017-03-28 06:07 internals2.opcodes.mul.html
-rw-r--r--      6183 2017-03-28 06:06 function.imagecreatefromxpm.html
-rw-r--r--      4614 2017-03-28 06:06 globiterator.count.html
-rw-r--r--      3370 2017-03-28 06:07 internals2.counter.function.counter-create.html
-rw-r--r--      4530 2017-03-28 06:06 mongo.tutorial.multi.query.html
-rw-r--r--      2242 2017-03-28 06:06 mysqlnd-ms.changes.html
-rw-r--r--      2140 2017-03-28 06:06 imagick.nextimage.html
-rw-r--r--      3220 2017-03-28 06:06 function.dba-close.html
-rw-r--r--      1288 2017-03-28 06:06 event.resources.html
-rw-r--r--      4330 2017-03-28 06:06 function.cairo-create.html
-rw-r--r--      4829 2017-03-28 06:06 function.pclose.html
-rw-r--r--      2403 2017-03-28 06:06 imagickdraw.getfillopacity.html
-rw-r--r--      3161 2017-03-28 06:06 harupage.gettransmatrix.html
-rw-r--r--      2247 2017-03-28 06:05 function.newt-bell.html
-rw-r--r--      1342 2017-03-28 06:07 sdodasrel.resources.html
-rw-r--r--      2346 2017-03-28 06:06 judy.memoryusage.html
-rw-r--r--      5811 2017-03-28 06:05 function.ob-list-handlers.html
-rw-r--r--      4934 2017-03-28 06:06 function.iconv-set-encoding.html
-rw-r--r--      5734 2017-03-28 06:06 function.cal-info.html
-rw-r--r--      2656 2017-03-28 06:06 imagickdraw.getstrokeantialias.html
-rw-r--r--      9697 2017-03-28 06:07 intro.sca.html
-rw-r--r--      6432 2017-03-28 06:05 function.mcrypt-get-key-size.html
-rw-r--r--      8642 2017-03-28 06:06 intlcalendar.isweekend.html
-rw-r--r--      3535 2017-03-28 06:06 function.fann-set-cascade-max-out-epochs.html
-rw-r--r--      7754 2017-03-28 06:06 imagickpixel.setcolor.html
-rw-r--r--      3395 2017-03-28 06:06 gearmantask.recvdata.html
-rw-r--r--      1470 2017-03-28 06:06 url.setup.html
-rw-r--r--      5016 2017-03-28 06:07 ds-set.diff.html
-rw-r--r--      3983 2017-03-28 06:06 function.ps-show-xy.html
-rw-r--r--      3146 2017-03-28 06:05 throwable.getcode.html
-rw-r--r--      5050 2017-03-28 06:07 ds-deque.merge.html
-rw-r--r--      2626 2017-03-28 06:06 imagick.drawimage.html
-rw-r--r--      1541 2017-03-28 06:06 enchant.setup.html
-rw-r--r--      2520 2017-03-28 06:07 solrinputdocument.toarray.html
-rw-r--r--      2020 2017-03-28 06:06 function.pdf-clip.html
-rw-r--r--      5872 2017-03-28 06:06 pthreads.modifiers.html
-rw-r--r--      2795 2017-03-28 06:06 yaf-view-simple.get.html
-rw-r--r--     10296 2017-03-28 06:06 function.mb-convert-case.html
-rw-r--r--      2066 2017-03-28 06:06 hrtime.installation.html
-rw-r--r--     27715 2017-03-28 06:06 class.evloop.html
-rw-r--r--      1636 2017-03-28 06:06 function.die.html
-rw-r--r--      3192 2017-03-28 06:06 splfixedarray.offsetget.html
-rw-r--r--      6377 2017-03-28 06:07 function.ctype-punct.html
-rw-r--r--      6786 2017-03-28 06:06 class.mongodb-driver-exception-unexpectedvalueexception.html
-rw-r--r--      5633 2017-03-28 06:06 function.pcntl-signal-dispatch.html
-rw-r--r--      5572 2017-03-28 06:06 function.ftp-delete.html
-rw-r--r--      2103 2017-03-28 06:06 function.date-create-immutable-from-format.html
-rw-r--r--      2990 2017-03-28 06:05 function.ncurses-define-key.html
-rw-r--r--      4064 2017-03-28 06:06 function.maxdb-stmt-close-long-data.html
-rw-r--r--      9719 2017-03-28 06:06 function.imagepalettetotruecolor.html
-rw-r--r--      5643 2017-03-28 06:07 function.ucfirst.html
-rw-r--r--      3811 2017-03-28 06:06 function.fann-set-cascade-output-stagnation-epochs.html
-rw-r--r--      5696 2017-03-28 06:06 splfileinfo.setfileclass.html
-rw-r--r--      1335 2017-03-28 06:06 vpopmail.resources.html
-rw-r--r--      1498 2017-03-28 06:05 ref.inclued.html
-rw-r--r--      3250 2017-03-28 06:06 harupage.setmiterlimit.html
-rw-r--r--      2784 2017-03-28 06:07 solrquery.getgroupfields.html
-rw-r--r--      6470 2017-03-28 06:07 gupnp.constants.html
-rw-r--r--      1484 2017-03-28 06:07 sdo.setup.html
-rw-r--r--      4545 2017-03-28 06:06 mongodb-bson-javascript.unserialize.html
-rw-r--r--      8870 2017-03-28 06:06 function.msql-fetch-array.html
-rw-r--r--      1508 2017-03-28 06:07 ldap.resources.html
-rw-r--r--      4372 2017-03-28 06:06 class.outeriterator.html
-rw-r--r--      4739 2017-03-28 06:07 regexp.reference.conditional.html
-rw-r--r--      1898 2017-03-28 06:06 ref.shmop.html
-rw-r--r--      2258 2017-03-28 06:05 weakmap.next.html
-rw-r--r--      2359 2017-03-28 06:05 weakmap.current.html
-rw-r--r--      7016 2017-03-28 06:06 function.ibase-pconnect.html
-rw-r--r--      5299 2017-03-28 06:06 imagick.thresholdimage.html
-rw-r--r--      7223 2017-03-28 06:07 function.snmp3-get.html
-rw-r--r--      5106 2017-03-28 06:07 ds-sequence.remove.html
-rw-r--r--      4335 2017-03-28 06:06 book.gnupg.html
-rw-r--r--      5647 2017-03-28 06:07 quickhashintstringhash.savetofile.html
-rw-r--r--      2662 2017-03-28 06:05 phar.creating.intro.html
-rw-r--r--     11991 2017-03-28 06:06 imagickdraw.composite.html
-rw-r--r--      6213 2017-03-28 06:06 class.cairofonttype.html
-rw-r--r--      6407 2017-03-28 06:06 function.imageaffinematrixconcat.html
-rw-r--r--      4459 2017-03-28 06:05 ref.runkit.html
-rw-r--r--      7693 2017-03-28 06:07 ds-set.sort.html
-rw-r--r--      2194 2017-03-28 06:07 function.iis-get-dir-security.html
-rw-r--r--      2623 2017-03-28 06:07 solrdocument.isset.html
-rw-r--r--      3671 2017-03-28 06:06 function.fann-set-cascade-num-candidate-groups.html
-rw-r--r--     15326 2017-03-28 06:07 reflectionmethod.construct.html
-rw-r--r--      7213 2017-03-28 06:06 calendar.constants.html
-rw-r--r--      4818 2017-03-28 06:06 function.linkinfo.html
-rw-r--r--     10434 2017-03-28 06:07 class.solrcollapsefunction.html
-rw-r--r--      4699 2017-03-28 06:06 function.closedir.html
-rw-r--r--      2925 2017-03-28 06:06 splfileobject.getchildren.html
-rw-r--r--      3778 2017-03-28 06:06 harudoc.setcompressionmode.html
-rw-r--r--      5034 2017-03-28 06:06 class.splint.html
-rw-r--r--      3253 2017-03-28 06:06 function.trader-cdlharami.html
-rw-r--r--      2361 2017-03-28 06:06 mongogridfsfile.getfilename.html
-rw-r--r--      5857 2017-03-28 06:07 function.ssh2-sftp-chmod.html
-rw-r--r--      8176 2017-03-28 06:07 class.variant.html
-rw-r--r--      9385 2017-03-28 06:05 function.php-uname.html
-rw-r--r--      4014 2017-03-28 06:07 oauth.setcapath.html
-rw-r--r--      7437 2017-03-28 06:07 function.ssh2-sftp-lstat.html
-rw-r--r--      9253 2017-03-28 06:07 example.xml-map-tags.html
-rw-r--r--      2074 2017-03-28 06:06 imagick.requirements.html
-rw-r--r--      6623 2017-03-28 06:06 fbsql.constants.html
-rw-r--r--      1551 2017-03-28 06:05 bcompiler.setup.html
-rw-r--r--     13198 2017-03-28 06:06 function.flock.html
-rw-r--r--      2068 2017-03-28 06:07 intro.swish.html
-rw-r--r--      6185 2017-03-28 06:07 function.ctype-xdigit.html
-rw-r--r--      5357 2017-03-28 06:05 function.putenv.html
-rw-r--r--     10495 2017-03-28 06:06 function.eio-symlink.html
-rw-r--r--      2912 2017-03-28 06:06 swfdisplayitem.setmatrix.html
-rw-r--r--      6179 2017-03-28 06:06 function.ps-shading.html
-rw-r--r--      2367 2017-03-28 06:06 ref.url.html
-rw-r--r--      1294 2017-03-28 06:06 misc.requirements.html
-rw-r--r--      1342 2017-03-28 06:07 ssh2.configuration.html
-rw-r--r--      2136 2017-03-28 06:06 function.ocisetprefetch.html
-rw-r--r--      1322 2017-03-28 06:07 classobj.requirements.html
-rw-r--r--     17634 2017-03-28 06:06 book.trader.html
-rw-r--r--      3681 2017-03-28 06:07 internals2.opcodes.is-identical.html
-rw-r--r--      2733 2017-03-28 06:05 function.ncurses-bkgdset.html
-rw-r--r--     17827 2017-03-28 06:06 mysqlnd.plugin.architecture.html
-rw-r--r--      4698 2017-03-28 06:06 filesystemiterator.next.html
-rw-r--r--      2607 2017-03-28 06:06 splheap.insert.html
-rw-r--r--      8290 2017-03-28 06:07 function.stripslashes.html
-rw-r--r--      9836 2017-03-28 06:06 function.idate.html
-rw-r--r--      1808 2017-03-28 06:07 regex.installation.html
-rw-r--r--      2517 2017-03-28 06:06 harupage.eofill.html
-rw-r--r--      1409 2017-03-28 06:07 intro.xsl.html
-rw-r--r--      4457 2017-03-28 06:06 mongodb-bson-binary.unserialize.html
-rw-r--r--      2516 2017-03-28 06:06 swfsprite.startsound.html
-rw-r--r--      3247 2017-03-28 06:06 class.spltype.html
-rw-r--r--      9763 2017-03-28 06:05 runkit.constants.html
-rw-r--r--      1935 2017-03-28 06:07 zmq.requirements.html
-rw-r--r--     14498 2017-03-28 06:06 function.maxdb-stmt-result-metadata.html
-rw-r--r--      7202 2017-03-28 06:07 internals2.opcodes.catch.html
-rw-r--r--      5639 2017-03-28 06:06 function.odbc-specialcolumns.html
-rw-r--r--      1214 2017-03-28 06:06 haru.constants.html
-rw-r--r--     10174 2017-03-28 06:05 pharfileinfo.setuncompressed.html
-rw-r--r--      5232 2017-03-28 06:07 function.svn-cleanup.html
-rw-r--r--      3905 2017-03-28 06:07 function.xml-get-current-byte-index.html
-rw-r--r--      5231 2017-03-28 06:07 memcached.casbykey.html
-rw-r--r--      4675 2017-03-28 06:05 ref.radius.html
-rw-r--r--      9817 2017-03-28 06:06 class.v8jsexception.html
-rw-r--r--      6064 2017-03-28 06:06 function.ftell.html
-rw-r--r--     12901 2017-03-28 06:05 security.database.storage.html
-rw-r--r--      2454 2017-03-28 06:06 imagick.getimagevirtualpixelmethod.html
-rw-r--r--     14764 2017-03-28 06:06 class.spltempfileobject.html
-rw-r--r--      9960 2017-03-28 06:06 book.spl.html
-rw-r--r--      5159 2017-03-28 06:07 zookeeper.setdeterministicconnorder.html
-rw-r--r--      5626 2017-03-28 06:06 function.px-get-info.html
-rw-r--r--      6346 2017-03-28 06:06 limititerator.construct.html
-rw-r--r--      7778 2017-03-28 06:06 tidy.construct.html
-rw-r--r--      2619 2017-03-28 06:06 imagick.getimageindex.html
-rw-r--r--      8333 2017-03-28 06:07 function.array-uintersect-assoc.html
-rw-r--r--      9782 2017-03-28 06:06 function.db2-special-columns.html
-rw-r--r--      1874 2017-03-28 06:07 internals2.opcodes.fetch-unset.html
-rw-r--r--      2827 2017-03-28 06:06 eventlistener.enable.html
-rw-r--r--     12663 2017-03-28 06:06 mongodb-driver-bulkwrite.update.html
-rw-r--r--      6581 2017-03-28 06:06 imagick.orderedposterizeimage.html
-rw-r--r--      1698 2017-03-28 06:05 readline.installation.html
-rw-r--r--      2698 2017-03-28 06:07 migration5.cli-cgi.html
-rw-r--r--      1335 2017-03-28 06:06 spl.configuration.html
-rw-r--r--      3162 2017-03-28 06:06 function.enchant-broker-free.html
-rw-r--r--      4024 2017-03-28 06:06 function.ingres-num-fields.html
-rw-r--r--      3765 2017-03-28 06:05 function.readline-callback-handler-remove.html
-rw-r--r--      2734 2017-03-28 06:06 imagick.removeimageprofile.html
-rw-r--r--      5532 2017-03-28 06:06 function.openssl-pkcs12-read.html
-rw-r--r--      8069 2017-03-28 06:06 function.iconv.html
-rw-r--r--      4241 2017-03-28 06:07 refs.webservice.html
-rw-r--r--      5010 2017-03-28 06:07 function.snmp-set-enum-print.html
-rw-r--r--      5901 2017-03-28 06:06 splfileobject.getflags.html
-rw-r--r--      5752 2017-03-28 06:07 function.snmp2-getnext.html
-rw-r--r--      4940 2017-03-28 06:07 sphinxclient.query.html
-rw-r--r--      3003 2017-03-28 06:06 recursiveiteratoriterator.enditeration.html
-rw-r--r--     12308 2017-03-28 06:06 function.maxdb-fetch-row.html
-rw-r--r--      1531 2017-03-28 06:06 spl.installation.html
-rw-r--r--     39608 2017-03-28 06:06 function.db2-connect.html
-rw-r--r--      6151 2017-03-28 06:07 function.socket-create-listen.html
-rw-r--r--      3416 2017-03-28 06:07 internals2.counter.function.counter-get-meta.html
-rw-r--r--      2344 2017-03-28 06:05 security.cgi-bin.default.html
-rw-r--r--      4099 2017-03-28 06:07 function.yp-order.html
-rw-r--r--      6165 2017-03-28 06:07 quickhashintstringhash.delete.html
-rw-r--r--      3497 2017-03-28 06:06 function.enchant-dict-store-replacement.html
-rw-r--r--      2165 2017-03-28 06:06 taint.installation.html
-rw-r--r--     10810 2017-03-28 06:07 solrclient.adddocuments.html
-rw-r--r--      2891 2017-03-28 06:07 solrquery.settermssort.html
-rw-r--r--      2836 2017-03-28 06:06 function.ifx-create-char.html
-rw-r--r--     14499 2017-03-28 06:06 mysqli-stmt.data-seek.html
-rw-r--r--      3411 2017-03-28 06:05 function.ncurses-isendwin.html
-rw-r--r--      5251 2017-03-28 06:06 function.shmop-read.html
-rw-r--r--      2924 2017-03-28 06:07 sdo-das-changesummary.islogging.html
-rw-r--r--      2421 2017-03-28 06:05 weakmap.valid.html
-rw-r--r--      5255 2017-03-28 06:07 soapclient.getlastresponse.html
-rw-r--r--      2561 2017-03-28 06:06 mysqlnd-mux.sharing_connections.html
-rw-r--r--      2212 2017-03-28 06:07 ui-controls-grid.ispadded.html
-rw-r--r--      3397 2017-03-28 06:07 sdo-das-changesummary.getoldcontainer.html
-rw-r--r--      2540 2017-03-28 06:06 function.pdf-begin-pattern.html
-rw-r--r--      6930 2017-03-28 06:07 ds-sequence.get.html
-rw-r--r--      8149 2017-03-28 06:06 function.mysql-num-rows.html
-rw-r--r--      2818 2017-03-28 06:06 imagick.setimageinterlacescheme.html
-rw-r--r--      5081 2017-03-28 06:07 function.end.html
-rw-r--r--      6167 2017-03-28 06:06 class.outofrangeexception.html
-rw-r--r--      3267 2017-03-28 06:06 function.bind-textdomain-codeset.html
-rw-r--r--      3070 2017-03-28 06:05 security.database.html
-rw-r--r--      8465 2017-03-28 06:06 class.evfork.html
-rw-r--r--      5828 2017-03-28 06:07 class.ui-draw-brush-radialgradient.html
-rw-r--r--      7654 2017-03-28 06:06 mongodb-bson-unserializable.bsonunserialize.html
-rw-r--r--      3911 2017-03-28 06:06 mongodb-bson-maxkey.unserialize.html
-rw-r--r--      4972 2017-03-28 06:07 reflectionfunction.tostring.html
-rw-r--r--      5833 2017-03-28 06:07 reference.pcre.pattern.posix.html
-rw-r--r--      2525 2017-03-28 06:06 yaf-loader.getlocalnamespace.html
-rw-r--r--      1673 2017-03-28 06:05 blenc.constants.html
-rw-r--r--      3796 2017-03-28 06:06 function.fann-descale-train.html
-rw-r--r--      3206 2017-03-28 06:06 function.trader-adx.html
-rw-r--r--      3651 2017-03-28 06:06 function.fann-num-input-train-data.html
-rw-r--r--     12035 2017-03-28 06:07 migration52.functions.html
-rw-r--r--      2968 2017-03-28 06:06 function.stats-dens-gamma.html
-rw-r--r--      3661 2017-03-28 06:07 function.yaz-element.html
-rw-r--r--      2079 2017-03-28 06:07 function.msession-destroy.html
-rw-r--r--     11475 2017-03-28 06:06 function.maxdb-fetch-lengths.html
-rw-r--r--     22360 2017-03-28 06:07 class.domnode.html
-rw-r--r--      1991 2017-03-28 06:07 hwapi.configuration.html
-rw-r--r--      7899 2017-03-28 06:07 ds-sequence.sort.html
-rw-r--r--      2754 2017-03-28 06:06 function.fann-destroy.html
-rw-r--r--      1314 2017-03-28 06:06 xdiff.resources.html
-rw-r--r--      2554 2017-03-28 06:06 imagickdraw.pushdefs.html
-rw-r--r--      6482 2017-03-28 06:07 varnish.example.admin.html
-rw-r--r--      1790 2017-03-28 06:06 json.installation.html
-rw-r--r--     15951 2017-03-28 06:06 function.exif-read-data.html
-rw-r--r--     23846 2017-03-28 06:06 function.mail.html
-rw-r--r--     13640 2017-03-28 06:06 dateperiod.construct.html
-rw-r--r--      4019 2017-03-28 06:06 function.fdf-set-flags.html
-rw-r--r--      3814 2017-03-28 06:06 gmp.constants.html
-rw-r--r--      3331 2017-03-28 06:06 gmagick.profileimage.html
-rw-r--r--      6254 2017-03-28 06:06 intro.mysqlnd-mux.html
-rw-r--r--      2614 2017-03-28 06:06 filteriterator.getinneriterator.html
-rw-r--r--      5665 2017-03-28 06:06 function.pspell-config-personal.html
-rw-r--r--     11797 2017-03-28 06:07 ref.array.html
-rw-r--r--      1307 2017-03-28 06:07 ssh2.resources.html
-rw-r--r--      3882 2017-03-28 06:06 function.fann-set-rprop-delta-zero.html
-rw-r--r--      3542 2017-03-28 06:06 function.stats-cdf-noncentral-chisquare.html
-rw-r--r--      3377 2017-03-28 06:06 gmagickdraw.line.html
-rw-r--r--      2289 2017-03-28 06:06 function.stream-bucket-append.html
-rw-r--r--      2178 2017-03-28 06:06 function.set-socket-blocking.html
-rw-r--r--      2888 2017-03-28 06:06 imagick.getresource.html
-rw-r--r--      3216 2017-03-28 06:06 harupage.getdash.html
-rw-r--r--      1300 2017-03-28 06:07 sam.resources.html
-rw-r--r--      4382 2017-03-28 06:06 function.mb-ereg-search-getregs.html
-rw-r--r--      2310 2017-03-28 06:07 solrpingresponse.construct.html
-rw-r--r--      4325 2017-03-28 06:06 function.fann-save.html
-rw-r--r--      2375 2017-03-28 06:06 swftextfield.setpadding.html
-rw-r--r--      8005 2017-03-28 06:05 rararchive.issolid.html
-rw-r--r--      9739 2017-03-28 06:07 reflectionclass.getmethods.html
-rw-r--r--      3526 2017-03-28 06:06 imagick.getimagechannelkurtosis.html
-rw-r--r--     13139 2017-03-28 06:06 refs.basic.other.html
-rw-r--r--     27580 2017-03-28 06:05 language.generators.syntax.html
-rw-r--r--      6575 2017-03-28 06:06 function.dbx-fetch-row.html
-rw-r--r--      4035 2017-03-28 06:06 splheap.compare.html
-rw-r--r--      3501 2017-03-28 06:06 harupage.setlinejoin.html
-rw-r--r--      5842 2017-03-28 06:06 directoryiterator.gettype.html
-rw-r--r--      6608 2017-03-28 06:06 arrayobject.exchangearray.html
-rw-r--r--      4042 2017-03-28 06:07 function.xmlwriter-end-comment.html
-rw-r--r--      2667 2017-03-28 06:06 ref.dir.html
-rw-r--r--      4811 2017-03-28 06:06 function.imap-rfc822-write-address.html
-rw-r--r--      9164 2017-03-28 06:06 fann.examples-1.html
-rw-r--r--      2427 2017-03-28 06:07 ui-controls-combo.setselected.html
-rw-r--r--     12366 2017-03-28 06:06 class.datetimeimmutable.html
-rw-r--r--      1580 2017-03-28 06:06 calendar.installation.html
-rw-r--r--      2764 2017-03-28 06:06 function.trader-add.html
-rw-r--r--      5302 2017-03-28 06:07 swish.query.html
-rw-r--r--      6397 2017-03-28 06:05 function.apcu-cache-info.html
-rw-r--r--      1482 2017-03-28 06:07 oauth.requirements.html
-rw-r--r--      4054 2017-03-28 06:06 event.settimer.html
-rw-r--r--      1509 2017-03-28 06:07 gupnp.requirements.html
-rw-r--r--      3298 2017-03-28 06:06 function.trader-cdlsticksandwich.html
-rw-r--r--      1699 2017-03-28 06:05 install.windows.tools.html
-rw-r--r--      9968 2017-03-28 06:06 mysqlnd.plugin.developing.html
-rw-r--r--      3698 2017-03-28 06:07 internals2.counter.counter-class.construct.html
-rw-r--r--      4681 2017-03-28 06:06 pthreads.constants.html
-rw-r--r--      6055 2017-03-28 06:06 arrayobject.setiteratorclass.html
-rw-r--r--      3403 2017-03-28 06:05 function.newt-checkbox.html
-rw-r--r--      3300 2017-03-28 06:06 function.ifx-update-char.html
-rw-r--r--      3323 2017-03-28 06:05 language.operators.string.html
-rw-r--r--      1537 2017-03-28 06:06 gearman.setup.html
-rw-r--r--      1334 2017-03-28 06:06 yaml.resources.html
-rw-r--r--      4428 2017-03-28 06:06 function.cairo-font-face-status.html
-rw-r--r--      4186 2017-03-28 06:06 function.xdiff-string-diff-binary.html
-rw-r--r--      4157 2017-03-28 06:07 sessionhandler.destroy.html
-rw-r--r--      3371 2017-03-28 06:06 function.sqlite-has-more.html
-rw-r--r--      5190 2017-03-28 06:06 function.ftp-get-option.html
-rw-r--r--      2706 2017-03-28 06:07 function.svn-fs-begin-txn2.html
-rw-r--r--      5960 2017-03-28 06:06 cairocontext.masksurface.html
-rw-r--r--      2266 2017-03-28 06:07 function.msession-set-array.html
-rw-r--r--      2571 2017-03-28 06:07 zmqcontext.ispersistent.html
-rw-r--r--      3933 2017-03-28 06:06 mysqli.set-local-infile-default.html
-rw-r--r--      8549 2017-03-28 06:06 function.pg-lo-create.html
-rw-r--r--      5348 2017-03-28 06:07 reflectionparameter.hastype.html
-rw-r--r--      2986 2017-03-28 06:06 gmagick.rollimage.html
-rw-r--r--      5606 2017-03-28 06:06 function.ftp-connect.html
-rw-r--r--      5142 2017-03-28 06:06 function.imagecolordeallocate.html
-rw-r--r--      1315 2017-03-28 06:07 iisfunc.requirements.html
-rw-r--r--      4242 2017-03-28 06:06 mongoinsertbatch.construct.html
-rw-r--r--      2900 2017-03-28 06:07 sphinxclient.getlastwarning.html
-rw-r--r--      1303 2017-03-28 06:07 svn.resources.html
-rw-r--r--      7998 2017-03-28 06:06 pdostatement.closecursor.html
-rw-r--r--      3779 2017-03-28 06:06 swfmovie.setbackground.html
-rw-r--r--      3895 2017-03-28 06:06 threaded.extend.html
-rw-r--r--      7373 2017-03-28 06:05 pharfileinfo.getcompressedsize.html
-rw-r--r--      8798 2017-03-28 06:06 function.imagepolygon.html
-rw-r--r--      2466 2017-03-28 06:06 function.stats-rand-gen-int.html
-rw-r--r--      3404 2017-03-28 06:06 gearmanworker.removeoptions.html
-rw-r--r--      5583 2017-03-28 06:07 solrdismaxquery.setbigramphrasefields.html
-rw-r--r--      2526 2017-03-28 06:06 swftext.getutf8width.html
-rw-r--r--      6048 2017-03-28 06:06 imagick.clutimage.html
-rw-r--r--      3811 2017-03-28 06:06 tokyotyranttable.add.html
-rw-r--r--      1279 2017-03-28 06:06 ftp.examples.html
-rw-r--r--      4681 2017-03-28 06:07 class.ui-draw-text-font.html
-rw-r--r--      6851 2017-03-28 06:06 function.pg-lo-close.html
-rw-r--r--     28060 2017-03-28 06:06 mongodb.command.html
-rw-r--r--     24744 2017-03-28 06:07 extensions.membership.html
-rw-r--r--      3460 2017-03-28 06:05 phar.fileformat.phar.html
-rw-r--r--      7350 2017-03-28 06:07 reflectionmethod.getmodifiers.html
-rw-r--r--      3273 2017-03-28 06:07 function.gupnp-control-point-new.html
-rw-r--r--      2475 2017-03-28 06:06 datetimeimmutable.settimestamp.html
-rw-r--r--      2818 2017-03-28 06:06 class.swffontchar.html
-rw-r--r--     27703 2017-03-28 06:06 mysqlnduhconnection.getstatistics.html
-rw-r--r--      7270 2017-03-28 06:07 quickhashintstringhash.update.html
-rw-r--r--      4412 2017-03-28 06:06 function.fann-get-cascade-activation-functions.html
-rw-r--r--      1374 2017-03-28 06:07 net-gopher.configuration.html
-rw-r--r--      7341 2017-03-28 06:07 ds-deque.slice.html
-rw-r--r--      2472 2017-03-28 06:06 mysqli-warning.next.html
-rw-r--r--      2650 2017-03-28 06:06 function.trader-ema.html
-rw-r--r--      8035 2017-03-28 06:07 quickhashstringinthash.loadfromstring.html
-rw-r--r--     16380 2017-03-28 06:06 function.mysql-real-escape-string.html
-rw-r--r--     11779 2017-03-28 06:06 mysqlnd-qc.pattern-based-caching.html
-rw-r--r--      2716 2017-03-28 06:06 gearmanworker.geterrno.html
-rw-r--r--      2519 2017-03-28 06:06 yaf-loader.clearlocalnamespace.html
-rw-r--r--      7203 2017-03-28 06:06 function.ignore-user-abort.html
-rw-r--r--      7952 2017-03-28 06:06 mongodb-driver-readconcern.bsonserialize.html
-rw-r--r--      1535 2017-03-28 06:06 intro.shmop.html
-rw-r--r--      7762 2017-03-28 06:07 snmp.constants.html
-rw-r--r--      4299 2017-03-28 06:06 function.px-update-record.html
-rw-r--r--      3928 2017-03-28 06:07 oauth.settoken.html
-rw-r--r--      8246 2017-03-28 06:06 function.sqlsrv-num-rows.html
-rw-r--r--      4073 2017-03-28 06:06 function.maxdb-real-query.html
-rw-r--r--      2628 2017-03-28 06:06 datetimeimmutable.settime.html
-rw-r--r--      4219 2017-03-28 06:06 swfbutton.addaction.html
-rw-r--r--      2969 2017-03-28 06:06 function.imap-qprint.html
-rw-r--r--      4285 2017-03-28 06:06 function.posix-ctermid.html
-rw-r--r--      3209 2017-03-28 06:06 evperiodic.set.html
-rw-r--r--      2358 2017-03-28 06:07 internals2.buildsys.html
-rw-r--r--      2404 2017-03-28 06:06 splfixedarray.rewind.html
-rw-r--r--      9072 2017-03-28 06:06 dba.installation.html
-rw-r--r--      1301 2017-03-28 06:07 array.requirements.html
-rw-r--r--      3655 2017-03-28 06:06 function.rad2deg.html
-rw-r--r--      7975 2017-03-28 06:06 book.eio.html
-rw-r--r--     12710 2017-03-28 06:06 eventhttpconnection.makerequest.html
-rw-r--r--      4702 2017-03-28 06:07 function.vsprintf.html
-rw-r--r--      2484 2017-03-28 06:05 language.references.unset.html
-rw-r--r--      1969 2017-03-28 06:07 intro.array.html
-rw-r--r--     12039 2017-03-28 06:07 session.upload-progress.html
-rw-r--r--      2780 2017-03-28 06:06 swftextfield.addchars.html
-rw-r--r--      5183 2017-03-28 06:07 soapclient.getfunctions.html
-rw-r--r--      1570 2017-03-28 06:07 simplexml.setup.html
-rw-r--r--      1525 2017-03-28 06:07 stomp.requirements.html
-rw-r--r--      4534 2017-03-28 06:07 sessionhandler.read.html
-rw-r--r--      4297 2017-03-28 06:07 internals2.opcodes.brk.html
-rw-r--r--      7868 2017-03-28 06:06 function.eio-statvfs.html
-rw-r--r--      2375 2017-03-28 06:07 ref.nis.html
-rw-r--r--      2364 2017-03-28 06:06 class.gmp.html
-rw-r--r--      4533 2017-03-28 06:06 datetimeimmutable.createfrommutable.html
-rw-r--r--      5123 2017-03-28 06:05 function.radius-create-request.html
-rw-r--r--     10921 2017-03-28 06:06 numberformatter.getattribute.html
-rw-r--r--      2891 2017-03-28 06:06 recursiveiteratoriterator.getinneriterator.html
-rw-r--r--     11459 2017-03-28 06:06 mongoresultexception.getdocument.html
-rw-r--r--      4869 2017-03-28 06:07 memcached.deletemulti.html
-rw-r--r--      5552 2017-03-28 06:07 class.ui-control.html
-rw-r--r--      2203 2017-03-28 06:07 function.ui-quit.html
-rw-r--r--      2412 2017-03-28 06:07 varnishadmin.getparams.html
-rw-r--r--      9543 2017-03-28 06:06 imagickdraw.polyline.html
-rw-r--r--     21139 2017-03-28 06:07 internals2.opcodes.html
-rw-r--r--      3316 2017-03-28 06:06 function.dbplus-restorepos.html
-rw-r--r--      2645 2017-03-28 06:07 reflector.export.html
-rw-r--r--      3499 2017-03-28 06:06 class.cairolinejoin.html
-rw-r--r--      5600 2017-03-28 06:06 function.mysqli-connect.html
-rw-r--r--      2657 2017-03-28 06:05 ref.kadm5.html
-rw-r--r--     12677 2017-03-28 06:07 quickhash.examples.html
-rw-r--r--      2418 2017-03-28 06:06 judy.offsetunset.html
-rw-r--r--      2567 2017-03-28 06:06 book.spl-types.html
-rw-r--r--     10026 2017-03-28 06:07 function.strspn.html
-rw-r--r--      7934 2017-03-28 06:07 sca.examples.proxies.html
-rw-r--r--      3077 2017-03-28 06:07 reflectionfunctionabstract.clone.html
-rw-r--r--      3328 2017-03-28 06:07 solrinputdocument.merge.html
-rw-r--r--      2265 2017-03-28 06:07 book.net-gopher.html
-rw-r--r--      3134 2017-03-28 06:06 gmagick.setsize.html
-rw-r--r--      5728 2017-03-28 06:06 mysqlinfo.terminology.html
-rw-r--r--      2383 2017-03-28 06:06 function.pdf-close-pdi.html
-rw-r--r--      9138 2017-03-28 06:06 yaf-controller-abstract.forward.html
-rw-r--r--      7382 2017-03-28 06:06 yaf-action-abstract.execute.html
-rw-r--r--     31014 2017-03-28 06:07 ref.sdo.html
-rw-r--r--      3185 2017-03-28 06:06 function.jdtojulian.html
-rw-r--r--      4939 2017-03-28 06:06 cairocontext.pushgroup.html
-rw-r--r--     11292 2017-03-28 06:06 mysqlinfo.concepts.charset.html
-rw-r--r--      2515 2017-03-28 06:05 function.newt-form-get-current.html
-rw-r--r--      1634 2017-03-28 06:06 intro.cyrus.html
-rw-r--r--      1340 2017-03-28 06:06 inotify.requirements.html
-rw-r--r--     10883 2017-03-28 06:06 imagickdraw.setviewbox.html
-rw-r--r--      2871 2017-03-28 06:07 sdo-das-setting.getpropertyindex.html
-rw-r--r--      1329 2017-03-28 06:06 tokenizer.requirements.html
-rw-r--r--      6118 2017-03-28 06:06 misc.configuration.html
-rw-r--r--      3510 2017-03-28 06:07 domelement.getattribute.html
-rw-r--r--      6612 2017-03-28 06:06 intlchar.isuuppercase.html
-rw-r--r--      6155 2017-03-28 06:06 class.outofboundsexception.html
-rw-r--r--      2200 2017-03-28 06:06 mysqlnd-qc.installation.html
-rw-r--r--      6559 2017-03-28 06:07 domdocument.createattributens.html
-rw-r--r--      3255 2017-03-28 06:06 function.trader-cdlpiercing.html
-rw-r--r--     11178 2017-03-28 06:06 function.mssql-result.html
-rw-r--r--      2552 2017-03-28 06:07 ui-menu.appendabout.html
-rw-r--r--      2632 2017-03-28 06:06 mysqlnd-ms.concepts.html
-rw-r--r--      5056 2017-03-28 06:07 domcomment.construct.html
-rw-r--r--      6388 2017-03-28 06:05 phar.getmetadata.html
-rw-r--r--      2252 2017-03-28 06:06 intro.mssql.html
-rw-r--r--      2474 2017-03-28 06:06 intliterator.current.html
-rw-r--r--     15570 2017-03-28 06:06 class.arrayobject.html
-rw-r--r--     15583 2017-03-28 06:07 function.call-user-func.html
-rw-r--r--      2991 2017-03-28 06:07 hwapi.link.html
-rw-r--r--      8761 2017-03-28 06:06 function.fbsql-fetch-array.html
-rw-r--r--      2444 2017-03-28 06:07 solrquery.getstatsfacets.html
-rw-r--r--      3204 2017-03-28 06:07 reflectionparameter.allowsnull.html
-rw-r--r--      2639 2017-03-28 06:07 ui-draw-color.construct.html
-rw-r--r--      3222 2017-03-28 06:07 hwapi.find.html
-rw-r--r--      2586 2017-03-28 06:06 harupage.getcurrentfontsize.html
-rw-r--r--      2401 2017-03-28 06:06 function.pdf-add-textflow.html
-rw-r--r--      1308 2017-03-28 06:05 openal.requirements.html
-rw-r--r--      2734 2017-03-28 06:06 yaf-view-simple.display.html
-rw-r--r--      8583 2017-03-28 06:06 intlcalendar.isequivalentto.html
-rw-r--r--      4228 2017-03-28 06:06 splfixedarray.toarray.html
-rw-r--r--      2552 2017-03-28 06:06 function.pdf-add-table-cell.html
-rw-r--r--      4106 2017-03-28 06:07 extensions.state.html
-rw-r--r--      3427 2017-03-28 06:05 function.zip-entry-compressionmethod.html
-rw-r--r--      4774 2017-03-28 06:06 eventbuffer.pullup.html
-rw-r--r--      3100 2017-03-28 06:07 solrquery.sethighlightusephrasehighlighter.html
-rw-r--r--      1841 2017-03-28 06:07 internals2.opcodes.user-opcode.html
-rw-r--r--      8129 2017-03-28 06:06 function.ftp-get.html
-rw-r--r--      1667 2017-03-28 06:07 rrd.installation.html
-rw-r--r--      5321 2017-03-28 06:06 function.fileowner.html
-rw-r--r--      9619 2017-03-28 06:07 function.yaz-scan.html
-rw-r--r--      1289 2017-03-28 06:06 msql.examples.html
-rw-r--r--     10434 2017-03-28 06:06 messageformatter.parsemessage.html
-rw-r--r--      3224 2017-03-28 06:05 function.mcrypt-enc-is-block-algorithm.html
-rw-r--r--      2269 2017-03-28 06:07 function.msession-uniq.html
-rw-r--r--      6149 2017-03-28 06:06 function.lchgrp.html
-rw-r--r--      3408 2017-03-28 06:06 filteriterator.construct.html
-rw-r--r--      7986 2017-03-28 06:06 imagickpixeliterator.setiteratorrow.html
-rw-r--r--      6586 2017-03-28 06:06 function.gmp-div-qr.html
-rw-r--r--      6635 2017-03-28 06:06 mongocursor.setreadpreference.html
-rw-r--r--      2650 2017-03-28 06:06 mongoid.getinc.html
-rw-r--r--      3426 2017-03-28 06:07 function.yaz-error.html
-rw-r--r--      2672 2017-03-28 06:07 ref.session-pgsql.html
-rw-r--r--      6936 2017-03-28 06:06 function.pg-field-type-oid.html
-rw-r--r--      9048 2017-03-28 06:07 book.sdo.html
-rw-r--r--      5375 2017-03-28 06:06 yaf-dispatcher.registerplugin.html
-rw-r--r--      3386 2017-03-28 06:07 oauth.disabledebug.html
-rw-r--r--      5350 2017-03-28 06:06 cairocontext.pushgroupwithcontent.html
-rw-r--r--      7233 2017-03-28 06:07 simplexmlelement.asxml.html
-rw-r--r--      3385 2017-03-28 06:07 reflectionproperty.isprivate.html
-rw-r--r--     18113 2017-03-28 06:07 function.array-column.html
-rw-r--r--      3853 2017-03-28 06:07 function.variant-not.html
-rw-r--r--      4502 2017-03-28 06:05 errorexception.getseverity.html
-rw-r--r--      3826 2017-03-28 06:06 mysqli.reap-async-query.html
-rw-r--r--      4754 2017-03-28 06:07 stomp.configuration.html
-rw-r--r--     37205 2017-03-28 06:05 apc.configuration.html
-rw-r--r--      3022 2017-03-28 06:06 class.yaf-exception-loadfailed-action.html
-rw-r--r--      3983 2017-03-28 06:07 domelement.setattributenodens.html
-rw-r--r--      3443 2017-03-28 06:06 function.stats-stat-noncentral-t.html
-rw-r--r--      5633 2017-03-28 06:06 function.gmp-scan1.html
-rw-r--r--      2040 2017-03-28 06:06 function.pdf-end-pattern.html
-rw-r--r--      2921 2017-03-28 06:06 mongoclient.connect.html
-rw-r--r--      4374 2017-03-28 06:07 yar-client.call.html
-rw-r--r--      2755 2017-03-28 06:06 recursiveiteratoriterator.valid.html
-rw-r--r--      2535 2017-03-28 06:07 ref.pcre.html
-rw-r--r--      3421 2017-03-28 06:07 internals2.opcodes.new.html
-rw-r--r--      2392 2017-03-28 06:06 cachingiterator.key.html
-rw-r--r--      4844 2017-03-28 06:06 paradox.constants.html
-rw-r--r--      3672 2017-03-28 06:07 domnode.issupported.html
-rw-r--r--      8977 2017-03-28 06:06 intlcalendar.getminimaldaysinfirstweek.html
-rw-r--r--      4850 2017-03-28 06:05 function.readline.html
-rw-r--r--      4093 2017-03-28 06:06 mongo.tutorial.insert.multiple.html
-rw-r--r--      9889 2017-03-28 06:06 function.mysqlnd-ms-get-last-used-connection.html
-rw-r--r--      1673 2017-03-28 06:07 intro.xmlreader.html
-rw-r--r--      3421 2017-03-28 06:07 function.yp-get-default-domain.html
-rw-r--r--      2657 2017-03-28 06:06 function.vpopmail-set-user-quota.html
-rw-r--r--      1490 2017-03-28 06:05 zip.setup.html
-rw-r--r--      3090 2017-03-28 06:07 migration52.errorrep.html
-rw-r--r--     22932 2017-03-28 06:06 mysqlnduhconnection.simplecommand.html
-rw-r--r--      3491 2017-03-28 06:06 function.pcntl-wifstopped.html
-rw-r--r--      2442 2017-03-28 06:07 solrobject.getpropertynames.html
-rw-r--r--      4072 2017-03-28 06:07 function.ldap-mod-del.html
-rw-r--r--      1375 2017-03-28 06:06 gmagick.configuration.html
-rw-r--r--      2318 2017-03-28 06:07 ui-controls-group.settitle.html
-rw-r--r--      4322 2017-03-28 06:06 book.misc.html
-rw-r--r--      7126 2017-03-28 06:06 datetimezone.listidentifiers.html
-rw-r--r--      2410 2017-03-28 06:06 yaf-session.wakeup.html
-rw-r--r--      2395 2017-03-28 06:07 migration51.html
-rw-r--r--      2995 2017-03-28 06:07 function.rrd-graph.html
-rw-r--r--      7924 2017-03-28 06:06 function.oci-num-fields.html
-rw-r--r--      2544 2017-03-28 06:06 taint.detail.untaint.html
-rw-r--r--      4456 2017-03-28 06:06 function.dbplus-rcreate.html
-rw-r--r--      3072 2017-03-28 06:06 splobserver.update.html
-rw-r--r--      7226 2017-03-28 06:07 quickhashinthash.loadfromstring.html
-rw-r--r--      6547 2017-03-28 06:06 function.dir.html
-rw-r--r--      6412 2017-03-28 06:07 function.ctype-upper.html
-rw-r--r--      2667 2017-03-28 06:07 solrclientexception.getinternalinfo.html
-rw-r--r--      8493 2017-03-28 06:07 ds-map.ksort.html
-rw-r--r--      2699 2017-03-28 06:07 solrquery.removefilterquery.html
-rw-r--r--      3067 2017-03-28 06:07 solrillegaloperationexception.getinternalinfo.html
-rw-r--r--      2379 2017-03-28 06:06 swfdisplayitem.getyscale.html
-rw-r--r--      2951 2017-03-28 06:07 var.configuration.html
-rw-r--r--     10218 2017-03-28 06:07 class.varnishadmin.html
-rw-r--r--      3606 2017-03-28 06:06 function.sybase-num-fields.html
-rw-r--r--      7223 2017-03-28 06:05 function.debug-print-backtrace.html
-rw-r--r--      3109 2017-03-28 06:07 domxpath.registernamespace.html
-rw-r--r--      3544 2017-03-28 06:06 eventbufferevent.enable.html
-rw-r--r--      3526 2017-03-28 06:06 sqlite3.escapestring.html
-rw-r--r--      6190 2017-03-28 06:06 function.ifx-affected-rows.html
-rw-r--r--      5612 2017-03-28 06:06 function.imagefontwidth.html
-rw-r--r--      7629 2017-03-28 06:06 function.geoip-record-by-name.html
-rw-r--r--      5984 2017-03-28 06:07 domdocument.load.html
-rw-r--r--      4345 2017-03-28 06:07 function.xmlwriter-set-indent-string.html
-rw-r--r--      5573 2017-03-28 06:07 quickhashinthash.update.html
-rw-r--r--      7760 2017-03-28 06:06 mongodb-driver-server.executecommand.html
-rw-r--r--      5401 2017-03-28 06:07 function.call-user-method.html
-rw-r--r--      2143 2017-03-28 06:06 function.pdf-setdashpattern.html
-rw-r--r--      2859 2017-03-28 06:05 weakref.valid.html
-rw-r--r--     30886 2017-03-28 06:07 migration56.new-features.html
-rw-r--r--      4717 2017-03-28 06:06 event.construct.html
-rw-r--r--      2599 2017-03-28 06:06 imagick.setfilename.html
-rw-r--r--      1518 2017-03-28 06:07 filter.setup.html
-rw-r--r--      6222 2017-03-28 06:06 mongodb-bson-binary.construct.html
-rw-r--r--      2776 2017-03-28 06:06 spldoublylinkedlist.pop.html
-rw-r--r--      2733 2017-03-28 06:06 function.pdf-set-border-color.html
-rw-r--r--      9913 2017-03-28 06:06 function.mysql-result.html
-rw-r--r--      4172 2017-03-28 06:06 imagick.despeckleimage.html
-rw-r--r--      4564 2017-03-28 06:06 imagick.blueshiftimage.html
-rw-r--r--      3191 2017-03-28 06:06 function.is-finite.html
-rw-r--r--      6958 2017-03-28 06:07 function.count-chars.html
-rw-r--r--     16516 2017-03-28 06:07 class.oauth.html
-rw-r--r--      3023 2017-03-28 06:06 recursiveiteratoriterator.beginiteration.html
-rw-r--r--      3060 2017-03-28 06:06 eventbuffer.freeze.html
-rw-r--r--      3528 2017-03-28 06:07 function.snmp-get-quick-print.html
-rw-r--r--      2118 2017-03-28 06:06 function.dba-list.html
-rw-r--r--      3611 2017-03-28 06:06 function.ibase-blob-cancel.html
-rw-r--r--      6705 2017-03-28 06:06 function.eio-fallocate.html
-rw-r--r--      9077 2017-03-28 06:07 memcached.set.html
-rw-r--r--      2493 2017-03-28 06:07 solrresponse.getdigestedresponse.html
-rw-r--r--      2330 2017-03-28 06:05 function.radius-strerror.html
-rw-r--r--      2780 2017-03-28 06:06 function.vpopmail-passwd.html
-rw-r--r--      2516 2017-03-28 06:07 hwapi.object-count.html
-rw-r--r--      2834 2017-03-28 06:05 apcuiterator.rewind.html
-rw-r--r--      4599 2017-03-28 06:06 evembed.createstopped.html
-rw-r--r--      7226 2017-03-28 06:07 memcache.decrement.html
-rw-r--r--      4500 2017-03-28 06:07 xsltprocessor.construct.html
-rw-r--r--      2569 2017-03-28 06:07 sdo-das-xml-document.getrootelementname.html
-rw-r--r--      1939 2017-03-28 06:06 ref.fileinfo.html
-rw-r--r--      4791 2017-03-28 06:06 function.cairo-font-options-set-antialias.html
-rw-r--r--      2488 2017-03-28 06:06 expect.installation.html
-rw-r--r--      2449 2017-03-28 06:06 function.trader-ht-sine.html
-rw-r--r--      6451 2017-03-28 06:07 function.getservbyname.html
-rw-r--r--      6056 2017-03-28 06:07 ds-map.apply.html
-rw-r--r--      5063 2017-03-28 06:06 function.px-retrieve-record.html
-rw-r--r--      7573 2017-03-28 06:06 function.pg-escape-string.html
-rw-r--r--      4695 2017-03-28 06:06 function.cairo-pattern-set-matrix.html
-rw-r--r--      4027 2017-03-28 06:06 syncreaderwriter.readunlock.html
-rw-r--r--      5009 2017-03-28 06:06 cairocontext.glyphpath.html
-rw-r--r--      2337 2017-03-28 06:06 imagick.getimageheight.html
-rw-r--r--      3476 2017-03-28 06:06 arrayiterator.offsetget.html
-rw-r--r--      6730 2017-03-28 06:05 phar.setsignaturealgorithm.html
-rw-r--r--      5624 2017-03-28 06:07 function.snmpgetnext.html
-rw-r--r--      3677 2017-03-28 06:07 solrinputdocument.haschilddocuments.html
-rw-r--r--      2030 2017-03-28 06:07 tcpwrap.installation.html
-rw-r--r--      5161 2017-03-28 06:05 function.apd-set-session-trace-socket.html
-rw-r--r--      6389 2017-03-28 06:06 imagick.scaleimage.html
-rw-r--r--      3653 2017-03-28 06:07 reflectionextension.tostring.html
-rw-r--r--      2836 2017-03-28 06:05 function.newt-checkbox-tree-get-current.html
-rw-r--r--      3987 2017-03-28 06:05 pharfileinfo.hasmetadata.html
-rw-r--r--      3266 2017-03-28 06:05 apcuiterator.gettotalsize.html
-rw-r--r--      2574 2017-03-28 06:07 function.oauth-urlencode.html
-rw-r--r--      4910 2017-03-28 06:06 function.cairo-ps-surface-set-size.html
-rw-r--r--      3254 2017-03-28 06:07 reflectionparameter.ispassedbyreference.html
-rw-r--r--      3961 2017-03-28 06:06 harudoc.setpassword.html
-rw-r--r--      4480 2017-03-28 06:06 harufont.measuretext.html
-rw-r--r--      4652 2017-03-28 06:06 cairoimagesurface.getwidth.html
-rw-r--r--      2951 2017-03-28 06:06 function.ibase-commit.html
-rw-r--r--      5961 2017-03-28 06:07 ref.com.html
-rw-r--r--      1315 2017-03-28 06:06 filepro.requirements.html
-rw-r--r--      2789 2017-03-28 06:06 mongocursor.key.html
-rw-r--r--      1328 2017-03-28 06:07 session.resources.html
-rw-r--r--      2590 2017-03-28 06:06 yaf-response-abstract.construct.html
-rw-r--r--      7607 2017-03-28 06:06 cairosvgsurface.getversions.html
-rw-r--r--      1300 2017-03-28 06:07 sca.resources.html
-rw-r--r--      1973 2017-03-28 06:06 function.pdf-get-errmsg.html
-rw-r--r--      2116 2017-03-28 06:07 function.msession-unlock.html
-rw-r--r--      5486 2017-03-28 06:07 ds-deque.sum.html
-rw-r--r--      3360 2017-03-28 06:06 gmagick.embossimage.html
-rw-r--r--      1761 2017-03-28 06:07 function.is-integer.html
-rw-r--r--      1507 2017-03-28 06:06 curl.setup.html
-rw-r--r--     10809 2017-03-28 06:06 function.sqlsrv-errors.html
-rw-r--r--      2971 2017-03-28 06:06 function.unixtojd.html
-rw-r--r--      4928 2017-03-28 06:07 sca.examples.nonscascript.html
-rw-r--r--      6730 2017-03-28 06:06 imagick.adaptiveblurimage.html
-rw-r--r--      5478 2017-03-28 06:06 function.imap-getsubscribed.html
-rw-r--r--      2337 2017-03-28 06:06 mongo.trouble.html
-rw-r--r--      2980 2017-03-28 06:06 splfileobject.haschildren.html
-rw-r--r--      2402 2017-03-28 06:05 function.ncurses-standout.html
-rw-r--r--      7725 2017-03-28 06:06 function.touch.html
-rw-r--r--      3582 2017-03-28 06:06 function.msql-create-db.html
-rw-r--r--      2157 2017-03-28 06:06 directory.read.html
-rw-r--r--      5206 2017-03-28 06:06 splobjectstorage.addall.html
-rw-r--r--      3929 2017-03-28 06:05 function.mcrypt-ecb.html
-rw-r--r--      3688 2017-03-28 06:06 cairoscaledfont.getctm.html
-rw-r--r--      3120 2017-03-28 06:06 imagickdraw.settextencoding.html
-rw-r--r--     14324 2017-03-28 06:07 appendices.html
-rw-r--r--      1531 2017-03-28 06:06 expect.resources.html
-rw-r--r--      8971 2017-03-28 06:06 function.imagegrabwindow.html
-rw-r--r--      2410 2017-03-28 06:07 ui-controls-multilineentry.isreadonly.html
-rw-r--r--      1470 2017-03-28 06:06 fam.requirements.html
-rw-r--r--      1238 2017-03-28 06:07 apache.constants.html
-rw-r--r--      2870 2017-03-28 06:07 internals2.opcodes.assign-sub.html
-rw-r--r--      5641 2017-03-28 06:06 yaf-response-abstract.prependbody.html
-rw-r--r--      3870 2017-03-28 06:06 gmagick.shearimage.html
-rw-r--r--      5900 2017-03-28 06:07 win32service.examples.html
-rw-r--r--      9400 2017-03-28 06:06 mysqlnduhconnection.geterrornumber.html
-rw-r--r--      2257 2017-03-28 06:05 generator.current.html
-rw-r--r--      6880 2017-03-28 06:06 function.cubrid-save-to-glo.html
-rw-r--r--      8444 2017-03-28 06:06 locale.getdisplayvariant.html
-rw-r--r--      1738 2017-03-28 06:05 function.gzputs.html
-rw-r--r--      3318 2017-03-28 06:06 function.trader-cdlidentical3crows.html
-rw-r--r--      2198 2017-03-28 06:07 ui-draw-matrix.isinvertible.html
-rw-r--r--      3152 2017-03-28 06:07 hwapi.objectbyanchor.html
-rw-r--r--      1307 2017-03-28 06:06 tidy.resources.html
-rw-r--r--      8941 2017-03-28 06:07 domdocument.importnode.html
-rw-r--r--      2661 2017-03-28 06:06 mongocursorexception.gethost.html
-rw-r--r--      2509 2017-03-28 06:07 rrdgraph.save.html
-rw-r--r--      4387 2017-03-28 06:07 function.xmlwriter-write-cdata.html
-rw-r--r--      2367 2017-03-28 06:07 ui-window.setsize.html
-rw-r--r--      2164 2017-03-28 06:06 function.maxdb-disable-rpl-parse.html
-rw-r--r--      5634 2017-03-28 06:07 function.variant-imp.html
-rw-r--r--      4611 2017-03-28 06:06 mysqli-stmt.next-result.html
-rw-r--r--     15259 2017-03-28 06:07 solrinputdocument.addchilddocuments.html
-rw-r--r--      4680 2017-03-28 06:06 book.pcntl.html
-rw-r--r--     11245 2017-03-28 06:07 class.quickhashstringinthash.html
-rw-r--r--      4379 2017-03-28 06:06 function.gnupg-cleardecryptkeys.html
-rw-r--r--      2469 2017-03-28 06:05 id3v2tag.addframe.html
-rw-r--r--      2913 2017-03-28 06:07 mqseries.configure.html
-rw-r--r--      7095 2017-03-28 06:07 function.udm-cat-path.html
-rw-r--r--      8785 2017-03-28 06:06 imagickdraw.push.html
-rw-r--r--      3534 2017-03-28 06:05 function.apc-compile-file.html
-rw-r--r--      3073 2017-03-28 06:07 sphinxclient.setconnecttimeout.html
-rw-r--r--      2653 2017-03-28 06:07 hwapi.object-attreditable.html
-rw-r--r--      6360 2017-03-28 06:07 solrdismaxquery.removetrigramphrasefield.html
-rw-r--r--      6947 2017-03-28 06:07 class.snmpexception.html
-rw-r--r--     11891 2017-03-28 06:06 class.evio.html
-rw-r--r--      6793 2017-03-28 06:07 migration52.classes.html
-rw-r--r--      6236 2017-03-28 06:06 function.time-sleep-until.html
-rw-r--r--     12341 2017-03-28 06:06 mysqli-stmt.num-rows.html
-rw-r--r--      2564 2017-03-28 06:06 taint.detail.basic.html
-rw-r--r--      1367 2017-03-28 06:06 parsekit.configuration.html
-rw-r--r--      6953 2017-03-28 06:07 reflectionclass.innamespace.html
-rw-r--r--      5885 2017-03-28 06:06 function.fbsql-next-result.html
-rw-r--r--      4218 2017-03-28 06:07 ds-vector.reversed.html
-rw-r--r--      7111 2017-03-28 06:07 com.configuration.html
-rw-r--r--      3636 2017-03-28 06:06 splpriorityqueue.compare.html
-rw-r--r--      2956 2017-03-28 06:05 phar.getversion.html
-rw-r--r--      4958 2017-03-28 06:07 reflectionclass.getextension.html
-rw-r--r--      2261 2017-03-28 06:06 function.pdf-get-minorversion.html
-rw-r--r--      2594 2017-03-28 06:06 function.mysqli-master-query.html
-rw-r--r--      6179 2017-03-28 06:06 function.dbase-numrecords.html
-rw-r--r--      2715 2017-03-28 06:06 harupage.getcurrentpos.html
-rw-r--r--      4517 2017-03-28 06:06 function.inotify-read.html
-rw-r--r--      3619 2017-03-28 06:07 xmlreader.movetofirstattribute.html
-rw-r--r--      2615 2017-03-28 06:07 soapvar.construct.html
-rw-r--r--      4779 2017-03-28 06:06 splfileobject.getmaxlinelen.html
-rw-r--r--      9283 2017-03-28 06:06 class.evidle.html
-rw-r--r--     10096 2017-03-28 06:05 phardata.converttodata.html
-rw-r--r--      1273 2017-03-28 06:05 blenc.resources.html
-rw-r--r--      4829 2017-03-28 06:06 function.eio-unlink.html
-rw-r--r--      1314 2017-03-28 06:06 iconv.resources.html
-rw-r--r--      1537 2017-03-28 06:07 hwapi.setup.html
-rw-r--r--      5486 2017-03-28 06:07 domattr.construct.html
-rw-r--r--      5410 2017-03-28 06:07 ds-sequence.apply.html
-rw-r--r--      2395 2017-03-28 06:07 ui-control.gettoplevel.html
-rw-r--r--      2026 2017-03-28 06:06 function.date-create-immutable.html
-rw-r--r--      4249 2017-03-28 06:07 soapserver.setclass.html
-rw-r--r--      5927 2017-03-28 06:06 intro.mysqlnd-memcache.html
-rw-r--r--     48510 2017-03-28 06:06 parsekit.constants.html
-rw-r--r--     39768 2017-03-28 06:07 class.domdocument.html
-rw-r--r--      1271 2017-03-28 06:05 bcompiler.constants.html
-rw-r--r--     13135 2017-03-28 06:07 function.strpos.html
-rw-r--r--      6478 2017-03-28 06:07 memcache.delete.html
-rw-r--r--      3759 2017-03-28 06:05 security.hiding.html
-rw-r--r--     17758 2017-03-28 06:06 mysqli-stmt.get-result.html
-rw-r--r--      7150 2017-03-28 06:07 oauthprovider.construct.html
-rw-r--r--      2907 2017-03-28 06:06 mongogridfscursor.key.html
-rw-r--r--      2747 2017-03-28 06:06 function.trader-kama.html
-rw-r--r--      3404 2017-03-28 06:06 recursivetreeiterator.setprefixpart.html
-rw-r--r--      3472 2017-03-28 06:07 xmlreader.setparserproperty.html
-rw-r--r--      3720 2017-03-28 06:05 configuration.changes.modes.html
-rw-r--r--      7457 2017-03-28 06:06 function.imagecolorresolvealpha.html
-rw-r--r--      2951 2017-03-28 06:07 quickhashintstringhash.exists.html
-rw-r--r--     12867 2017-03-28 06:06 class.seekableiterator.html
-rw-r--r--      3890 2017-03-28 06:07 sca.examples.structure.html
-rw-r--r--      5087 2017-03-28 06:07 stomp.send.html
-rw-r--r--      6366 2017-03-28 06:06 imagick.adaptivesharpenimage.html
-rw-r--r--      2138 2017-03-28 06:05 function.newt-cursor-on.html
-rw-r--r--      5194 2017-03-28 06:06 function.intl-error-name.html
-rw-r--r--      3583 2017-03-28 06:06 ref.xdiff.html
-rw-r--r--      1363 2017-03-28 06:06 enchant.configuration.html
-rw-r--r--      1517 2017-03-28 06:06 uodbc.setup.html
-rw-r--r--      2731 2017-03-28 06:06 function.fann-get-network-type.html
-rw-r--r--      5486 2017-03-28 06:06 function.cubrid-error-msg.html
-rw-r--r--      3298 2017-03-28 06:07 ui-draw-path.bezierto.html
-rw-r--r--      5516 2017-03-28 06:06 function.mb-substr-count.html
-rw-r--r--      1503 2017-03-28 06:05 ncurses.requirements.html
-rw-r--r--      3326 2017-03-28 06:07 class.yar-server.html
-rw-r--r--      5624 2017-03-28 06:06 mongoclient.getwriteconcern.html
-rw-r--r--      9761 2017-03-28 06:05 language.oop5.cloning.html
-rw-r--r--      5928 2017-03-28 06:06 function.fann-set-activation-steepness.html
-rw-r--r--      5193 2017-03-28 06:07 soapclient.setlocation.html
-rw-r--r--      2470 2017-03-28 06:06 yaf-config-ini.rewind.html
-rw-r--r--      1557 2017-03-28 06:05 readline.setup.html
-rw-r--r--      8662 2017-03-28 06:06 recursivedirectoryiterator.construct.html
-rw-r--r--      2626 2017-03-28 06:06 mongocollection.validate.html
-rw-r--r--      1468 2017-03-28 06:07 svm.setup.html
-rw-r--r--      5400 2017-03-28 06:06 function.imap-listscan.html
-rw-r--r--      5345 2017-03-28 06:06 cairocontext.setscaledfont.html
-rw-r--r--      3034 2017-03-28 06:06 eventhttprequest.gethost.html
-rw-r--r--      2857 2017-03-28 06:05 rarentry.getcrc.html
-rw-r--r--      3038 2017-03-28 06:06 imagick.setimageblueprimary.html
-rw-r--r--      3326 2017-03-28 06:06 class.swfmorph.html
-rw-r--r--      3243 2017-03-28 06:07 sdo-model-type.getbasetype.html
-rw-r--r--      2570 2017-03-28 06:07 function.rrd-lastupdate.html
-rw-r--r--     15612 2017-03-28 06:06 function.proc-open.html
-rw-r--r--     11751 2017-03-28 06:06 yaf-router.addroute.html
-rw-r--r--      2092 2017-03-28 06:06 function.ocicollsize.html
-rw-r--r--      3542 2017-03-28 06:06 function.fann-set-rprop-decrease-factor.html
-rw-r--r--      5985 2017-03-28 06:06 class.harudestination.html
-rw-r--r--     16945 2017-03-28 06:06 function.imagettftext.html
-rw-r--r--      6219 2017-03-28 06:06 splobjectstorage.offsetunset.html
-rw-r--r--      2911 2017-03-28 06:06 harupage.getwordspace.html
-rw-r--r--      2489 2017-03-28 06:06 collectable.isgarbage.html
-rw-r--r--      8922 2017-03-28 06:07 book.quickhash.html
-rw-r--r--      1398 2017-03-28 06:07 win32service.configuration.html
-rw-r--r--      1715 2017-03-28 06:05 htscanner.installation.html
-rw-r--r--      1321 2017-03-28 06:07 libxml.resources.html
-rw-r--r--      3786 2017-03-28 06:05 reserved.variables.phperrormsg.html
-rw-r--r--      5569 2017-03-28 06:06 streamwrapper.stream-seek.html
-rw-r--r--      2676 2017-03-28 06:06 function.eio-npending.html
-rw-r--r--     15359 2017-03-28 06:06 function.cubrid-connect-with-url.html
-rw-r--r--      7510 2017-03-28 06:06 recursiveregexiterator.getchildren.html
-rw-r--r--      2996 2017-03-28 06:06 function.cyrus-connect.html
-rw-r--r--      1906 2017-03-28 06:05 function.require.html
-rw-r--r--      5069 2017-03-28 06:07 gupnp-service-proxy-send-action.html
-rw-r--r--      6028 2017-03-28 06:06 class.yaf-route-simple.html
-rw-r--r--     11113 2017-03-28 06:06 function.mysqlnd-memcache-set.html
-rw-r--r--      5523 2017-03-28 06:06 cairocontext.relmoveto.html
-rw-r--r--      4952 2017-03-28 06:06 function.gmp-mod.html
-rw-r--r--      2785 2017-03-28 06:06 function.stats-stat-powersum.html
-rw-r--r--      3654 2017-03-28 06:06 function.trader-mavp.html
-rw-r--r--     10642 2017-03-28 06:06 function.eio-mknod.html
-rw-r--r--      4905 2017-03-28 06:06 function.cairo-ps-surface-create.html
-rw-r--r--      2746 2017-03-28 06:06 swftextfield.setrightmargin.html
-rw-r--r--      2951 2017-03-28 06:05 function.m-setssl-cafile.html
-rw-r--r--      7514 2017-03-28 06:06 imagick.setimageartifact.html
-rw-r--r--      8658 2017-03-28 06:06 function.cubrid-col-get.html
-rw-r--r--      2389 2017-03-28 06:06 imagickdraw.resetvectorgraphics.html
-rw-r--r--     16756 2017-03-28 06:06 function.eio-readdir.html
-rw-r--r--      3262 2017-03-28 06:07 solrquery.sethighlightfragmenter.html
-rw-r--r--      8895 2017-03-28 06:06 intldateformatter.gettimezoneid.html
-rw-r--r--      2226 2017-03-28 06:07 function.msession-find.html
-rw-r--r--      7752 2017-03-28 06:06 gearmanworker.addfunction.html
-rw-r--r--      2634 2017-03-28 06:06 ref.pdo-dblib.html
-rw-r--r--      3487 2017-03-28 06:06 transliterator.construct.html
-rw-r--r--      5115 2017-03-28 06:07 memcached.callbacks.result.html
-rw-r--r--      2795 2017-03-28 06:06 spldoublylinkedlist.top.html
-rw-r--r--      2692 2017-03-28 06:06 imagick.setgravity.html
-rw-r--r--      2495 2017-03-28 06:06 imagickdraw.gettextinterlinespacing.html
-rw-r--r--      4875 2017-03-28 06:07 book.xmlreader.html
-rw-r--r--      7386 2017-03-28 06:06 function.mysql-close.html
-rw-r--r--      3575 2017-03-28 06:06 function.dbplus-flush.html
-rw-r--r--      2858 2017-03-28 06:06 mongogridfsfile.construct.html
-rw-r--r--      2813 2017-03-28 06:07 xmldiff-memory.diff.html
-rw-r--r--      9963 2017-03-28 06:06 pdo.query.html
-rw-r--r--      6363 2017-03-28 06:06 image.examples-watermark.html
-rw-r--r--     17391 2017-03-28 06:06 pdo.prepared-statements.html
-rw-r--r--      1455 2017-03-28 06:05 phar.creating.html
-rw-r--r--      1287 2017-03-28 06:06 pdo.requirements.html
-rw-r--r--      8655 2017-03-28 06:07 ds-hashable.hash.html
-rw-r--r--     12220 2017-03-28 06:07 session.security.ini.html
-rw-r--r--      2199 2017-03-28 06:05 bcompiler.installation.html
-rw-r--r--     16270 2017-03-28 06:06 datetime.construct.html
-rw-r--r--      6794 2017-03-28 06:06 function.ibase-num-fields.html
-rw-r--r--      2538 2017-03-28 06:06 function.pdf-fill-textblock.html
-rw-r--r--      3817 2017-03-28 06:06 mbstring.ja-basic.html
-rw-r--r--      3013 2017-03-28 06:06 function.fann-copy.html
-rw-r--r--      2336 2017-03-28 06:06 function.maxdb-thread-safe.html
-rw-r--r--      7683 2017-03-28 06:06 dateperiod.getenddate.html
-rw-r--r--      2916 2017-03-28 06:06 ev.stop.html
-rw-r--r--      8511 2017-03-28 06:07 function.strtok.html
-rw-r--r--      6360 2017-03-28 06:06 cairofontface.status.html
-rw-r--r--      7504 2017-03-28 06:06 function.cubrid-is-instance.html
-rw-r--r--      6906 2017-03-28 06:07 function.session-set-cookie-params.html
-rw-r--r--      6374 2017-03-28 06:06 function.proc-get-status.html
-rw-r--r--      4460 2017-03-28 06:05 function.id3-get-frame-short-name.html
-rw-r--r--      2509 2017-03-28 06:07 ui-draw-matrix.rotate.html
-rw-r--r--      4845 2017-03-28 06:06 mongodb-bson-binary.getdata.html
-rw-r--r--      2683 2017-03-28 06:05 function.m-transinqueue.html
-rw-r--r--      2995 2017-03-28 06:06 function.oci-free-descriptor.html
-rw-r--r--      1901 2017-03-28 06:06 function.date-date-set.html
-rw-r--r--      3627 2017-03-28 06:05 function.ncurses-getmaxyx.html
-rw-r--r--      2330 2017-03-28 06:06 imagick.clipimage.html
-rw-r--r--      2871 2017-03-28 06:07 internals2.opcodes.pre-dec.html
-rw-r--r--      3539 2017-03-28 06:05 function.mcrypt-module-get-algo-key-size.html
-rw-r--r--      6667 2017-03-28 06:06 mysqli-stmt.attr-set.html
-rw-r--r--     62336 2017-03-28 06:07 migration70.incompatible.html
-rw-r--r--      6760 2017-03-28 06:07 zookeeper.getacl.html
-rw-r--r--      3223 2017-03-28 06:06 cubrid.resources.html
-rw-r--r--      4785 2017-03-28 06:06 function.posix-getgid.html
-rw-r--r--      3972 2017-03-28 06:06 function.fbsql-stop-db.html
-rw-r--r--      2905 2017-03-28 06:06 harupage.getlinewidth.html
-rw-r--r--      5498 2017-03-28 06:07 function.yaz-sort.html
-rw-r--r--      7089 2017-03-28 06:07 swish.constants.html
-rw-r--r--      2202 2017-03-28 06:07 ui-draw-pen.clip.html
-rw-r--r--      5897 2017-03-28 06:06 function.date-sun-info.html
-rw-r--r--      7341 2017-03-28 06:07 zookeeper.setacl.html
-rw-r--r--      5401 2017-03-28 06:06 harupage.textrect.html
-rw-r--r--     42087 2017-03-28 06:06 sqlsrv.constants.html
-rw-r--r--      4165 2017-03-28 06:07 sdo-list.insert.html
-rw-r--r--      1516 2017-03-28 06:06 dbplus.constants.html
-rw-r--r--      7071 2017-03-28 06:07 function.crc32.html
-rw-r--r--      5033 2017-03-28 06:06 function.gnupg-export.html
-rw-r--r--      3249 2017-03-28 06:06 function.trader-cdlhammer.html
-rw-r--r--     11253 2017-03-28 06:06 function.eio-fstat.html
-rw-r--r--      1585 2017-03-28 06:06 mysqlnd-memcache.setup.html
-rw-r--r--      3305 2017-03-28 06:07 class.reflectiontype.html
-rw-r--r--      3254 2017-03-28 06:07 sdo-das-datafactory.getdatafactory.html
-rw-r--r--      3307 2017-03-28 06:05 function.ncurses-clrtoeol.html
-rw-r--r--      1517 2017-03-28 06:07 nsapi.setup.html
-rw-r--r--      6242 2017-03-28 06:07 function.rsort.html
-rw-r--r--      3428 2017-03-28 06:06 harudoc.getstreamsize.html
-rw-r--r--      2542 2017-03-28 06:06 yaf-application.run.html
-rw-r--r--      3744 2017-03-28 06:07 function.session-save-path.html
-rw-r--r--      2922 2017-03-28 06:06 harupage.getgraystroke.html
-rw-r--r--      1689 2017-03-28 06:05 xhprof.installation.html
-rw-r--r--      2783 2017-03-28 06:06 yaf-loader.setlibrarypath.html
-rw-r--r--      2114 2017-03-28 06:05 intro.mhash.html
-rw-r--r--      8856 2017-03-28 06:06 class.cairofontoptions.html
-rw-r--r--      2507 2017-03-28 06:06 function.pdf-begin-page.html
-rw-r--r--      2879 2017-03-28 06:07 function.svn-repos-create.html
-rw-r--r--     19947 2017-03-28 06:06 class.gmagickdraw.html
-rw-r--r--      9468 2017-03-28 06:06 mongodb-driver-writeconcern.construct.html
-rw-r--r--      2985 2017-03-28 06:06 datetime.wakeup.html
-rw-r--r--      3061 2017-03-28 06:07 solrutils.escapequerychars.html
-rw-r--r--      1342 2017-03-28 06:07 zookeeper.resources.html
-rw-r--r--      2669 2017-03-28 06:06 yaf-dispatcher.setdefaultaction.html
-rw-r--r--      1335 2017-03-28 06:07 nis.configuration.html
-rw-r--r--      1523 2017-03-28 06:06 exec.setup.html
-rw-r--r--      4416 2017-03-28 06:06 function.cairo-surface-show-page.html
-rw-r--r--      7900 2017-03-28 06:06 dateinterval.construct.html
-rw-r--r--      1424 2017-03-28 06:07 mqseries.ini.html
-rw-r--r--      5061 2017-03-28 06:06 mongoclient.listdbs.html
-rw-r--r--      3123 2017-03-28 06:06 function.px-get-field.html
-rw-r--r--      4620 2017-03-28 06:07 domelement.setidattribute.html
-rw-r--r--      2949 2017-03-28 06:06 swffill.moveto.html
-rw-r--r--      5601 2017-03-28 06:06 imagick.trimimage.html
-rw-r--r--      6603 2017-03-28 06:05 function.hash-equals.html
-rw-r--r--      1469 2017-03-28 06:05 intro.id3.html
-rw-r--r--      4890 2017-03-28 06:06 threaded.unlock.html
-rw-r--r--      1315 2017-03-28 06:07 sockets.requirements.html
-rw-r--r--     14953 2017-03-28 06:05 info.constants.html
-rw-r--r--      4295 2017-03-28 06:07 sphinxclient.setmatchmode.html
-rw-r--r--      4542 2017-03-28 06:06 function.recode-string.html
-rw-r--r--      6552 2017-03-28 06:06 imagick.normalizeimage.html
-rw-r--r--     12340 2017-03-28 06:06 mysqli-result.lengths.html
-rw-r--r--      4552 2017-03-28 06:06 evloop.defaultloop.html
-rw-r--r--      6049 2017-03-28 06:06 locale.getdefault.html
-rw-r--r--      1511 2017-03-28 06:07 xml.examples.html
-rw-r--r--      2371 2017-03-28 06:05 reserved.variables.httprawpostdata.html
-rw-r--r--     16382 2017-03-28 06:05 function.mcrypt-encrypt.html
-rw-r--r--      9725 2017-03-28 06:06 ref.pdo-odbc.html
-rw-r--r--      7290 2017-03-28 06:05 phar.copy.html
-rw-r--r--      3942 2017-03-28 06:07 function.xmlwriter-end-pi.html
-rw-r--r--      6286 2017-03-28 06:06 function.posix-getgrnam.html
-rw-r--r--      2060 2017-03-28 06:06 openssl.constants.html
-rw-r--r--     12973 2017-03-28 06:05 language.types.callable.html
-rw-r--r--      4690 2017-03-28 06:06 sqlite.installation.html
-rw-r--r--      2090 2017-03-28 06:05 ref.opcache.html
-rw-r--r--      5781 2017-03-28 06:07 reflectionclass.tostring.html
-rw-r--r--      4326 2017-03-28 06:06 function.gnupg-clearsignkeys.html
-rw-r--r--      1489 2017-03-28 06:06 pdf.setup.html
-rw-r--r--      4601 2017-03-28 06:06 function.cairo-matrix-rotate.html
-rw-r--r--      1408 2017-03-28 06:05 ref.rar.html
-rw-r--r--      3340 2017-03-28 06:06 swfdisplayitem.setdepth.html
-rw-r--r--      3776 2017-03-28 06:05 function.uopz-overload.html
-rw-r--r--      4172 2017-03-28 06:05 phardata.setstub.html
-rw-r--r--      4263 2017-03-28 06:07 function.convert-uuencode.html
-rw-r--r--      3120 2017-03-28 06:07 solrquery.sethighlightmaxanalyzedchars.html
-rw-r--r--      3081 2017-03-28 06:05 function.newt-listbox-set-entry.html
-rw-r--r--      6880 2017-03-28 06:07 memcache.add.html
-rw-r--r--      2866 2017-03-28 06:07 internals2.opcodes.pre-inc.html
-rw-r--r--      3062 2017-03-28 06:06 function.stats-dens-negative-binomial.html
-rw-r--r--      4573 2017-03-28 06:07 domcharacterdata.insertdata.html
-rw-r--r--      1789 2017-03-28 06:07 internals2.opcodes.ext-nop.html
-rw-r--r--      3277 2017-03-28 06:06 oci-collection.assign.html
-rw-r--r--      7071 2017-03-28 06:06 function.enchant-dict-quick-check.html
-rw-r--r--      5258 2017-03-28 06:06 class.haruencoder.html
-rw-r--r--      6275 2017-03-28 06:07 swishresults.seekresult.html
-rw-r--r--      7307 2017-03-28 06:06 function.ingres-fetch-row.html
-rw-r--r--      2652 2017-03-28 06:06 harupage.getcmykstroke.html
-rw-r--r--      3022 2017-03-28 06:06 function.openssl-dh-compute-key.html
-rw-r--r--      1934 2017-03-28 06:06 ref.cyrus.html
-rw-r--r--      2049 2017-03-28 06:06 function.ocierror.html
-rw-r--r--      3766 2017-03-28 06:06 function.fann-set-sarprop-step-error-threshold-factor.html
-rw-r--r--      8661 2017-03-28 06:06 class.mongodb-driver-exception-writeexception.html
-rw-r--r--      2982 2017-03-28 06:07 solrquery.setmltmintermfrequency.html
-rw-r--r--      1255 2017-03-28 06:07 zookeeper.constants.html
-rw-r--r--      6155 2017-03-28 06:06 function.trader-sarext.html
-rw-r--r--      2607 2017-03-28 06:05 function.readline-write-history.html
-rw-r--r--     18447 2017-03-28 06:05 zip.examples.html
-rw-r--r--      3086 2017-03-28 06:06 function.enchant-dict-check.html
-rw-r--r--      2710 2017-03-28 06:05 function.ncurses-attrset.html
-rw-r--r--      5853 2017-03-28 06:06 directoryiterator.getatime.html
-rw-r--r--      4646 2017-03-28 06:06 function.expect-popen.html
-rw-r--r--      6801 2017-03-28 06:07 function.socket-read.html
-rw-r--r--      4602 2017-03-28 06:06 splfileinfo.tostring.html
-rw-r--r--      5418 2017-03-28 06:06 function.mt-getrandmax.html
-rw-r--r--      2794 2017-03-28 06:06 swftextfield.setleftmargin.html
-rw-r--r--      8439 2017-03-28 06:05 configuration.changes.html
-rw-r--r--      5432 2017-03-28 06:06 cairocontext.infill.html
-rw-r--r--      5623 2017-03-28 06:07 function.ssh2-sftp-symlink.html
-rw-r--r--     11551 2017-03-28 06:07 function.array-walk.html
-rw-r--r--      4113 2017-03-28 06:07 reflectionextension.getversion.html
-rw-r--r--      2630 2017-03-28 06:06 function.ming-setswfcompression.html
-rw-r--r--      9209 2017-03-28 06:07 function.property-exists.html
-rw-r--r--      3512 2017-03-28 06:05 security.html
-rw-r--r--      3606 2017-03-28 06:05 function.zip-read.html
-rw-r--r--      2934 2017-03-28 06:06 hrtime-performancecounter.gettickssince.html
-rw-r--r--      4556 2017-03-28 06:06 imagick.transposeimage.html
-rw-r--r--      4941 2017-03-28 06:07 class.xmldiff-memory.html
-rw-r--r--      3067 2017-03-28 06:06 function.event-priority-set.html
-rw-r--r--      2634 2017-03-28 06:06 function.filepro-fieldcount.html
-rw-r--r--      2958 2017-03-28 06:06 gmagick.medianfilterimage.html
-rw-r--r--      5263 2017-03-28 06:06 gearmanclient.setcompletecallback.html
-rw-r--r--     13810 2017-03-28 06:06 function.oci-password-change.html
-rw-r--r--      2847 2017-03-28 06:06 yaf-session.offsetset.html
-rw-r--r--      6722 2017-03-28 06:07 function.array-rand.html
-rw-r--r--      6864 2017-03-28 06:07 function.inet-ntop.html
-rw-r--r--      4244 2017-03-28 06:06 function.ps-symbol-width.html
-rw-r--r--      1964 2017-03-28 06:07 history.php.publications.html
-rw-r--r--      3004 2017-03-28 06:06 book.fileinfo.html
-rw-r--r--      2393 2017-03-28 06:06 imagickpixel.clear.html
-rw-r--r--      4250 2017-03-28 06:06 imagick.painttransparentimage.html
-rw-r--r--      5528 2017-03-28 06:07 internals2.opcodes.fe-reset.html
-rw-r--r--      6800 2017-03-28 06:07 varnish.constants.html
-rw-r--r--      2959 2017-03-28 06:05 function.m-getcommadelimited.html
-rw-r--r--      7613 2017-03-28 06:06 function.get-browser.html
-rw-r--r--      3827 2017-03-28 06:06 function.cubrid-lob2-new.html
-rw-r--r--      7558 2017-03-28 06:06 mysqli-stmt.send-long-data.html
-rw-r--r--      2866 2017-03-28 06:06 cachingiterator.offsetexists.html
-rw-r--r--      2490 2017-03-28 06:06 swffont.getutf8width.html
-rw-r--r--    114603 2017-03-28 06:07 doc.changelog.html
-rw-r--r--      4652 2017-03-28 06:07 ds-sequence.allocate.html
-rw-r--r--      5403 2017-03-28 06:06 function.disk-free-space.html
-rw-r--r--      7768 2017-03-28 06:06 haru.builtin.encodings.html
-rw-r--r--      2403 2017-03-28 06:06 ev.verify.html
-rw-r--r--     57299 2017-03-28 06:06 function.strftime.html
-rw-r--r--      3741 2017-03-28 06:06 function.imap-bodystruct.html
-rw-r--r--      8804 2017-03-28 06:06 function.imageloadfont.html
-rw-r--r--      4603 2017-03-28 06:06 function.ps-curveto.html
-rw-r--r--      7007 2017-03-28 06:05 phardata.copy.html
-rw-r--r--      2874 2017-03-28 06:06 gmagick.setimagedispose.html
-rw-r--r--      3684 2017-03-28 06:06 gearmanjob.exception.html
-rw-r--r--      4739 2017-03-28 06:07 reflectionclass.getdoccomment.html
-rw-r--r--      4306 2017-03-28 06:06 function.fann-test-data.html
-rw-r--r--      3092 2017-03-28 06:06 multipleiterator.valid.html
-rw-r--r--      2633 2017-03-28 06:07 ui-menu.appendpreferences.html
-rw-r--r--     22189 2017-03-28 06:06 mongocollection.createindex.html
-rw-r--r--     12533 2017-03-28 06:06 function.db2-client-info.html
-rw-r--r--      1314 2017-03-28 06:07 hwapi.resources.html
-rw-r--r--      3407 2017-03-28 06:06 function.ifxus-create-slob.html
-rw-r--r--      1339 2017-03-28 06:07 debugger.html
-rw-r--r--      1323 2017-03-28 06:06 json.requirements.html
-rw-r--r--      2301 2017-03-28 06:07 ldap.using.html
-rw-r--r--      6118 2017-03-28 06:06 book.ingres.html
-rw-r--r--     20960 2017-03-28 06:05 wincache.configuration.html
-rw-r--r--      4469 2017-03-28 06:07 internals2.opcodes.fetch-dim-w.html
-rw-r--r--      2214 2017-03-28 06:07 ui-menuitem.setchecked.html
-rw-r--r--      3309 2017-03-28 06:06 function.trader-cdlhomingpigeon.html
-rw-r--r--      2976 2017-03-28 06:06 mongodb-driver-cursorid.construct.html
-rw-r--r--      2658 2017-03-28 06:06 eventdnsbase.addsearch.html
-rw-r--r--      1496 2017-03-28 06:06 intro.fileinfo.html
-rw-r--r--      3072 2017-03-28 06:05 security.database.design.html
-rw-r--r--      2260 2017-03-28 06:06 function.pdf-get-parameter.html
-rw-r--r--      2782 2017-03-28 06:06 eventbuffer.expand.html
-rw-r--r--      6742 2017-03-28 06:07 ds-set.get.html
-rw-r--r--      3731 2017-03-28 06:05 function.runkit-constant-redefine.html
-rw-r--r--      3169 2017-03-28 06:06 oci-lob.save.html
-rw-r--r--      1431 2017-03-28 06:05 hash.resources.html
-rw-r--r--      5180 2017-03-28 06:07 class.xmldiff-dom.html
-rw-r--r--      1609 2017-03-28 06:07 pcre.pattern.html
-rw-r--r--     12209 2017-03-28 06:06 imagickdraw.pathcurvetoquadraticbezierabsolute.html
-rw-r--r--      9549 2017-03-28 06:06 class.tidynode.html
-rw-r--r--    353041 2017-03-28 06:06 class.intlchar.html
-rw-r--r--      6171 2017-03-28 06:07 solrdismaxquery.removeuserfield.html
-rw-r--r--      2547 2017-03-28 06:06 yaf-request-simple.get.html
-rw-r--r--      6017 2017-03-28 06:07 function.md5.html
-rw-r--r--     10806 2017-03-28 06:05 function.runkit-method-redefine.html
-rw-r--r--      3405 2017-03-28 06:06 function.fann-get-cascade-max-out-epochs.html
-rw-r--r--      2686 2017-03-28 06:06 lua.include.html
-rw-r--r--      1663 2017-03-28 06:06 intro.pgsql.html
-rw-r--r--      7122 2017-03-28 06:06 ev.embeddablebackends.html
-rw-r--r--      3002 2017-03-28 06:05 function.ncurses-has-ic.html
-rw-r--r--      4252 2017-03-28 06:06 ref.sybase.html
-rw-r--r--      5877 2017-03-28 06:07 function.mqseries-put1.html
-rw-r--r--      7828 2017-03-28 06:06 function.db2-column-privileges.html
-rw-r--r--      2262 2017-03-28 06:06 curlfile.getpostfilename.html
-rw-r--r--      3391 2017-03-28 06:06 function.stats-rand-gen-ibinomial-negative.html
-rw-r--r--      8102 2017-03-28 06:06 cairocontext.getantialias.html
-rw-r--r--      3056 2017-03-28 06:05 function.newt-grid-v-stacked.html
-rw-r--r--      5536 2017-03-28 06:07 reflectiongenerator.getfunction.html
-rw-r--r--      2668 2017-03-28 06:05 rarentry.tostring.html
-rw-r--r--      2778 2017-03-28 06:06 gmagick.getimagewhitepoint.html
-rw-r--r--      2754 2017-03-28 06:07 internals2.opcodes.echo.html
-rw-r--r--      2468 2017-03-28 06:06 gearmantask.isrunning.html
-rw-r--r--      5244 2017-03-28 06:06 function.imap-check.html
-rw-r--r--      5142 2017-03-28 06:06 function.gnupg-adddecryptkey.html
-rw-r--r--     11070 2017-03-28 06:06 class.imagickpixel.html
-rw-r--r--      2481 2017-03-28 06:07 hwapi.object-title.html
-rw-r--r--      2314 2017-03-28 06:06 imagick.getfilename.html
-rw-r--r--     13696 2017-03-28 06:07 function.trim.html
-rw-r--r--     11550 2017-03-28 06:06 function.sqlsrv-rollback.html
-rw-r--r--      2216 2017-03-28 06:07 ui-menu.construct.html
-rw-r--r--      4495 2017-03-28 06:06 ingres.installation.html
-rw-r--r--      5305 2017-03-28 06:06 cairocontext.setantialias.html
-rw-r--r--      4889 2017-03-28 06:06 cairocontext.popgroup.html
-rw-r--r--      5008 2017-03-28 06:06 cairosurface.getfontoptions.html
-rw-r--r--      4289 2017-03-28 06:06 eventhttprequest.sendreplystart.html
-rw-r--r--      3156 2017-03-28 06:06 arrayiterator.unserialize.html
-rw-r--r--      2827 2017-03-28 06:06 function.px-numfields.html
-rw-r--r--     14394 2017-03-28 06:06 function.cubrid-fetch-field.html
-rw-r--r--      1515 2017-03-28 06:05 crack.setup.html
-rw-r--r--      1501 2017-03-28 06:06 dio.setup.html
-rw-r--r--      3148 2017-03-28 06:06 function.mysqlnd-qc-clear-cache.html
-rw-r--r--      7512 2017-03-28 06:07 ds-sequence.slice.html
-rw-r--r--     16546 2017-03-28 06:06 function.file-get-contents.html
-rw-r--r--      3587 2017-03-28 06:06 function.filepro-retrieve.html
-rw-r--r--      2644 2017-03-28 06:06 function.trader-sma.html
-rw-r--r--      4916 2017-03-28 06:06 cubridmysql.cubrid.html
-rw-r--r--      7347 2017-03-28 06:06 function.cubrid-lob-close.html
-rw-r--r--      3949 2017-03-28 06:07 sphinxclient.setfilter.html
-rw-r--r--      1913 2017-03-28 06:06 class.cairopath.html
-rw-r--r--      3364 2017-03-28 06:05 function.mcrypt-module-close.html
-rw-r--r--      2739 2017-03-28 06:07 reflectionzendextension.construct.html
-rw-r--r--      3546 2017-03-28 06:06 class.mongoexecutiontimeoutexception.html
-rw-r--r--      3837 2017-03-28 06:06 function.fann-scale-output.html
-rw-r--r--      7200 2017-03-28 06:06 syncsharedmemory.write.html
-rw-r--r--      6268 2017-03-28 06:06 function.curl-strerror.html
-rw-r--r--      4047 2017-03-28 06:07 yar-client.construct.html
-rw-r--r--      3234 2017-03-28 06:06 swfshape.drawline.html
-rw-r--r--      2739 2017-03-28 06:06 cachingiterator.offsetget.html
-rw-r--r--      2582 2017-03-28 06:06 imagickdraw.getstrokedasharray.html
-rw-r--r--      3362 2017-03-28 06:06 gmagick.setimagechanneldepth.html
-rw-r--r--      1930 2017-03-28 06:06 sqlsrv.resources.html
-rw-r--r--      7907 2017-03-28 06:06 mongodb-bson-utcdatetime.construct.html
-rw-r--r--      4821 2017-03-28 06:06 gearmanclient.setfailcallback.html
-rw-r--r--      4711 2017-03-28 06:07 ds-priorityqueue.copy.html
-rw-r--r--      2980 2017-03-28 06:06 evloop.now.html
-rw-r--r--     47281 2017-03-28 06:07 internals2.pdo.implementing.html
-rw-r--r--      4738 2017-03-28 06:07 varnishadmin.construct.html
-rw-r--r--      5449 2017-03-28 06:07 book.zmq.html
-rw-r--r--      4144 2017-03-28 06:07 domelement.getattributenodens.html
-rw-r--r--      2932 2017-03-28 06:06 recursiveiteratoriterator.callhaschildren.html
-rw-r--r--      2551 2017-03-28 06:06 cachingiterator.rewind.html
-rw-r--r--      6959 2017-03-28 06:07 memcached.setoptions.html
-rw-r--r--      7162 2017-03-28 06:07 reflectionmethod.invoke.html
-rw-r--r--      7794 2017-03-28 06:07 function.prev.html
-rw-r--r--      7023 2017-03-28 06:06 streamwrapper.stream-open.html
-rw-r--r--     15496 2017-03-28 06:06 function.maxdb-prepare.html
-rw-r--r--      9712 2017-03-28 06:06 function.imap-status.html
-rw-r--r--      9430 2017-03-28 06:06 function.ps-set-text-pos.html
-rw-r--r--      3853 2017-03-28 06:06 evloop.periodic.html
-rw-r--r--      6011 2017-03-28 06:05 control-structures.break.html
-rw-r--r--      5603 2017-03-28 06:06 mongodbref.get.html
-rw-r--r--      2010 2017-03-28 06:06 function.mysqli-set-opt.html
-rw-r--r--      5959 2017-03-28 06:06 function.gmp-div-r.html
-rw-r--r--      3532 2017-03-28 06:05 security.general.html
-rw-r--r--      2187 2017-03-28 06:06 intro.fam.html
-rw-r--r--      3094 2017-03-28 06:06 harudoc.save.html
-rw-r--r--      4761 2017-03-28 06:07 memcache.constants.html
-rw-r--r--      4040 2017-03-28 06:07 ds-set.capacity.html
-rw-r--r--      7763 2017-03-28 06:06 function.ftp-put.html
-rw-r--r--      2511 2017-03-28 06:07 ui-controls-colorbutton.getcolor.html
-rw-r--r--      2425 2017-03-28 06:06 function.pdf-setgray-fill.html
-rw-r--r--      4889 2017-03-28 06:06 cairosurface.showpage.html
-rw-r--r--      2443 2017-03-28 06:06 function.pdf-setfont.html
-rw-r--r--      1533 2017-03-28 06:06 intro.exif.html
-rw-r--r--      2108 2017-03-28 06:05 copyright.html
-rw-r--r--      2328 2017-03-28 06:06 intro.pdo.html
-rw-r--r--      4078 2017-03-28 06:07 zmqdevice.settimercallback.html
-rw-r--r--      9204 2017-03-28 06:06 imagickdraw.circle.html
-rw-r--r--      4776 2017-03-28 06:06 cairo.versionstring.html
-rw-r--r--      2682 2017-03-28 06:07 sdo-das-changesummary.beginlogging.html
-rw-r--r--      1308 2017-03-28 06:05 opcache.resources.html
-rw-r--r--      3991 2017-03-28 06:06 function.sqlite-fetch-object.html
-rw-r--r--      2306 2017-03-28 06:06 function.pdf-info-matchbox.html
-rw-r--r--      3512 2017-03-28 06:07 class.domnodelist.html
-rw-r--r--      3839 2017-03-28 06:06 evcheck.construct.html
-rw-r--r--      2648 2017-03-28 06:06 intlbreakiterator.construct.html
-rw-r--r--      3474 2017-03-28 06:06 limititerator.next.html
-rw-r--r--      3990 2017-03-28 06:06 mongocursor.immortal.html
-rw-r--r--      3033 2017-03-28 06:07 ui-draw-brush-radialgradient.construct.html
-rw-r--r--      3719 2017-03-28 06:06 recursivefilteriterator.getchildren.html
-rw-r--r--      3364 2017-03-28 06:05 serializable.unserialize.html
-rw-r--r--      2785 2017-03-28 06:05 function.ncurses-timeout.html
-rw-r--r--      4650 2017-03-28 06:06 lua.assign.html
-rw-r--r--      1479 2017-03-28 06:06 intro.yaml.html
-rw-r--r--      8134 2017-03-28 06:05 rararchive.isbroken.html
-rw-r--r--      3111 2017-03-28 06:06 gmagick.reducenoiseimage.html
-rw-r--r--      2734 2017-03-28 06:07 function.yp-cat.html
-rw-r--r--      3668 2017-03-28 06:06 streamwrapper.stream-cast.html
-rw-r--r--      7206 2017-03-28 06:06 intlcalendar.gettimezone.html
-rw-r--r--      2940 2017-03-28 06:07 internals2.opcodes.assign-concat.html
-rw-r--r--      2708 2017-03-28 06:06 function.openssl-x509-free.html
-rw-r--r--      1964 2017-03-28 06:07 intro.xmlrpc.html
-rw-r--r--      7873 2017-03-28 06:07 domxpath.evaluate.html
-rw-r--r--      3670 2017-03-28 06:07 migration70.classes.html
-rw-r--r--      2956 2017-03-28 06:06 function.trader-plus-dm.html
-rw-r--r--      3040 2017-03-28 06:06 function.dbplus-undo.html
-rw-r--r--      3344 2017-03-28 06:06 eventutil.getsocketfd.html
-rw-r--r--      2514 2017-03-28 06:06 imagickdraw.pathclose.html
-rw-r--r--      7212 2017-03-28 06:06 function.stream-copy-to-stream.html
-rw-r--r--      2870 2017-03-28 06:06 yaf-dispatcher.flushinstantly.html
-rw-r--r--      4383 2017-03-28 06:06 arrayobject.offsetunset.html
-rw-r--r--      1510 2017-03-28 06:05 kadm5.setup.html
-rw-r--r--      5461 2017-03-28 06:06 cairocontext.scale.html
-rw-r--r--      5425 2017-03-28 06:07 function.ssh2-sftp-readlink.html
-rw-r--r--      8712 2017-03-28 06:06 lapack.solvelinearequation.html
-rw-r--r--      2336 2017-03-28 06:06 imagickdraw.getfont.html
-rw-r--r--      5672 2017-03-28 06:07 function.ssh2-sftp-realpath.html
-rw-r--r--      9443 2017-03-28 06:06 mysqlnd-ms.changes-one-six.html
-rw-r--r--      4107 2017-03-28 06:06 mongo.tutorial.cursor.html
-rw-r--r--      3975 2017-03-28 06:06 cairosurfacepattern.setextend.html
-rw-r--r--      4401 2017-03-28 06:06 function.cairo-surface-get-type.html
-rw-r--r--      3008 2017-03-28 06:06 mongoint32.construct.html
-rw-r--r--      6007 2017-03-28 06:05 function.kadm5-get-principal.html
-rw-r--r--      2431 2017-03-28 06:06 imagick.getimagefilename.html
-rw-r--r--     15088 2017-03-28 06:06 function.maxdb-fetch-field-direct.html
-rw-r--r--      5253 2017-03-28 06:06 yaml.callbacks.parse.html
-rw-r--r--      3455 2017-03-28 06:06 recursivedirectoryiterator.getsubpath.html
-rw-r--r--      3586 2017-03-28 06:06 function.fann-get-train-stop-function.html
-rw-r--r--      3925 2017-03-28 06:06 function.sqlite-libencoding.html
-rw-r--r--      5117 2017-03-28 06:07 reflectionclass.isfinal.html
-rw-r--r--      2713 2017-03-28 06:06 gmagickdraw.polyline.html
-rw-r--r--     10867 2017-03-28 06:06 appenditerator.construct.html
-rw-r--r--      2975 2017-03-28 06:06 swffill.scaleto.html
-rw-r--r--      2668 2017-03-28 06:06 swfsprite.setframes.html
-rw-r--r--      4339 2017-03-28 06:05 exception.tostring.html
-rw-r--r--      2780 2017-03-28 06:07 function.xmlrpc-server-register-introspection-callback.html
-rw-r--r--      4217 2017-03-28 06:07 ds-pair.isempty.html
-rw-r--r--      2003 2017-03-28 06:05 reserved.interfaces.html
-rw-r--r--      4491 2017-03-28 06:07 ds-map.pairs.html
-rw-r--r--      3118 2017-03-28 06:06 function.dbplus-xunlockrel.html
-rw-r--r--      3469 2017-03-28 06:06 evloop.child.html
-rw-r--r--      4114 2017-03-28 06:06 ev.watcher-callbacks.html
-rw-r--r--      5772 2017-03-28 06:07 function.gupnp-context-host-path.html
-rw-r--r--      3372 2017-03-28 06:06 ev.depth.html
-rw-r--r--      3072 2017-03-28 06:07 migration52.other.html
-rw-r--r--      3213 2017-03-28 06:06 swfsprite.add.html
-rw-r--r--      3521 2017-03-28 06:07 reflectionfunctionabstract.getnumberofrequiredparameters.html
-rw-r--r--      2708 2017-03-28 06:06 gearmanworker.error.html
-rw-r--r--      1426 2017-03-28 06:05 ncurses.errconsts.html
-rw-r--r--      3709 2017-03-28 06:06 harupage.curveto2.html
-rw-r--r--      2756 2017-03-28 06:06 sqlite3stmt.readonly.html
-rw-r--r--      1335 2017-03-28 06:07 sdo.configuration.html
-rw-r--r--      2157 2017-03-28 06:06 intro.paradox.html
-rw-r--r--     21375 2017-03-28 06:06 mongo.queries.html
-rw-r--r--      2045 2017-03-28 06:05 intro.readline.html
-rw-r--r--      2448 2017-03-28 06:05 function.ncurses-hide-panel.html
-rw-r--r--      2409 2017-03-28 06:07 ui-controls-box.construct.html
-rw-r--r--      2211 2017-03-28 06:06 datetime.installation.html
-rw-r--r--      8057 2017-03-28 06:06 function.stream-filter-prepend.html
-rw-r--r--      3772 2017-03-28 06:06 function.fann-set-cascade-candidate-change-fraction.html
-rw-r--r--     21210 2017-03-28 06:05 info.configuration.html
-rw-r--r--      7829 2017-03-28 06:06 function.pcntl-wait.html
-rw-r--r--      3766 2017-03-28 06:06 function.pdf-begin-page-ext.html
-rw-r--r--      3040 2017-03-28 06:07 hwapi.copy.html
-rw-r--r--      4153 2017-03-28 06:07 sphinxclient.setlimits.html
-rw-r--r--      3132 2017-03-28 06:06 function.trader-ad.html
-rw-r--r--      4347 2017-03-28 06:07 solrquery.setexpandrows.html
-rw-r--r--      7327 2017-03-28 06:06 mysqli.connect-errno.html
-rw-r--r--      7011 2017-03-28 06:06 ref.pdo-sqlsrv.connection.html
-rw-r--r--      3171 2017-03-28 06:06 haruencoder.gettype.html
-rw-r--r--      1530 2017-03-28 06:07 sdo-das-xml.installation.html
-rw-r--r--      1720 2017-03-28 06:07 quickhash.installation.html
-rw-r--r--      4577 2017-03-28 06:06 function.dbx-close.html
-rw-r--r--      2254 2017-03-28 06:07 pcre.examples.html
-rw-r--r--      3031 2017-03-28 06:07 function.svn-fs-copy.html
-rw-r--r--      2988 2017-03-28 06:07 sdo-das-dataobject.getchangesummary.html
-rw-r--r--      7817 2017-03-28 06:06 class.splheap.html
-rw-r--r--      3561 2017-03-28 06:06 mongo.getslaveokay.html
-rw-r--r--      3700 2017-03-28 06:06 haruannotation.sethighlightmode.html
-rw-r--r--      6422 2017-03-28 06:05 ref.mcrypt.html
-rw-r--r--      4441 2017-03-28 06:07 oauthprovider.is2leggedendpoint.html
-rw-r--r--      5400 2017-03-28 06:06 directoryiterator.getpathname.html
-rw-r--r--      3268 2017-03-28 06:07 zmqsocket.send.html
-rw-r--r--      2852 2017-03-28 06:07 reflector.tostring.html
-rw-r--r--     21146 2017-03-28 06:07 cc.license.html
-rw-r--r--      3481 2017-03-28 06:06 function.imap-msgno.html
-rw-r--r--      1379 2017-03-28 06:05 zip.requirements.html
-rw-r--r--      5400 2017-03-28 06:07 ds-sequence.rotate.html
-rw-r--r--      3580 2017-03-28 06:06 harupage.rectangle.html
-rw-r--r--      1397 2017-03-28 06:05 introduction.html
-rw-r--r--      4568 2017-03-28 06:06 function.cairo-pattern-create-for-surface.html
-rw-r--r--     11588 2017-03-28 06:07 libxml.constants.html
-rw-r--r--      1994 2017-03-28 06:06 intro.mysqlnd.html
-rw-r--r--      4444 2017-03-28 06:06 mongocommandcursor.batchsize.html
-rw-r--r--      2147 2017-03-28 06:07 yar.installation.html
-rw-r--r--      1437 2017-03-28 06:06 ref.judy.html
-rw-r--r--      4740 2017-03-28 06:06 recursivetreeiterator.construct.html
-rw-r--r--      2781 2017-03-28 06:06 function.stats-rand-gen-ipoisson.html
-rw-r--r--      5077 2017-03-28 06:05 function.mcrypt-enc-get-supported-key-sizes.html
-rw-r--r--      2340 2017-03-28 06:06 intro.chdb.html
-rw-r--r--      3260 2017-03-28 06:06 eventhttprequest.sendreplyend.html
-rw-r--r--      6709 2017-03-28 06:07 soapserver.addfunction.html
-rw-r--r--     16820 2017-03-28 06:06 function.parse-ini-file.html
-rw-r--r--      3662 2017-03-28 06:07 sdo-datafactory.create.html
-rw-r--r--      3301 2017-03-28 06:05 function.newt-form-destroy.html
-rw-r--r--      4358 2017-03-28 06:07 solrquery.addexpandfilterquery.html
-rw-r--r--      4969 2017-03-28 06:06 imagickpixel.getcolorcount.html
-rw-r--r--      6365 2017-03-28 06:05 function.output-reset-rewrite-vars.html
-rw-r--r--     10348 2017-03-28 06:07 function.snmp-set-valueretrieval.html
-rw-r--r--      1391 2017-03-28 06:06 ibm-db2.resources.html
-rw-r--r--      3356 2017-03-28 06:06 gmagick.scaleimage.html
-rw-r--r--      2844 2017-03-28 06:06 evloop.backend.html
-rw-r--r--      9904 2017-03-28 06:06 function.oci-set-edition.html
-rw-r--r--      4685 2017-03-28 06:05 ziparchive.deletename.html
-rw-r--r--      5068 2017-03-28 06:06 function.cubrid-get-charset.html
-rw-r--r--      3302 2017-03-28 06:06 eventbase.dispatch.html
-rw-r--r--      2675 2017-03-28 06:05 function.readline-read-history.html
-rw-r--r--      7650 2017-03-28 06:06 class.mongoexception.html
-rw-r--r--      2626 2017-03-28 06:05 rarentry.isencrypted.html
-rw-r--r--      4074 2017-03-28 06:05 function.memory-get-peak-usage.html
-rw-r--r--      4848 2017-03-28 06:06 cairocontext.getlinecap.html
-rw-r--r--      5689 2017-03-28 06:06 mongoclient.gethosts.html
-rw-r--r--      7157 2017-03-28 06:07 ds-map.remove.html
-rw-r--r--      2409 2017-03-28 06:06 judy.gettype.html
-rw-r--r--      5557 2017-03-28 06:07 function.variant-idiv.html
-rw-r--r--      1340 2017-03-28 06:06 rpmreader.examples.html
-rw-r--r--      3706 2017-03-28 06:07 oauthprovider.isrequesttokenendpoint.html
-rw-r--r--     11464 2017-03-28 06:07 faq.com.html
-rw-r--r--      3707 2017-03-28 06:07 function.xmlwriter-text.html
-rw-r--r--      2433 2017-03-28 06:05 function.radius-demangle.html
-rw-r--r--      1988 2017-03-28 06:06 function.timezone-transitions-get.html
-rw-r--r--      3713 2017-03-28 06:06 function.ps-close.html
-rw-r--r--      2747 2017-03-28 06:06 evloop.verify.html
-rw-r--r--      5607 2017-03-28 06:06 class.splbool.html
-rw-r--r--      7178 2017-03-28 06:06 timezones.america.html
-rw-r--r--      4212 2017-03-28 06:06 function.msql-data-seek.html
-rw-r--r--      1812 2017-03-28 06:06 function.imap-listmailbox.html
-rw-r--r--      3205 2017-03-28 06:06 oci-collection.getelem.html
-rw-r--r--      2540 2017-03-28 06:07 solrinputdocument.clear.html
-rw-r--r--      8076 2017-03-28 06:06 tidy.repairfile.html
-rw-r--r--      2674 2017-03-28 06:07 solrinputdocument.getfieldnames.html
-rw-r--r--      4794 2017-03-28 06:06 function.fann-create-sparse-array.html
-rw-r--r--     10492 2017-03-28 06:06 tokyotyrantquery.addcond.html
-rw-r--r--      1356 2017-03-28 06:07 xmlrpc.configuration.html
-rw-r--r--      3316 2017-03-28 06:06 harupage.sethorizontalscaling.html
-rw-r--r--      3211 2017-03-28 06:05 function.newt-checkbox-tree.html
-rw-r--r--      5521 2017-03-28 06:05 rarentry.getunpackedsize.html
-rw-r--r--      2781 2017-03-28 06:07 ui-area.onkey.html
-rw-r--r--      6657 2017-03-28 06:07 sdo-das-relational.applychanges.html
-rw-r--r--      1725 2017-03-28 06:07 solr.requirements.html
-rw-r--r--      6689 2017-03-28 06:06 class.swfbutton.html
-rw-r--r--      6646 2017-03-28 06:06 class.lua.html
-rw-r--r--     22705 2017-03-28 06:07 sdodasrel.examples.two-table.html
-rw-r--r--      2649 2017-03-28 06:06 arrayiterator.seek.html
-rw-r--r--      9895 2017-03-28 06:06 class.limititerator.html
-rw-r--r--      1355 2017-03-28 06:07 ds.setup.html
-rw-r--r--      9608 2017-03-28 06:07 function.session-destroy.html
-rw-r--r--      6315 2017-03-28 06:06 datetime.gettimestamp.html
-rw-r--r--      6730 2017-03-28 06:06 book.dbplus.html
-rw-r--r--      6360 2017-03-28 06:06 function.bcpowmod.html
-rw-r--r--      2288 2017-03-28 06:06 mongocursor.getnext.html
-rw-r--r--     28089 2017-03-28 06:07 book.ui.html
-rw-r--r--      6399 2017-03-28 06:06 book.sqlite3.html
-rw-r--r--      2759 2017-03-28 06:06 splfixedarray.current.html
-rw-r--r--      2949 2017-03-28 06:06 harupage.getmiterlimit.html
-rw-r--r--      4697 2017-03-28 06:06 function.pcntl-sigtimedwait.html
-rw-r--r--      3463 2017-03-28 06:06 harupage.setdash.html
-rw-r--r--      4805 2017-03-28 06:07 reflectionclass.getinterfacenames.html
-rw-r--r--      2611 2017-03-28 06:06 gmagick.getversion.html
-rw-r--r--      8649 2017-03-28 06:06 function.imagesetbrush.html
-rw-r--r--      2311 2017-03-28 06:06 imagickdraw.getfillrule.html
-rw-r--r--      2696 2017-03-28 06:06 recursivetreeiterator.key.html
-rw-r--r--      7592 2017-03-28 06:06 imagick.exportimagepixels.html
-rw-r--r--      4439 2017-03-28 06:06 function.cubrid-lob2-tell.html
-rw-r--r--      4484 2017-03-28 06:06 function.cairo-image-surface-get-stride.html
-rw-r--r--      4538 2017-03-28 06:07 solrparams.setparam.html
-rw-r--r--      2653 2017-03-28 06:06 recursivedirectoryiterator.next.html
-rw-r--r--      5784 2017-03-28 06:07 ds-map.diff.html
-rw-r--r--      4001 2017-03-28 06:06 function.sqlite-last-error.html
-rw-r--r--      2777 2017-03-28 06:07 sdo-das-xml-document.setencoding.html
-rw-r--r--     10501 2017-03-28 06:05 phar.converttodata.html
-rw-r--r--      2984 2017-03-28 06:05 function.m-parsecommadelimited.html
-rw-r--r--      2618 2017-03-28 06:05 mpegfile.getid3v2tag.html
-rw-r--r--      4078 2017-03-28 06:06 harudoc.setinfoattr.html
-rw-r--r--      3038 2017-03-28 06:06 harupage.fillstroke.html
-rw-r--r--      1335 2017-03-28 06:07 funchand.resources.html
-rw-r--r--      2592 2017-03-28 06:06 yaf-request-abstract.ispost.html
-rw-r--r--      1509 2017-03-28 06:06 stream.setup.html
-rw-r--r--      4745 2017-03-28 06:07 xmlreader.open.html
-rw-r--r--     12051 2017-03-28 06:06 intldateformatter.parse.html
-rw-r--r--      2999 2017-03-28 06:05 function.newt-form-watch-fd.html
-rw-r--r--      2716 2017-03-28 06:06 function.trader-get-unstable-period.html
-rw-r--r--      2931 2017-03-28 06:06 haruimage.getcolorspace.html
-rw-r--r--      6695 2017-03-28 06:07 class.ui-controls-combo.html
-rw-r--r--      2904 2017-03-28 06:07 domdocument.normalizedocument.html
-rw-r--r--      4676 2017-03-28 06:06 class.mongodb-bson-persistable.html
-rw-r--r--      2478 2017-03-28 06:06 imagickdraw.getstrokewidth.html
-rw-r--r--      1315 2017-03-28 06:06 hrtime.setup.html
-rw-r--r--     10290 2017-03-28 06:06 function.eio-custom.html
-rw-r--r--      7137 2017-03-28 06:06 imagickdraw.point.html
-rw-r--r--      2682 2017-03-28 06:06 intltimezone.getdstsavings.html
-rw-r--r--      9792 2017-03-28 06:07 array.constants.html
-rw-r--r--      5309 2017-03-28 06:06 function.xdiff-string-bdiff-size.html
-rw-r--r--      9198 2017-03-28 06:07 function.fprintf.html
-rw-r--r--      6004 2017-03-28 06:06 cairocontext.fillpreserve.html
-rw-r--r--      2681 2017-03-28 06:06 mongo.tutorial.counting.html
-rw-r--r--      2905 2017-03-28 06:06 function.connection-aborted.html
-rw-r--r--      7213 2017-03-28 06:07 function.import-request-variables.html
-rw-r--r--      1332 2017-03-28 06:05 rar.configuration.html
-rw-r--r--      1707 2017-03-28 06:05 ref.xhprof.html
-rw-r--r--      2357 2017-03-28 06:06 intro.ev.html
-rw-r--r--      3383 2017-03-28 06:06 imagick.setimagepage.html
-rw-r--r--      1301 2017-03-28 06:06 cyrus.requirements.html
-rw-r--r--      1907 2017-03-28 06:06 function.date-offset-get.html
-rw-r--r--      2789 2017-03-28 06:05 function.newt-grid-free.html
-rw-r--r--      2738 2017-03-28 06:06 function.enchant-broker-get-error.html
-rw-r--r--      7670 2017-03-28 06:06 function.dirname.html
-rw-r--r--      2977 2017-03-28 06:05 function.ncurses-instr.html
-rw-r--r--      8650 2017-03-28 06:06 numberformatter.format.html
-rw-r--r--      1506 2017-03-28 06:07 stomp.setup.html
-rw-r--r--      6016 2017-03-28 06:07 quickhashintstringhash.construct.html
-rw-r--r--      5589 2017-03-28 06:06 intlchar.isualphabetic.html
-rw-r--r--      3985 2017-03-28 06:06 intlcalendar.before.html
-rw-r--r--      4941 2017-03-28 06:06 function.php-strip-whitespace.html
-rw-r--r--      9139 2017-03-28 06:07 migration55.incompatible.html
-rw-r--r--      2673 2017-03-28 06:06 yaf-dispatcher.setdefaultmodule.html
-rw-r--r--      2778 2017-03-28 06:06 function.trader-mult.html
-rw-r--r--     84718 2017-03-28 06:05 language.types.array.html
-rw-r--r--      1658 2017-03-28 06:05 configuration.html
-rw-r--r--      2302 2017-03-28 06:06 function.stream-bucket-new.html
-rw-r--r--      1916 2017-03-28 06:07 internals2.opcodes.init-ns-fcall-by-name.html
-rw-r--r--      1308 2017-03-28 06:06 stream.requirements.html
-rw-r--r--      3696 2017-03-28 06:06 gmagick.motionblurimage.html
-rw-r--r--      2830 2017-03-28 06:06 function.pdf-place-pdi-page.html
-rw-r--r--      4824 2017-03-28 06:05 pharfileinfo.getpharflags.html
-rw-r--r--      2494 2017-03-28 06:06 imagickpixel.destroy.html
-rw-r--r--     15336 2017-03-28 06:07 class.reflectionfunctionabstract.html
-rw-r--r--      2633 2017-03-28 06:07 function.svn-repos-recover.html
-rw-r--r--      4010 2017-03-28 06:06 book.calendar.html
-rw-r--r--      1834 2017-03-28 06:06 ref.password.html
-rw-r--r--     10254 2017-03-28 06:07 migration53.deprecated.html
-rw-r--r--      8030 2017-03-28 06:06 function.shmop-open.html
-rw-r--r--      3210 2017-03-28 06:05 phar.getsupportedsignatures.html
-rw-r--r--      5932 2017-03-28 06:06 function.hexdec.html
-rw-r--r--      4234 2017-03-28 06:06 mongodb.getgridfs.html
-rw-r--r--     10604 2017-03-28 06:06 mysqlnduhconnection.changeuser.html
-rw-r--r--      2462 2017-03-28 06:07 solrresponse.success.html
-rw-r--r--      9711 2017-03-28 06:06 function.ibase-connect.html
-rw-r--r--      2025 2017-03-28 06:06 function.ocilogoff.html
-rw-r--r--      2346 2017-03-28 06:07 ui-controls-label.construct.html
-rw-r--r--      2196 2017-03-28 06:06 function.pdf-create-textflow.html
-rw-r--r--     16084 2017-03-28 06:07 function.call-user-func-array.html
-rw-r--r--      1893 2017-03-28 06:06 function.pdf-setpolydash.html
-rw-r--r--      8169 2017-03-28 06:05 radius.constants.packets.html
-rw-r--r--      6218 2017-03-28 06:07 function.gupnp-service-proxy-action-set.html
-rw-r--r--     11375 2017-03-28 06:06 imagickdraw.setgravity.html
-rw-r--r--      2081 2017-03-28 06:06 imagick.gethomeurl.html
-rw-r--r--      3411 2017-03-28 06:07 function.socket-cmsg-space.html
-rw-r--r--      2974 2017-03-28 06:05 ncurses.colorconsts.html
-rw-r--r--     11272 2017-03-28 06:06 mysqlnd-ms.quickstart.mysql_fabric.html
-rw-r--r--      2567 2017-03-28 06:06 function.pspell-config-dict-dir.html
-rw-r--r--      5970 2017-03-28 06:06 imagick.smushimages.html
-rw-r--r--      2745 2017-03-28 06:07 class.ui-draw-text-font-italic.html
-rw-r--r--      4762 2017-03-28 06:07 memcached.getserverlist.html
-rw-r--r--     11270 2017-03-28 06:06 function.stream-filter-append.html
-rw-r--r--      5207 2017-03-28 06:07 soapclient.getlastrequest.html
-rw-r--r--      1520 2017-03-28 06:07 strings.setup.html
-rw-r--r--      2676 2017-03-28 06:05 function.m-connect.html
-rw-r--r--      4683 2017-03-28 06:07 sdo.installation.html
-rw-r--r--      4607 2017-03-28 06:06 mongodb.drop.html
-rw-r--r--      1816 2017-03-28 06:05 function.require-once.html
-rw-r--r--      4248 2017-03-28 06:07 function.xmlwriter-set-indent.html
-rw-r--r--      2700 2017-03-28 06:07 solrquery.settermsupperbound.html
-rw-r--r--     47249 2017-03-28 06:05 functions.arguments.html
-rw-r--r--      6708 2017-03-28 06:06 function.msg-send.html
-rw-r--r--      4854 2017-03-28 06:06 function.cairo-font-options-set-hint-metrics.html
-rw-r--r--      3034 2017-03-28 06:05 function.newt-entry-set-flags.html
-rw-r--r--      1461 2017-03-28 06:06 gmp.resources.html
-rw-r--r--      1704 2017-03-28 06:06 intro.password.html
-rw-r--r--      7891 2017-03-28 06:06 function.iterator-to-array.html
-rw-r--r--      1319 2017-03-28 06:06 rpmreader.requirements.html
-rw-r--r--      5033 2017-03-28 06:06 function.mysql-field-seek.html
-rw-r--r--      1274 2017-03-28 06:05 weakref.resources.html
-rw-r--r--      7795 2017-03-28 06:06 function.imagecreatefromgd2part.html
-rw-r--r--      2758 2017-03-28 06:07 solrquery.getfacetmethod.html
-rw-r--r--     10463 2017-03-28 06:06 class.messageformatter.html
-rw-r--r--     10325 2017-03-28 06:06 function.pg-field-prtlen.html
-rw-r--r--      2862 2017-03-28 06:06 function.eio-sync.html
-rw-r--r--      6048 2017-03-28 06:05 features.file-upload.put-method.html
-rw-r--r--     10473 2017-03-28 06:06 imagickdraw.setfontstretch.html
-rw-r--r--     12196 2017-03-28 06:05 phar.decompressfiles.html
-rw-r--r--      2118 2017-03-28 06:06 function.maxdb-bind-param.html
-rw-r--r--      6899 2017-03-28 06:07 snmp.setsecurity.html
-rw-r--r--      3630 2017-03-28 06:06 class.cairofontslant.html
-rw-r--r--      2516 2017-03-28 06:05 ref.apcu.html
-rw-r--r--      6911 2017-03-28 06:05 function.random-int.html
-rw-r--r--      3247 2017-03-28 06:07 hwapi.dstofsrcanchor.html
-rw-r--r--      5876 2017-03-28 06:07 function.apache-request-headers.html
-rw-r--r--     12005 2017-03-28 06:07 book.strings.html
-rw-r--r--      5550 2017-03-28 06:07 function.mqseries-set.html
-rw-r--r--      9135 2017-03-28 06:06 locale.composelocale.html
-rw-r--r--      9727 2017-03-28 06:06 messageformatter.format.html
-rw-r--r--      2535 2017-03-28 06:06 cyrus.constants.html
-rw-r--r--      2571 2017-03-28 06:06 intro.enchant.html
-rw-r--r--      1503 2017-03-28 06:06 imap.setup.html
-rw-r--r--      4654 2017-03-28 06:06 function.ps-rect.html
-rw-r--r--      4370 2017-03-28 06:06 splfileinfo.isfile.html
-rw-r--r--      5959 2017-03-28 06:07 migration70.deprecated.html
-rw-r--r--      6444 2017-03-28 06:06 class.cairosurfacepattern.html
-rw-r--r--      4310 2017-03-28 06:05 function.apcu-sma-info.html
-rw-r--r--      2835 2017-03-28 06:07 function.rrd-first.html
-rw-r--r--     16047 2017-03-28 06:06 mysqli.overview.html
-rw-r--r--     21482 2017-03-28 06:07 function.dns-get-record.html
-rw-r--r--      1358 2017-03-28 06:06 gearman.resources.html
-rw-r--r--      3313 2017-03-28 06:06 mongo.tutorial.collection.html
-rw-r--r--      1506 2017-03-28 06:06 ifx.installation.html
-rw-r--r--      8515 2017-03-28 06:06 pdo.sqlitecreatecollation.html
-rw-r--r--      3419 2017-03-28 06:06 imagick.remapimage.html
-rw-r--r--      1291 2017-03-28 06:07 swish.requirements.html
-rw-r--r--      2515 2017-03-28 06:06 hrtime-stopwatch.start.html
-rw-r--r--      2581 2017-03-28 06:05 context.params.html
-rw-r--r--      7053 2017-03-28 06:06 splfileinfo.openfile.html
-rw-r--r--      2349 2017-03-28 06:07 ui-controls-group.setmargin.html
-rw-r--r--      7149 2017-03-28 06:06 mysqlnd-ms.failover.html
-rw-r--r--      2719 2017-03-28 06:07 sdo-model-property.getname.html
-rw-r--r--      5667 2017-03-28 06:06 function.intl-is-failure.html
-rw-r--r--     10468 2017-03-28 06:06 function.stream-socket-recvfrom.html
-rw-r--r--      3955 2017-03-28 06:05 error.getfile.html
-rw-r--r--      2955 2017-03-28 06:06 splfileinfo.getsize.html
-rw-r--r--     28279 2017-03-28 06:05 language.exceptions.extending.html
-rw-r--r--      6883 2017-03-28 06:06 class.yaf-exception.html
-rw-r--r--      5120 2017-03-28 06:05 function.ob-get-clean.html
-rw-r--r--      2371 2017-03-28 06:07 zmqpoll.getlasterrors.html
-rw-r--r--      3951 2017-03-28 06:06 function.mb-language.html
-rw-r--r--     13136 2017-03-28 06:06 mysqli.commit.html
-rw-r--r--      4821 2017-03-28 06:06 arrayiterator.valid.html
-rw-r--r--      8316 2017-03-28 06:06 function.eval.html
-rw-r--r--      1700 2017-03-28 06:06 posix.constants.html
-rw-r--r--     16807 2017-03-28 06:06 mysqli.examples-basic.html
-rw-r--r--      6965 2017-03-28 06:06 mysqlnd-qc.quickstart.concepts.html
-rw-r--r--      1908 2017-03-28 06:06 function.date-isodate-set.html
-rw-r--r--      3267 2017-03-28 06:06 function.dbplus-ropen.html
-rw-r--r--      1503 2017-03-28 06:05 mcve.setup.html
-rw-r--r--      4513 2017-03-28 06:07 function.get-declared-classes.html
-rw-r--r--     15518 2017-03-28 06:06 book.image.html
-rw-r--r--      2849 2017-03-28 06:07 function.closelog.html
-rw-r--r--     16591 2017-03-28 06:07 class.ds-set.html
-rw-r--r--      2343 2017-03-28 06:06 mongodb.requirements.html
-rw-r--r--      2988 2017-03-28 06:07 xmlreader.read.html
-rw-r--r--      3245 2017-03-28 06:06 gmagick.setimageblueprimary.html
-rw-r--r--      9591 2017-03-28 06:06 imagickdraw.setfontweight.html
-rw-r--r--     17053 2017-03-28 06:07 function.htmlentities.html
-rw-r--r--      6273 2017-03-28 06:07 function.variant-or.html
-rw-r--r--      4617 2017-03-28 06:06 cairolineargradient.construct.html
-rw-r--r--      8248 2017-03-28 06:07 function.is-soap-fault.html
-rw-r--r--      2698 2017-03-28 06:06 evwatcher.feed.html
-rw-r--r--      7308 2017-03-28 06:06 imagick.transparentpaintimage.html
-rw-r--r--      5175 2017-03-28 06:06 function.imap-fetchmime.html
-rw-r--r--      1685 2017-03-28 06:07 swish.installation.html
-rw-r--r--      1512 2017-03-28 06:07 regex.setup.html
-rw-r--r--      6468 2017-03-28 06:06 function.dbase-pack.html
-rw-r--r--      6304 2017-03-28 06:06 tokyotyrant.putcat.html
-rw-r--r--      2897 2017-03-28 06:06 function.getrandmax.html
-rw-r--r--      4874 2017-03-28 06:06 cairocontext.getmiterlimit.html
-rw-r--r--      6227 2017-03-28 06:05 function.ncurses-color-set.html
-rw-r--r--      8813 2017-03-28 06:06 function.imagerotate.html
-rw-r--r--      6338 2017-03-28 06:06 function.mssql-get-last-message.html
-rw-r--r--     13687 2017-03-28 06:06 evtimer.construct.html
-rw-r--r--      1386 2017-03-28 06:07 com.examples.html
-rw-r--r--      4667 2017-03-28 06:07 book.sam.html
-rw-r--r--      1493 2017-03-28 06:06 chdb.setup.html
-rw-r--r--     11008 2017-03-28 06:07 soapserver.setpersistence.html
-rw-r--r--     17862 2017-03-28 06:07 function.money-format.html
-rw-r--r--      3847 2017-03-28 06:06 function.enchant-broker-set-ordering.html
-rw-r--r--      4035 2017-03-28 06:06 mongocursor.partial.html
-rw-r--r--      2367 2017-03-28 06:06 imagick.getimageunits.html
-rw-r--r--     23098 2017-03-28 06:06 mongocollection.find.html
-rw-r--r--      5950 2017-03-28 06:07 function.gupnp-service-notify.html
-rw-r--r--      5249 2017-03-28 06:07 function.yp-first.html
-rw-r--r--      2443 2017-03-28 06:06 function.pdf-open-pdi-page.html
-rw-r--r--      4744 2017-03-28 06:06 book.sync.html
-rw-r--r--     10574 2017-03-28 06:07 function.strcspn.html
-rw-r--r--     25560 2017-03-28 06:06 function.oci-define-by-name.html
-rw-r--r--      2349 2017-03-28 06:06 swfbutton.addasound.html
-rw-r--r--      5083 2017-03-28 06:07 ds-vector.merge.html
-rw-r--r--      5957 2017-03-28 06:07 class.ui-controls-progress.html
-rw-r--r--      1241 2017-03-28 06:07 win32ps.constants.html
-rw-r--r--      2076 2017-03-28 06:07 migration51.changes.html
-rw-r--r--      2565 2017-03-28 06:05 function.ncurses-flushinp.html
-rw-r--r--      3419 2017-03-28 06:07 win32service.constants.controlsaccepted.html
-rw-r--r--      8183 2017-03-28 06:07 memcached.increment.html
-rw-r--r--      5922 2017-03-28 06:05 function.id3-get-version.html
-rw-r--r--      9154 2017-03-28 06:06 function.rand.html
-rw-r--r--      1508 2017-03-28 06:06 exif.setup.html
-rw-r--r--      3597 2017-03-28 06:06 harupage.setrgbstroke.html
-rw-r--r--      3968 2017-03-28 06:06 function.log-killcursor.html
-rw-r--r--      8763 2017-03-28 06:07 function.ldap-add.html
-rw-r--r--      3578 2017-03-28 06:07 xsltprocessor.hasexsltsupport.html
-rw-r--r--      6122 2017-03-28 06:06 cairomatrix.initrotate.html
-rw-r--r--      2826 2017-03-28 06:07 solrquery.getfacetdateother.html
-rw-r--r--      2786 2017-03-28 06:07 refs.utilspec.windows.html
-rw-r--r--      3152 2017-03-28 06:05 function.newt-grid-add-components-to-form.html
-rw-r--r--      2150 2017-03-28 06:06 function.ocistatementtype.html
-rw-r--r--      3161 2017-03-28 06:06 function.stream-supports-lock.html
-rw-r--r--      1931 2017-03-28 06:06 function.timezone-offset-get.html
-rw-r--r--      2581 2017-03-28 06:06 imagickpixeliterator.destroy.html
-rw-r--r--     18726 2017-03-28 06:07 function.list.html
-rw-r--r--      6394 2017-03-28 06:06 mongopool.getsize.html
-rw-r--r--      3084 2017-03-28 06:06 imagickdraw.pathmovetorelative.html
-rw-r--r--      2912 2017-03-28 06:06 yaf-config-ini.set.html
-rw-r--r--      2143 2017-03-28 06:07 hwapi.content-mimetype.html
-rw-r--r--      2484 2017-03-28 06:06 book.inotify.html
-rw-r--r--      3341 2017-03-28 06:05 function.zip-entry-compressedsize.html
-rw-r--r--      2358 2017-03-28 06:07 ui-window.add.html
-rw-r--r--      3556 2017-03-28 06:07 function.variant-set-type.html
-rw-r--r--      5882 2017-03-28 06:06 eventsslcontext.construct.html
-rw-r--r--      4750 2017-03-28 06:06 class.cairosubpixelorder.html
-rw-r--r--     13191 2017-03-28 06:06 function.maxdb-use-result.html
-rw-r--r--      5908 2017-03-28 06:06 directoryiterator.valid.html
-rw-r--r--      3720 2017-03-28 06:07 class.ui-menuitem.html
-rw-r--r--      2500 2017-03-28 06:06 imagick.clampimage.html
-rw-r--r--      2532 2017-03-28 06:06 imagickdraw.getstrokedashoffset.html
-rw-r--r--      6010 2017-03-28 06:06 function.geoip-id-by-name.html
-rw-r--r--      1293 2017-03-28 06:06 bc.resources.html
-rw-r--r--      6404 2017-03-28 06:06 yaf-application.clearlasterror.html
-rw-r--r--      2732 2017-03-28 06:06 sqlsrv.installation.html
-rw-r--r--     13689 2017-03-28 06:07 samconnection.send.html
-rw-r--r--      3785 2017-03-28 06:06 function.finfo-set-flags.html
-rw-r--r--      2383 2017-03-28 06:07 solrgenericresponse.destruct.html
-rw-r--r--     16413 2017-03-28 06:07 function.array-splice.html
-rw-r--r--      7667 2017-03-28 06:06 mongocursor.timeout.html
-rw-r--r--      2836 2017-03-28 06:06 iteratoriterator.key.html
-rw-r--r--      2341 2017-03-28 06:07 soapfault.tostring.html
-rw-r--r--      2766 2017-03-28 06:07 reflectionparameter.isvariadic.html
-rw-r--r--     23365 2017-03-28 06:07 class.zookeeper.html
-rw-r--r--      9280 2017-03-28 06:06 function.openssl-pkcs7-encrypt.html
-rw-r--r--      2848 2017-03-28 06:07 solrquery.setmltmaxwordlength.html
-rw-r--r--      2698 2017-03-28 06:06 yaf-controller-abstract.getinvokearg.html
-rw-r--r--      2668 2017-03-28 06:05 phar.fileformat.signature.html
-rw-r--r--      3073 2017-03-28 06:06 class.cairosvgversion.html
-rw-r--r--      6489 2017-03-28 06:06 directoryiterator.getextension.html
-rw-r--r--      4121 2017-03-28 06:05 language.namespaces.definition.html
-rw-r--r--      4052 2017-03-28 06:06 function.mb-ereg-search-getpos.html
-rw-r--r--      8264 2017-03-28 06:05 language.oop5.serialization.html
-rw-r--r--      1335 2017-03-28 06:07 classkit.resources.html
-rw-r--r--      4133 2017-03-28 06:06 function.sqlite-has-prev.html
-rw-r--r--      5743 2017-03-28 06:06 function.eio-sendfile.html
-rw-r--r--      2626 2017-03-28 06:07 function.svn-fs-txn-root.html
-rw-r--r--      5474 2017-03-28 06:06 function.eio-chmod.html
-rw-r--r--      7356 2017-03-28 06:06 imagickpixeliterator.clear.html
-rw-r--r--      6763 2017-03-28 06:05 language.namespaces.fallback.html
-rw-r--r--      2855 2017-03-28 06:05 apcuiterator.key.html
-rw-r--r--      3521 2017-03-28 06:05 function.ncurses-mvvline.html
-rw-r--r--     18618 2017-03-28 06:06 function.mysqlnd-qc-get-core-stats.html
-rw-r--r--      5295 2017-03-28 06:06 function.fann-set-scaling-params.html
-rw-r--r--      3003 2017-03-28 06:06 ref.mysqlnd-qc.html
-rw-r--r--      2797 2017-03-28 06:07 solrquery.removehighlightfield.html
-rw-r--r--      8865 2017-03-28 06:06 mongocommandcursor.info.html
-rw-r--r--      6216 2017-03-28 06:07 sdo-das-relational.construct.html
-rw-r--r--      5453 2017-03-28 06:05 phar.count.html
-rw-r--r--      1377 2017-03-28 06:07 xmlreader.configuration.html
-rw-r--r--      2542 2017-03-28 06:07 solrdocument.valid.html
-rw-r--r--      4264 2017-03-28 06:06 splfileinfo.isdir.html
-rw-r--r--      5257 2017-03-28 06:06 intlchar.getnumericvalue.html
-rw-r--r--      1880 2017-03-28 06:06 mongodb.installation.html
-rw-r--r--      3988 2017-03-28 06:06 function.fdf-set-ap.html
-rw-r--r--      3249 2017-03-28 06:07 sdo-model-type.isopentype.html
-rw-r--r--      2948 2017-03-28 06:05 ref.errorfunc.html
-rw-r--r--      8590 2017-03-28 06:06 function.imagestring.html
-rw-r--r--      2720 2017-03-28 06:05 function.newt-scale-set.html
-rw-r--r--      4526 2017-03-28 06:07 reflectionclass.isinterface.html
-rw-r--r--      9201 2017-03-28 06:06 book.ps.html
-rw-r--r--      3022 2017-03-28 06:05 function.newt-checkbox-tree-get-multi-selection.html
-rw-r--r--      3315 2017-03-28 06:06 function.dbplus-open.html
-rw-r--r--      2074 2017-03-28 06:05 runkit.installation.html
-rw-r--r--     21854 2017-03-28 06:06 mysqlnd-ms.quickstart.xa_transactions.html
-rw-r--r--      7190 2017-03-28 06:05 function.radius-put-vendor-attr.html
-rw-r--r--      1315 2017-03-28 06:06 shmop.examples.html
-rw-r--r--      3213 2017-03-28 06:07 soapserver.setobject.html
-rw-r--r--      4591 2017-03-28 06:07 internals2.opcodes.fetch-obj-r.html
-rw-r--r--      4523 2017-03-28 06:05 ref.wincache.html
-rw-r--r--      2546 2017-03-28 06:06 haruimage.getsize.html
-rw-r--r--      3198 2017-03-28 06:07 ref.xmlrpc.html
-rw-r--r--      7641 2017-03-28 06:07 quickhashstringinthash.update.html
-rw-r--r--      5025 2017-03-28 06:07 function.svn-blame.html
-rw-r--r--      1933 2017-03-28 06:06 function.date-timezone-get.html
-rw-r--r--      1326 2017-03-28 06:07 net-gopher.requirements.html
-rw-r--r--     27319 2017-03-28 06:05 language.oop5.magic.html
-rw-r--r--      2254 2017-03-28 06:06 function.fdf-remove-item.html
-rw-r--r--      9002 2017-03-28 06:07 class.ui-draw-path.html
-rw-r--r--     11162 2017-03-28 06:05 function.debug-backtrace.html
-rw-r--r--      6149 2017-03-28 06:06 function.ftp-exec.html
-rw-r--r--      5591 2017-03-28 06:06 function.odbc-result.html
-rw-r--r--      4688 2017-03-28 06:07 memcached.callbacks.read-through.html
-rw-r--r--     15119 2017-03-28 06:06 mongocollection.remove.html
-rw-r--r--      1837 2017-03-28 06:05 intro.inclued.html
-rw-r--r--      5877 2017-03-28 06:05 language.variables.predefined.html
-rw-r--r--      9970 2017-03-28 06:06 mongodb.authenticate.html
-rw-r--r--      4023 2017-03-28 06:06 pdo.pgsqlcopytofile.html
-rw-r--r--      5313 2017-03-28 06:06 imagick.radialblurimage.html
-rw-r--r--      3023 2017-03-28 06:06 function.ifx-textasvarchar.html
-rw-r--r--     11575 2017-03-28 06:07 reflectionfunction.construct.html
-rw-r--r--     19682 2017-03-28 06:06 imagickdraw.bezier.html
-rw-r--r--      7552 2017-03-28 06:06 function.uniqid.html
-rw-r--r--      3705 2017-03-28 06:07 solrinputdocument.getchilddocumentscount.html
-rw-r--r--      2877 2017-03-28 06:06 function.openssl-x509-read.html
-rw-r--r--      4899 2017-03-28 06:06 imagick.medianfilterimage.html
-rw-r--r--      9335 2017-03-28 06:06 function.exit.html
-rw-r--r--      5061 2017-03-28 06:05 phar.getsupportedcompression.html
-rw-r--r--      4399 2017-03-28 06:05 function.cli-get-process-title.html
-rw-r--r--      5426 2017-03-28 06:06 function.imagecreatefromgd2.html
-rw-r--r--      3878 2017-03-28 06:06 function.fbsql-drop-db.html
-rw-r--r--      2104 2017-03-28 06:06 function.maxdb-execute.html
-rw-r--r--      5326 2017-03-28 06:06 cairocontext.setmatrix.html
-rw-r--r--     11960 2017-03-28 06:07 class.simplexmliterator.html
-rw-r--r--      8316 2017-03-28 06:05 install.unix.nginx.html
-rw-r--r--      6481 2017-03-28 06:06 function.gmp-hamdist.html
-rw-r--r--      3000 2017-03-28 06:07 migration5.configuration.html
-rw-r--r--      5183 2017-03-28 06:06 cairocontext.mask.html
-rw-r--r--      9422 2017-03-28 06:06 yaml.examples.html
-rw-r--r--      6532 2017-03-28 06:07 function.snmp2-walk.html
-rw-r--r--     38071 2017-03-28 06:06 class.ev.html
-rw-r--r--      7579 2017-03-28 06:06 function.fbsql-create-blob.html
-rw-r--r--      8156 2017-03-28 06:06 function.mysqlnd-uh-convert-to-mysqlnd.html
-rw-r--r--      8129 2017-03-28 06:06 mongocursor.awaitdata.html
-rw-r--r--      3435 2017-03-28 06:07 ui-draw-path.arcto.html
-rw-r--r--      2211 2017-03-28 06:05 phar.fileformat.tar.html
-rw-r--r--      3779 2017-03-28 06:07 domelement.getattributenode.html
-rw-r--r--      3270 2017-03-28 06:07 reflectionproperty.getmodifiers.html
-rw-r--r--      3093 2017-03-28 06:05 function.newt-checkbox-set-flags.html
-rw-r--r--      9583 2017-03-28 06:05 closure.bindto.html
-rw-r--r--      3399 2017-03-28 06:07 zookeeper.getstate.html
-rw-r--r--      3394 2017-03-28 06:05 function.openal-context-create.html
-rw-r--r--      9088 2017-03-28 06:07 sdo-das-datafactory.addpropertytotype.html
-rw-r--r--      5357 2017-03-28 06:05 function.ncurses-wborder.html
-rw-r--r--      3023 2017-03-28 06:06 yaf-request-abstract.getparam.html
-rw-r--r--      6806 2017-03-28 06:06 class.mongodb-driver-exception-connectionexception.html
-rw-r--r--      5595 2017-03-28 06:06 function.eio-readahead.html
-rw-r--r--      2601 2017-03-28 06:06 function.mysqli-bind-param.html
-rw-r--r--      2921 2017-03-28 06:05 function.ncurses-flash.html
-rw-r--r--     19156 2017-03-28 06:06 function.mysqlnd-ms-set-user-pick-server.html
-rw-r--r--      3505 2017-03-28 06:05 function.apd-continue.html
-rw-r--r--      2984 2017-03-28 06:06 intltimezone.geterrormessage.html
-rw-r--r--      3543 2017-03-28 06:05 mhash.examples.html
-rw-r--r--      4100 2017-03-28 06:05 install.cloud.azure.html
-rw-r--r--      3461 2017-03-28 06:07 migration54.classes.html
-rw-r--r--      4468 2017-03-28 06:07 ds-set.copy.html
-rw-r--r--      3440 2017-03-28 06:07 hwapi.lock.html
-rw-r--r--      2743 2017-03-28 06:07 zmqdevice.settimertimeout.html
-rw-r--r--      2490 2017-03-28 06:06 function.trader-cos.html
-rw-r--r--      5461 2017-03-28 06:06 function.mailparse-rfc822-parse-addresses.html
-rw-r--r--      4368 2017-03-28 06:05 exception.gettraceasstring.html
-rw-r--r--      3731 2017-03-28 06:07 sdo-sequence.move.html
-rw-r--r--      4048 2017-03-28 06:07 sphinx.examples.html
-rw-r--r--      9679 2017-03-28 06:06 yaf-route-map.construct.html
-rw-r--r--      9739 2017-03-28 06:06 imagickdraw.setfont.html
-rw-r--r--      7158 2017-03-28 06:06 syncsharedmemory.read.html
-rw-r--r--      7242 2017-03-28 06:07 reflectionclass.getdefaultproperties.html
-rw-r--r--      4139 2017-03-28 06:06 function.mailparse-msg-extract-part.html
-rw-r--r--      5387 2017-03-28 06:06 function.eio-utime.html
-rw-r--r--      5988 2017-03-28 06:06 function.lchown.html
-rw-r--r--     11605 2017-03-28 06:07 sca.examples.understanding-wsdl.html
-rw-r--r--      4971 2017-03-28 06:06 cairocontext.getfontface.html
-rw-r--r--      1873 2017-03-28 06:06 stream.filters.html
-rw-r--r--      5289 2017-03-28 06:06 imagick.setpointsize.html
-rw-r--r--      4859 2017-03-28 06:06 function.cairo-pdf-surface-create.html
-rw-r--r--      4095 2017-03-28 06:07 book.stomp.html
-rw-r--r--      2135 2017-03-28 06:06 dio.installation.html
-rw-r--r--      7077 2017-03-28 06:06 function.mysqlnd-ms-match-wild.html
-rw-r--r--      5186 2017-03-28 06:05 reserved.variables.post.html
-rw-r--r--      3262 2017-03-28 06:06 function.trader-cdl3blackcrows.html
-rw-r--r--      3057 2017-03-28 06:06 swfsoundinstance.loopinpoint.html
-rw-r--r--      2828 2017-03-28 06:06 mongodb.selectcollection.html
-rw-r--r--      9845 2017-03-28 06:07 solrclient.query.html
-rw-r--r--      1558 2017-03-28 06:05 mcrypt.installation.html
-rw-r--r--      2493 2017-03-28 06:06 imagickdraw.gettextinterwordspacing.html
-rw-r--r--     29552 2017-03-28 06:06 pdostatement.fetch.html
-rw-r--r--      2448 2017-03-28 06:06 evwatcher.getloop.html
-rw-r--r--      2753 2017-03-28 06:05 function.ncurses-putp.html
-rw-r--r--      4090 2017-03-28 06:06 eventhttprequest.sendreply.html
-rw-r--r--      9630 2017-03-28 06:07 reflectionproperty.setvalue.html
-rw-r--r--      3517 2017-03-28 06:05 function.ncurses-mvhline.html
-rw-r--r--      2758 2017-03-28 06:06 book.mysqlnd-memcache.html
-rw-r--r--      1844 2017-03-28 06:06 enchant.requirements.html
-rw-r--r--      3540 2017-03-28 06:06 cairopattern.construct.html
-rw-r--r--      2700 2017-03-28 06:06 function.px-delete.html
-rw-r--r--      3454 2017-03-28 06:06 multipleiterator.containsiterator.html
-rw-r--r--      3514 2017-03-28 06:06 function.dbplus-getunique.html
-rw-r--r--      3694 2017-03-28 06:07 ref.mnogosearch.html
-rw-r--r--      4844 2017-03-28 06:07 function.apache-response-headers.html
-rw-r--r--      2474 2017-03-28 06:06 oci-collection.size.html
-rw-r--r--      2468 2017-03-28 06:06 function.event-base-free.html
-rw-r--r--      3063 2017-03-28 06:06 swfsoundinstance.loopoutpoint.html
-rw-r--r--      2263 2017-03-28 06:05 book.inclued.html
-rw-r--r--      1580 2017-03-28 06:07 sdodasrel.setup.html
-rw-r--r--      5481 2017-03-28 06:06 tokyotyrant.setmaster.html
-rw-r--r--      1349 2017-03-28 06:06 mime-magic.resources.html
-rw-r--r--      2933 2017-03-28 06:06 class.yaf-exception-dispatchfailed.html
-rw-r--r--      7535 2017-03-28 06:07 migration54.ini.html
-rw-r--r--      3005 2017-03-28 06:06 eventbuffer.add.html
-rw-r--r--      1294 2017-03-28 06:06 exec.requirements.html
-rw-r--r--      4004 2017-03-28 06:07 sdodasrel.requirements.html
-rw-r--r--      2371 2017-03-28 06:07 function.ldap-parse-reference.html
-rw-r--r--      2353 2017-03-28 06:05 function.ncurses-slk-refresh.html
-rw-r--r--      3430 2017-03-28 06:06 harupage.showtext.html
-rw-r--r--      3058 2017-03-28 06:05 function.newt-grid-v-close-stacked.html
-rw-r--r--      2976 2017-03-28 06:07 function.ldap-unbind.html
-rw-r--r--     10849 2017-03-28 06:07 faq.mailinglist.html
-rw-r--r--      2828 2017-03-28 06:06 eventhttprequest.getcommand.html
-rw-r--r--      3803 2017-03-28 06:07 reflectionparameter.export.html
-rw-r--r--      1849 2017-03-28 06:05 language.errors.html
-rw-r--r--      3667 2017-03-28 06:06 intlchar.foldcase.html
-rw-r--r--      2509 2017-03-28 06:06 function.trader-asin.html
-rw-r--r--      2790 2017-03-28 06:06 swfvideostream.setdimension.html
-rw-r--r--      3010 2017-03-28 06:07 svmmodel.construct.html
-rw-r--r--      1384 2017-03-28 06:06 mysql.examples.html
-rw-r--r--      7687 2017-03-28 06:06 imagick.levelimage.html
-rw-r--r--      5416 2017-03-28 06:06 function.rpm-get-tag.html
-rw-r--r--      1597 2017-03-28 06:06 intro.tokenizer.html
-rw-r--r--      7214 2017-03-28 06:06 mysqlnduhconnection.endpsession.html
-rw-r--r--      2531 2017-03-28 06:06 recode.installation.html
-rw-r--r--      3692 2017-03-28 06:06 function.sybase-min-client-severity.html
drwxr-xr-x         0 2017-03-28 06:07 images/
-rw-r--r--       712 2017-03-28 06:06 images/21009b70229598c6a80eef8b45bf282b-imagefilledarc.png
-rw-r--r--     31908 2017-03-28 06:05 images/fa7c5b5f326e3c4a6cc9db19e7edbaf0-xkcd-bobby-tables.png
-rw-r--r--     26214 2017-03-28 06:05 images/0baa1b9fae6aec55bbb73037f3016001-xkcd-goto.png
-rw-r--r--       108 2017-03-28 06:06 images/21009b70229598c6a80eef8b45bf282b-imagecharup.png
-rw-r--r--      1254 2017-03-28 06:06 images/21009b70229598c6a80eef8b45bf282b-imagecopy.gif
-rw-r--r--      1608 2017-03-28 06:06 images/21009b70229598c6a80eef8b45bf282b-imagecreatefromjpeg.jpg
-rw-r--r--      1266 2017-03-28 06:06 images/21009b70229598c6a80eef8b45bf282b-imageconvolution_gaussian.png
-rw-r--r--     17535 2017-03-28 06:07 images/befd863081615f539082d9ff76bf7b39-zend.04-cross-converter.png
-rw-r--r--      5968 2017-03-28 06:05 images/12f37b1c6963c1c5c18f30495416a197-loop-array.png
-rw-r--r--    189105 2017-03-28 06:06 images/21009b70229598c6a80eef8b45bf282b-watermarks.png
-rw-r--r--       521 2017-03-28 06:06 images/c0d23d2d6769e53e24a1b3136c064577-floodfillpaint_result.png
-rw-r--r--     22096 2017-03-28 06:06 images/21009b70229598c6a80eef8b45bf282b-imagesettile.png
-rw-r--r--      9586 2017-03-28 06:06 images/c0d23d2d6769e53e24a1b3136c064577-hello_world_reflection.png
-rw-r--r--      8398 2017-03-28 06:05 images/b4cf2bb34e3c20eebcf8f9e8e7949efd-iis6defaultdoc.png
-rw-r--r--       107 2017-03-28 06:06 images/21009b70229598c6a80eef8b45bf282b-imagechar.png
-rw-r--r--      9414 2017-03-28 06:06 images/55c7816ef6df6821f05678a68b4e4e63-mymemflow.png
-rw-r--r--     25905 2017-03-28 06:05 images/b4cf2bb34e3c20eebcf8f9e8e7949efd-iis6anonauth.png
-rw-r--r--      7025 2017-03-28 06:07 images/befd863081615f539082d9ff76bf7b39-zend.07-warning-messages.png
-rw-r--r--       287 2017-03-28 06:06 images/21009b70229598c6a80eef8b45bf282b-imagefill.png
-rw-r--r--       287 2017-03-28 06:06 images/21009b70229598c6a80eef8b45bf282b-imagecreatetruecolor.png
-rw-r--r--       917 2017-03-28 06:06 images/21009b70229598c6a80eef8b45bf282b-imagelayereffect.png
-rw-r--r--      2268 2017-03-28 06:06 images/21009b70229598c6a80eef8b45bf282b-imagettftext.png
-rw-r--r--      1874 2017-03-28 06:06 images/21009b70229598c6a80eef8b45bf282b-imagesetbrush.png
-rw-r--r--      5978 2017-03-28 06:06 images/c0d23d2d6769e53e24a1b3136c064577-adaptiveBlurImage.gif
-rw-r--r--       178 2017-03-28 06:06 images/21009b70229598c6a80eef8b45bf282b-imagecreate.png
-rw-r--r--     10201 2017-03-28 06:05 images/12f37b1c6963c1c5c18f30495416a197-simple-array2.png
-rw-r--r--      2629 2017-03-28 06:06 images/21009b70229598c6a80eef8b45bf282b-imagesetstyle.jpg
-rw-r--r--       221 2017-03-28 06:06 images/21009b70229598c6a80eef8b45bf282b-imagecreatefromgif.gif
-rw-r--r--      1474 2017-03-28 06:06 images/21009b70229598c6a80eef8b45bf282b-imageellipse.png
-rw-r--r--     30544 2017-03-28 06:05 images/b4cf2bb34e3c20eebcf8f9e8e7949efd-iis7handlermap.png
-rw-r--r--     62231 2017-03-28 06:05 images/12f37b1c6963c1c5c18f30495416a197-gc-benchmark.png
-rw-r--r--       140 2017-03-28 06:06 images/21009b70229598c6a80eef8b45bf282b-imagecolortransparent.png
-rw-r--r--      5018 2017-03-28 06:06 images/21009b70229598c6a80eef8b45bf282b-imagefilterpixelate.png
-rw-r--r--       497 2017-03-28 06:06 images/c0d23d2d6769e53e24a1b3136c064577-floodfillpaint_intermediate.png
-rw-r--r--     17127 2017-03-28 06:06 images/21009b70229598c6a80eef8b45bf282b-imagecopyresampled_2.jpg
-rw-r--r--       377 2017-03-28 06:06 images/21009b70229598c6a80eef8b45bf282b-imagesetthickness.png
-rw-r--r--      1443 2017-03-28 06:06 images/21009b70229598c6a80eef8b45bf282b-imageantialias.png
-rw-r--r--     18502 2017-03-28 06:07 images/befd863081615f539082d9ff76bf7b39-zend.01-internal-structure.png
-rw-r--r--     73387 2017-03-28 06:07 images/4fd86c7f1b197d1d954ad0f4b033dc93-yar.png
-rw-r--r--      9665 2017-03-28 06:07 images/befd863081615f539082d9ff76bf7b39-zend.09-execution-info.png
-rw-r--r--      3403 2017-03-28 06:06 images/c0d23d2d6769e53e24a1b3136c064577-distortImage.png
-rw-r--r--     50382 2017-03-28 06:06 images/f3bc48edf40d5e3e09a166c7fadc7efb-driver_arch.png
-rw-r--r--     19547 2017-03-28 06:07 images/befd863081615f539082d9ff76bf7b39-zend.06-variable-creation.png
-rw-r--r--      2350 2017-03-28 06:06 images/c0d23d2d6769e53e24a1b3136c064577-functionImage_polynomial.png
-rw-r--r--    103817 2017-03-28 06:07 images/2a34c7f2e658f6ae74f3869f2aa5886f-crypt-text-rendered.svg
-rw-r--r--      5630 2017-03-28 06:06 images/c0d23d2d6769e53e24a1b3136c064577-hello_world.png
-rw-r--r--     37752 2017-03-28 06:06 images/e88cefb5c3fca5060e2490b9763c4433-readfile.png
-rw-r--r--       379 2017-03-28 06:06 images/21009b70229598c6a80eef8b45bf282b-imagestringup.png
-rw-r--r--     54553 2017-03-28 06:05 images/b4cf2bb34e3c20eebcf8f9e8e7949efd-iis7w2k8cgi.png
-rw-r--r--      1301 2017-03-28 06:06 images/21009b70229598c6a80eef8b45bf282b-imagejpeg.jpg
-rw-r--r--     19682 2017-03-28 06:07 images/befd863081615f539082d9ff76bf7b39-zend.05-reference-test.png
-rw-r--r--      2859 2017-03-28 06:06 images/21009b70229598c6a80eef8b45bf282b-imagecolorallocatealpha.png
-rw-r--r--      1288 2017-03-28 06:06 images/21009b70229598c6a80eef8b45bf282b-imagefilledpolygon.png
-rw-r--r--      1301 2017-03-28 06:06 images/21009b70229598c6a80eef8b45bf282b-imagecopyresized.jpg
-rw-r--r--     55381 2017-03-28 06:05 images/b4cf2bb34e3c20eebcf8f9e8e7949efd-iis7handlericon.png
-rw-r--r--      2373 2017-03-28 06:06 images/c0d23d2d6769e53e24a1b3136c064577-functionImage_sinusoidal.png
-rw-r--r--     48022 2017-03-28 06:05 images/b4cf2bb34e3c20eebcf8f9e8e7949efd-iis7vistacgi.png
-rw-r--r--     22197 2017-03-28 06:07 images/befd863081615f539082d9ff76bf7b39-zend.08-phpinfo-output.png
-rw-r--r--      2453 2017-03-28 06:06 images/c0d23d2d6769e53e24a1b3136c064577-functionImage_multiplied.png
-rw-r--r--      1480 2017-03-28 06:06 images/21009b70229598c6a80eef8b45bf282b-imagepolygon.png
-rw-r--r--       376 2017-03-28 06:06 images/21009b70229598c6a80eef8b45bf282b-imagecreatefrompng.png
-rw-r--r--       530 2017-03-28 06:06 images/21009b70229598c6a80eef8b45bf282b-imagefilltoborder.png
-rw-r--r--      1696 2017-03-28 06:06 images/21009b70229598c6a80eef8b45bf282b-imagearc.png
-rw-r--r--       138 2017-03-28 06:06 images/21009b70229598c6a80eef8b45bf282b-imagecreatefromstring.png
-rw-r--r--    193967 2017-03-28 06:06 images/21009b70229598c6a80eef8b45bf282b-watermark-merged.png
-rw-r--r--      1214 2017-03-28 06:06 images/21009b70229598c6a80eef8b45bf282b-imagecopyresampled.jpg
-rw-r--r--     30936 2017-03-28 06:05 images/12f37b1c6963c1c5c18f30495416a197-gc-algorithm.png
-rw-r--r--      5348 2017-03-28 06:05 images/12f37b1c6963c1c5c18f30495416a197-leak-array.png
-rw-r--r--      6804 2017-03-28 06:06 images/21009b70229598c6a80eef8b45bf282b-imagerotate.jpg
-rw-r--r--      9359 2017-03-28 06:05 images/12f37b1c6963c1c5c18f30495416a197-simple-array.png
-rw-r--r--      3004 2017-03-28 06:06 images/21009b70229598c6a80eef8b45bf282b-imageconvolution_emboss.png
-rw-r--r--      2419 2017-03-28 06:06 images/21009b70229598c6a80eef8b45bf282b-imagesetpixel.png
-rw-r--r--      1724 2017-03-28 06:06 images/21009b70229598c6a80eef8b45bf282b-imagefilledellipse.png
-rw-r--r--     21269 2017-03-28 06:06 images/c0d23d2d6769e53e24a1b3136c064577-php_logo.png
-rw-r--r--      3108 2017-03-28 06:06 images/21009b70229598c6a80eef8b45bf282b-imagerectangle.jpg
-rw-r--r--       167 2017-03-28 06:06 images/21009b70229598c6a80eef8b45bf282b-imagedashedline.png
-rw-r--r--       979 2017-03-28 06:06 images/21009b70229598c6a80eef8b45bf282b-imageopenpolygon.png
-rw-r--r--       125 2017-03-28 06:06 images/21009b70229598c6a80eef8b45bf282b-imagefilledrectangle.png
-rw-r--r--       175 2017-03-28 06:06 images/21009b70229598c6a80eef8b45bf282b-imagestring.png
-rw-r--r--      2237 2017-03-28 06:06 images/21009b70229598c6a80eef8b45bf282b-imagefliphorizontal.png
-rw-r--r--      2223 2017-03-28 06:06 images/21009b70229598c6a80eef8b45bf282b-imageflipvertical.png
-rw-r--r--       346 2017-03-28 06:06 images/c0d23d2d6769e53e24a1b3136c064577-importimagepixels.jpg
-rw-r--r--     10823 2017-03-28 06:05 function.hash.html
-rw-r--r--      5593 2017-03-28 06:06 splobjectstorage.detach.html
-rw-r--r--      6519 2017-03-28 06:07 class.zmqdevice.html
-rw-r--r--      3498 2017-03-28 06:06 eventbuffer.write.html
-rw-r--r--      7829 2017-03-28 06:06 function.pg-fetch-result.html
-rw-r--r--      2380 2017-03-28 06:06 gmagick.getimageunits.html
-rw-r--r--     13149 2017-03-28 06:07 function.define-syslog-variables.html
-rw-r--r--      7833 2017-03-28 06:06 intlchar.enumcharnames.html
-rw-r--r--      2866 2017-03-28 06:06 intltimezone.hassamerules.html
-rw-r--r--      5346 2017-03-28 06:07 class.yar-client.html
-rw-r--r--      3456 2017-03-28 06:06 function.fann-get-cascade-min-cand-epochs.html
-rw-r--r--      4707 2017-03-28 06:06 mysqli.more-results.html
-rw-r--r--      5273 2017-03-28 06:06 function.date-parse-from-format.html
-rw-r--r--      1902 2017-03-28 06:06 function.pdf-set-word-spacing.html
-rw-r--r--      2471 2017-03-28 06:07 solrparams.getpreparedparams.html
-rw-r--r--      2726 2017-03-28 06:06 class.luaclosure.html
-rw-r--r--      2176 2017-03-28 06:06 intro.dio.html
-rw-r--r--      3178 2017-03-28 06:07 xsltprocessor.setsecurityprefs.html
-rw-r--r--     12660 2017-03-28 06:06 pdo.prepare.html
-rw-r--r--      9331 2017-03-28 06:07 xml.constants.html
-rw-r--r--      3382 2017-03-28 06:06 function.imap-utf7-encode.html
-rw-r--r--      6579 2017-03-28 06:05 function.hash-update-stream.html
-rw-r--r--      3445 2017-03-28 06:05 function.ob-clean.html
-rw-r--r--      1777 2017-03-28 06:07 internals2.opcodes.send-var-no-ref.html
-rw-r--r--      6034 2017-03-28 06:06 function.cubrid-num-cols.html
-rw-r--r--      2634 2017-03-28 06:06 function.trader-mom.html
-rw-r--r--      4260 2017-03-28 06:06 function.posix-setrlimit.html
-rw-r--r--      3547 2017-03-28 06:06 arrayiterator.natsort.html
-rw-r--r--      2388 2017-03-28 06:06 function.mysqli-rpl-probe.html
-rw-r--r--     24601 2017-03-28 06:06 mysqli.real-connect.html
-rw-r--r--     25180 2017-03-28 06:06 class.collator.html
-rw-r--r--      1666 2017-03-28 06:07 xmlwriter.installation.html
-rw-r--r--      2882 2017-03-28 06:05 iteratoraggregate.getiterator.html
-rw-r--r--      5804 2017-03-28 06:07 solrquery.setgrouptruncate.html
-rw-r--r--     12387 2017-03-28 06:07 class.quickhashinthash.html
-rw-r--r--      2877 2017-03-28 06:06 cachingiterator.construct.html
-rw-r--r--      8574 2017-03-28 06:06 function.fbsql-read-clob.html
-rw-r--r--      7507 2017-03-28 06:06 function.cubrid-field-table.html
-rw-r--r--      6626 2017-03-28 06:06 splobjectstorage.offsetexists.html
-rw-r--r--      5302 2017-03-28 06:06 tokyotyranttable.out.html
-rw-r--r--      3768 2017-03-28 06:07 domnode.c14n.html
-rw-r--r--      6151 2017-03-28 06:06 function.mb-substitute-character.html
-rw-r--r--      8666 2017-03-28 06:07 regexp.reference.character-classes.html
-rw-r--r--     10260 2017-03-28 06:06 mysqlinfo.concepts.buffering.html
-rw-r--r--      4319 2017-03-28 06:07 domdocument.construct.html
-rw-r--r--      4126 2017-03-28 06:06 mongotimestamp.construct.html
-rw-r--r--      4564 2017-03-28 06:06 mysqli-stmt.construct.html
-rw-r--r--      3658 2017-03-28 06:07 function.win32-pause-service.html
-rw-r--r--      3304 2017-03-28 06:06 function.ifx-update-blob.html
-rw-r--r--      4938 2017-03-28 06:06 ref.pdo-odbc.connection.html
-rw-r--r--      3265 2017-03-28 06:06 spldoublylinkedlist.offsetget.html
-rw-r--r--     12138 2017-03-28 06:06 function.sqlite-fetch-all.html
-rw-r--r--      8044 2017-03-28 06:07 function.ssh2-publickey-add.html
-rw-r--r--      5376 2017-03-28 06:06 function.parsekit-func-arginfo.html
-rw-r--r--     31012 2017-03-28 06:06 ref.maxdb.html
-rw-r--r--      4200 2017-03-28 06:05 function.runkit-function-rename.html
-rw-r--r--     13211 2017-03-28 06:07 svn.constants.html
-rw-r--r--     11043 2017-03-28 06:06 filesystem.constants.html
-rw-r--r--      2610 2017-03-28 06:05 intro.zlib.html
-rw-r--r--      2654 2017-03-28 06:06 yaf-response-abstract.setheader.html
-rw-r--r--      3125 2017-03-28 06:05 function.newt-scale.html
-rw-r--r--      5509 2017-03-28 06:06 function.grapheme-strlen.html
-rw-r--r--      2467 2017-03-28 06:06 datetime.formats.html
-rw-r--r--      3187 2017-03-28 06:07 function.udm-free-ispell-data.html
-rw-r--r--      2682 2017-03-28 06:06 function.trader-roc.html
-rw-r--r--      1766 2017-03-28 06:06 ref.mhash.html
-rw-r--r--      3787 2017-03-28 06:06 function.ps-close-image.html
-rw-r--r--      2192 2017-03-28 06:05 ref.bzip2.html
-rw-r--r--      2167 2017-03-28 06:06 function.event-new.html
-rw-r--r--      2460 2017-03-28 06:06 event.setpriority.html
-rw-r--r--      5434 2017-03-28 06:05 control-structures.do.while.html
-rw-r--r--      6971 2017-03-28 06:07 migration53.methods.html
-rw-r--r--     15488 2017-03-28 06:06 function.mysqlnd-qc-get-normalized-query-trace-log.html
-rw-r--r--     27645 2017-03-28 06:07 faq.installation.html
-rw-r--r--      4855 2017-03-28 06:07 memcached.getresultmessage.html
-rw-r--r--      1795 2017-03-28 06:07 internals2.memory.html
-rw-r--r--      7454 2017-03-28 06:07 function.array-flip.html
-rw-r--r--     15549 2017-03-28 06:05 language.types.type-juggling.html
-rw-r--r--      2803 2017-03-28 06:07 reflectionproperty.tostring.html
-rw-r--r--      2459 2017-03-28 06:05 audioproperties.getsamplebitrate.html
-rw-r--r--      2238 2017-03-28 06:07 mqseries.constants.html
-rw-r--r--      2977 2017-03-28 06:06 recursiveiteratoriterator.callgetchildren.html
-rw-r--r--      3923 2017-03-28 06:07 internals2.opcodes.include-or-eval.html
-rw-r--r--      3595 2017-03-28 06:06 function.openssl-pkey-new.html
-rw-r--r--      3111 2017-03-28 06:05 function.openal-source-destroy.html
-rw-r--r--      7591 2017-03-28 06:06 splfileobject.key.html
-rw-r--r--      6074 2017-03-28 06:06 class.mongodb-bson-timestamp.html
-rw-r--r--      1238 2017-03-28 06:05 csprng.constants.html
-rw-r--r--     15867 2017-03-28 06:05 language.oop5.interfaces.html
-rw-r--r--      1760 2017-03-28 06:05 book.htscanner.html
-rw-r--r--      5074 2017-03-28 06:06 directoryiterator.getsize.html
-rw-r--r--      1791 2017-03-28 06:07 function.is-double.html
-rw-r--r--      2057 2017-03-28 06:05 refs.remote.auth.html
-rw-r--r--      1547 2017-03-28 06:07 classobj.setup.html
-rw-r--r--      5708 2017-03-28 06:06 function.password-verify.html
-rw-r--r--      1454 2017-03-28 06:05 bzip2.requirements.html
-rw-r--r--     16468 2017-03-28 06:05 features.file-upload.post-method.html
-rw-r--r--      1931 2017-03-28 06:06 mssql.installation.html
-rw-r--r--      3997 2017-03-28 06:07 ds-stack.clear.html
-rw-r--r--      4237 2017-03-28 06:07 samconnection.setdebug.html
-rw-r--r--      1363 2017-03-28 06:06 paradox.configuration.html
-rw-r--r--      5319 2017-03-28 06:05 reserved.variables.get.html
-rw-r--r--      1581 2017-03-28 06:06 chdb.requirements.html
-rw-r--r--      5345 2017-03-28 06:07 ds-priorityqueue.toarray.html
-rw-r--r--      3872 2017-03-28 06:06 cairoscaledfont.glyphextents.html
-rw-r--r--      2745 2017-03-28 06:06 mongocommandcursor.key.html
-rw-r--r--      2420 2017-03-28 06:07 solrquery.getstatsfields.html
-rw-r--r--      1198 2017-03-28 06:05 manual.html
-rw-r--r--     20673 2017-03-28 06:06 mysqli.query.html
-rw-r--r--      2680 2017-03-28 06:07 solrparams.get.html
-rw-r--r--      2127 2017-03-28 06:05 language.types.html
-rw-r--r--      5547 2017-03-28 06:05 function.inflate-init.html
-rw-r--r--      2679 2017-03-28 06:06 yaf-config-ini.offsetget.html
-rw-r--r--      3107 2017-03-28 06:06 intlbreakiterator.createcharacterinstance.html
-rw-r--r--      4051 2017-03-28 06:06 swfshape.drawcurve.html
-rw-r--r--      6195 2017-03-28 06:06 class.mongodb-bson-objectid.html
-rw-r--r--      8829 2017-03-28 06:06 function.fann-create-train-from-callback.html
-rw-r--r--      5595 2017-03-28 06:06 imagick.modulateimage.html
-rw-r--r--     13598 2017-03-28 06:06 mysqli-stmt.error-list.html
-rw-r--r--      2924 2017-03-28 06:05 apciterator.valid.html
-rw-r--r--      3127 2017-03-28 06:07 book.mqseries.html
-rw-r--r--     13335 2017-03-28 06:05 phar.uncompressallfiles.html
-rw-r--r--      6080 2017-03-28 06:05 class.throwable.html
-rw-r--r--      1807 2017-03-28 06:06 intro.math.html
-rw-r--r--      3158 2017-03-28 06:06 imagick.setimageprofile.html
-rw-r--r--      8591 2017-03-28 06:06 function.date-default-timezone-get.html
-rw-r--r--      2701 2017-03-28 06:06 gmagick.getimagehistogram.html
-rw-r--r--     11072 2017-03-28 06:06 pdostatement.debugdumpparams.html
-rw-r--r--      4498 2017-03-28 06:06 mongocode.tostring.html
-rw-r--r--      9338 2017-03-28 06:07 function.print-r.html
-rw-r--r--      5666 2017-03-28 06:06 directoryiterator.next.html
-rw-r--r--      3560 2017-03-28 06:06 mongoid.gethostname.html
-rw-r--r--      3347 2017-03-28 06:07 oauth.getcapath.html
-rw-r--r--      1632 2017-03-28 06:05 hash.installation.html
-rw-r--r--      6080 2017-03-28 06:06 imagick.getiteratorindex.html
-rw-r--r--      5217 2017-03-28 06:07 ds-set.xor.html
-rw-r--r--     13930 2017-03-28 06:06 book.cubrid.html
-rw-r--r--     21358 2017-03-28 06:06 function.oci-new-descriptor.html
-rw-r--r--      7729 2017-03-28 06:06 function.imagecolorexact.html
-rw-r--r--      5383 2017-03-28 06:06 function.pspell-save-wordlist.html
-rw-r--r--      9335 2017-03-28 06:06 numberformatter.getpattern.html
-rw-r--r--      6505 2017-03-28 06:06 worker.collect.html
-rw-r--r--      2490 2017-03-28 06:07 internals2.opcodes.jmpz-ex.html
-rw-r--r--      2062 2017-03-28 06:06 intro.mime-magic.html
-rw-r--r--      5419 2017-03-28 06:06 class.datetimeinterface.html
-rw-r--r--      7007 2017-03-28 06:07 function.socket-getpeername.html
-rw-r--r--     15962 2017-03-28 06:07 function.array-filter.html
-rw-r--r--      3551 2017-03-28 06:06 gmagick.thumbnailimage.html
-rw-r--r--      3890 2017-03-28 06:06 mongocursor.hint.html
-rw-r--r--      7536 2017-03-28 06:06 mysqlnduhconnection.serverdumpdebuginformation.html
-rw-r--r--      8056 2017-03-28 06:06 pdo.exec.html
-rw-r--r--      3984 2017-03-28 06:05 function.newt-textbox-reflowed.html
-rw-r--r--      2328 2017-03-28 06:07 varnishadmin.auth.html
-rw-r--r--      4547 2017-03-28 06:06 function.openssl-csr-export-to-file.html
-rw-r--r--      5308 2017-03-28 06:05 class.arithmeticerror.html
-rw-r--r--      2997 2017-03-28 06:06 fannconnection.setweight.html
-rw-r--r--     15144 2017-03-28 06:07 ldap.constants.html
-rw-r--r--      2482 2017-03-28 06:07 rrdcreator.save.html
-rw-r--r--      5343 2017-03-28 06:06 function.pg-host.html
-rw-r--r--      6249 2017-03-28 06:07 function.getmxrr.html
-rw-r--r--      8290 2017-03-28 06:06 class.dateinterval.html
-rw-r--r--      4152 2017-03-28 06:06 function.dbplus-rcrtexact.html
-rw-r--r--      4168 2017-03-28 06:06 streamwrapper.stream-write.html
-rw-r--r--      4324 2017-03-28 06:06 function.fbsql-set-transaction.html
-rw-r--r--      7268 2017-03-28 06:06 mongodb-driver-writeconcernerror.getmessage.html
-rw-r--r--      5444 2017-03-28 06:07 swish.construct.html
-rw-r--r--      4756 2017-03-28 06:06 imagick.setimageorientation.html
-rw-r--r--      2880 2017-03-28 06:06 splsubject.detach.html
-rw-r--r--      3594 2017-03-28 06:06 function.sybase-field-seek.html
-rw-r--r--      6835 2017-03-28 06:05 function.uopz-function.html
-rw-r--r--      1335 2017-03-28 06:06 parsekit.resources.html
-rw-r--r--      3085 2017-03-28 06:07 internals2.opcodes.assign-obj.html
-rw-r--r--      1746 2017-03-28 06:07 ref.simplexml.html
-rw-r--r--      2974 2017-03-28 06:07 solrcollapsefunction.getsize.html
-rw-r--r--      2990 2017-03-28 06:06 harupage.movetonextline.html
-rw-r--r--     14762 2017-03-28 06:06 imagickdraw.setfillrule.html
-rw-r--r--      7313 2017-03-28 06:05 rarexception.setusingexceptions.html
-rw-r--r--      9402 2017-03-28 06:06 mongodb-driver-writeresult.getupsertedids.html
-rw-r--r--      3794 2017-03-28 06:06 function.event-add.html
-rw-r--r--      1328 2017-03-28 06:06 haru.examples.html
-rw-r--r--      8398 2017-03-28 06:05 function.runkit-function-add.html
-rw-r--r--      3245 2017-03-28 06:06 function.odbc-num-rows.html
-rw-r--r--      3877 2017-03-28 06:06 swfdisplayitem.skewyto.html
-rw-r--r--      7723 2017-03-28 06:07 function.get-parent-class.html
-rw-r--r--      2562 2017-03-28 06:06 harufont.getdescent.html
-rw-r--r--      9611 2017-03-28 06:06 function.gmp-gcdext.html
-rw-r--r--      6792 2017-03-28 06:06 function.curl-escape.html
-rw-r--r--      2921 2017-03-28 06:07 reflectionparameter.getposition.html
-rw-r--r--      6582 2017-03-28 06:06 function.is-dir.html
-rw-r--r--      3268 2017-03-28 06:07 solrquery.sethighlightsnippets.html
-rw-r--r--      9908 2017-03-28 06:06 function.db2-rollback.html
-rw-r--r--      5753 2017-03-28 06:06 directoryiterator.isdir.html
-rw-r--r--      2828 2017-03-28 06:06 book.lapack.html
-rw-r--r--      2451 2017-03-28 06:06 function.pdf-arc.html
-rw-r--r--      3959 2017-03-28 06:06 tokyotyranttable.putnr.html
-rw-r--r--      1947 2017-03-28 06:05 function.get-required-files.html
-rw-r--r--      2268 2017-03-28 06:07 ui-window.hasborders.html
-rw-r--r--      2370 2017-03-28 06:06 class.mongodb-driver-exception-exception.html
-rw-r--r--      1673 2017-03-28 06:06 v8js.installation.html
-rw-r--r--      3035 2017-03-28 06:06 yaf-request-abstract.setparam.html
-rw-r--r--      8937 2017-03-28 06:06 sqlite3.createcollation.html
-rw-r--r--      2578 2017-03-28 06:06 function.stats-skew.html
-rw-r--r--      3070 2017-03-28 06:06 function.pdf-shading.html
-rw-r--r--      2664 2017-03-28 06:06 imagick.setimagegamma.html
-rw-r--r--     15798 2017-03-28 06:05 langref.html
-rw-r--r--      9294 2017-03-28 06:05 ziparchive.locatename.html
-rw-r--r--      1703 2017-03-28 06:07 win32ps.installation.html
-rw-r--r--      1309 2017-03-28 06:06 ingres.examples.html
-rw-r--r--      2616 2017-03-28 06:06 mongoclient.tostring.html
-rw-r--r--      2008 2017-03-28 06:06 book.mail.html
-rw-r--r--      3856 2017-03-28 06:06 harudoc.setpagelayout.html
-rw-r--r--      7101 2017-03-28 06:06 ev.supportedbackends.html
-rw-r--r--      9801 2017-03-28 06:06 function.mysqlnd-ms-get-last-gtid.html
-rw-r--r--      2489 2017-03-28 06:06 yaf-view-simple.isset.html
-rw-r--r--      5749 2017-03-28 06:06 function.cubrid-num-fields.html
-rw-r--r--      1858 2017-03-28 06:07 intro.solr.html
-rw-r--r--     32280 2017-03-28 06:06 changelog.mongo.html
-rw-r--r--      5838 2017-03-28 06:06 intlcalendar.getlocale.html
-rw-r--r--      3129 2017-03-28 06:06 swfshape.drawarc.html
-rw-r--r--      2800 2017-03-28 06:05 throwable.getline.html
-rw-r--r--      4599 2017-03-28 06:06 pdo-4d.sqltypes.html
-rw-r--r--      2405 2017-03-28 06:05 audioproperties.getlength.html
-rw-r--r--     98860 2017-03-28 06:06 curl.constants.html
-rw-r--r--      4546 2017-03-28 06:05 function.inclued-get-data.html
-rw-r--r--     19424 2017-03-28 06:06 function.oci-fetch-object.html
-rw-r--r--     10738 2017-03-28 06:06 mongo.connecting.rs.html
-rw-r--r--      3619 2017-03-28 06:06 imagick.quantizeimages.html
-rw-r--r--      5884 2017-03-28 06:07 ref.sdodasrel.html
-rw-r--r--      6366 2017-03-28 06:05 function.radius-cvt-addr.html
-rw-r--r--      4785 2017-03-28 06:06 function.openssl-private-encrypt.html
-rw-r--r--      4311 2017-03-28 06:06 imagick.configuration.html
-rw-r--r--      3388 2017-03-28 06:05 book.errorfunc.html
-rw-r--r--      7124 2017-03-28 06:07 function.ldap-parse-result.html
-rw-r--r--      6103 2017-03-28 06:06 mongocollection.getindexinfo.html
-rw-r--r--      5699 2017-03-28 06:06 imagick.gammaimage.html
-rw-r--r--      3218 2017-03-28 06:06 mysqlnd-mux.constants.html
-rw-r--r--      2450 2017-03-28 06:07 ui-controls-editablecombo.settext.html
-rw-r--r--      3765 2017-03-28 06:06 lua.eval.html
-rw-r--r--      2930 2017-03-28 06:06 dbx.requirements.html
-rw-r--r--      3413 2017-03-28 06:06 function.ibase-free-event-handler.html
-rw-r--r--      6235 2017-03-28 06:06 mongodate.construct.html
-rw-r--r--      2362 2017-03-28 06:07 ui-draw-path.construct.html
-rw-r--r--      2542 2017-03-28 06:06 swfmovie.importfont.html
-rw-r--r--      2240 2017-03-28 06:06 function.pdf-lineto.html
-rw-r--r--      1335 2017-03-28 06:06 datetime.resources.html
-rw-r--r--      1322 2017-03-28 06:06 datetime.requirements.html
-rw-r--r--      2643 2017-03-28 06:06 yaf-controller-abstract.setviewpath.html
-rw-r--r--      5067 2017-03-28 06:06 imagick.queryfonts.html
-rw-r--r--      4042 2017-03-28 06:06 function.cairo-ps-get-levels.html
-rw-r--r--      6193 2017-03-28 06:05 function.set-include-path.html
-rw-r--r--      6584 2017-03-28 06:07 book.soap.html
-rw-r--r--      3760 2017-03-28 06:06 cairofontoptions.gethintmetrics.html
-rw-r--r--      3104 2017-03-28 06:07 internals2.opcodes.is-not-equal.html
-rw-r--r--      2411 2017-03-28 06:07 ui-controls-entry.gettext.html
-rw-r--r--      4633 2017-03-28 06:06 cairocontext.devicetouser.html
-rw-r--r--      8642 2017-03-28 06:06 intl.constants.html
-rw-r--r--      7418 2017-03-28 06:06 datetimezone.getoffset.html
-rw-r--r--      8629 2017-03-28 06:06 function.realpath.html
-rw-r--r--      9474 2017-03-28 06:06 function.imap-mailboxmsginfo.html
-rw-r--r--     11273 2017-03-28 06:07 function.in-array.html
-rw-r--r--      5594 2017-03-28 06:06 function.cairo-image-surface-create-for-data.html
-rw-r--r--      3872 2017-03-28 06:06 function.ibase-blob-create.html
-rw-r--r--      6037 2017-03-28 06:07 yar-server-exception.gettype.html
-rw-r--r--      4079 2017-03-28 06:07 win32service.constants.basepriorities.html
-rw-r--r--      2633 2017-03-28 06:06 yaf-config-abstract.set.html
-rw-r--r--      2562 2017-03-28 06:06 uconverter.geterrormessage.html
-rw-r--r--      1677 2017-03-28 06:06 xdiff.requirements.html
-rw-r--r--      5556 2017-03-28 06:05 function.get-extension-funcs.html
-rw-r--r--      6979 2017-03-28 06:07 function.get-object-vars.html
-rw-r--r--      2464 2017-03-28 06:05 function.ncurses-termattrs.html
-rw-r--r--      4459 2017-03-28 06:06 function.mysqlnd-ms-fabric-select-shard.html
-rw-r--r--      2203 2017-03-28 06:06 function.pdf-load-3ddata.html
-rw-r--r--      6288 2017-03-28 06:06 mysqlnd.overview.html
-rw-r--r--      3238 2017-03-28 06:05 function.newt-push-help-line.html
-rw-r--r--      8959 2017-03-28 06:05 outcontrol.configuration.html
-rw-r--r--      2129 2017-03-28 06:05 radius.constants.html
-rw-r--r--      9605 2017-03-28 06:06 pdo.sqlitecreatefunction.html
-rw-r--r--      6422 2017-03-28 06:06 function.cubrid-ping.html
-rw-r--r--      2982 2017-03-28 06:06 iteratoriterator.rewind.html
-rw-r--r--      3317 2017-03-28 06:06 oci-lob.write.html
-rw-r--r--     26399 2017-03-28 06:05 language.variables.scope.html
-rw-r--r--      4648 2017-03-28 06:07 quickhashinthash.getsize.html
-rw-r--r--      2503 2017-03-28 06:07 ui-controls-multilineentry.append.html
-rw-r--r--      3594 2017-03-28 06:06 function.fann-set-rprop-increase-factor.html
-rw-r--r--     10195 2017-03-28 06:07 function.array-slice.html
-rw-r--r--      6120 2017-03-28 06:07 soapserver.getfunctions.html
-rw-r--r--      3449 2017-03-28 06:06 uconverter.toucallback.html
-rw-r--r--      6106 2017-03-28 06:06 swftextfield.construct.html
-rw-r--r--      5085 2017-03-28 06:07 function.strtolower.html
-rw-r--r--      2915 2017-03-28 06:05 wincache.win32build.building.html
-rw-r--r--      3238 2017-03-28 06:06 mysqlnd-ms.loadbalancing.html
-rw-r--r--      1535 2017-03-28 06:05 openal.setup.html
-rw-r--r--      1897 2017-03-28 06:06 function.pdf-add-bookmark.html
-rw-r--r--      2407 2017-03-28 06:07 solrdocument.next.html
-rw-r--r--      8670 2017-03-28 06:05 function.radius-get-vendor-attr.html
-rw-r--r--      2251 2017-03-28 06:06 swfsoundinstance.nomultiple.html
-rw-r--r--      2869 2017-03-28 06:06 intlbreakiterator.preceding.html
-rw-r--r--      4037 2017-03-28 06:06 function.bindtextdomain.html
-rw-r--r--      1866 2017-03-28 06:06 function.imap-header.html
-rw-r--r--      3027 2017-03-28 06:07 internals2.opcodes.sr.html
-rw-r--r--      4198 2017-03-28 06:05 function.apd-set-pprof-trace.html
-rw-r--r--      1701 2017-03-28 06:06 taint.detail.html
-rw-r--r--      4923 2017-03-28 06:07 reflectionextension.getinientries.html
-rw-r--r--      3092 2017-03-28 06:06 function.dbplus-undoprepare.html
-rw-r--r--      1680 2017-03-28 06:07 internals2.streams.html
-rw-r--r--      3182 2017-03-28 06:06 mongocollection.construct.html
-rw-r--r--      4935 2017-03-28 06:06 cairosurface.copypage.html
-rw-r--r--      2485 2017-03-28 06:06 imagick.getimagerenderingintent.html
-rw-r--r--      2250 2017-03-28 06:07 transports.html
-rw-r--r--      2578 2017-03-28 06:06 function.pdf-arcn.html
-rw-r--r--      5089 2017-03-28 06:07 function.is-resource.html
-rw-r--r--      4819 2017-03-28 06:06 ref.sqlsrv.html
-rw-r--r--      9975 2017-03-28 06:07 migration52.parameters.html
-rw-r--r--      2842 2017-03-28 06:06 mysqlnd.persist.html
-rw-r--r--      1342 2017-03-28 06:06 proctitle.resources.html
-rw-r--r--      3277 2017-03-28 06:06 class.swfbitmap.html
-rw-r--r--    182621 2017-03-28 06:06 mysqlnd-ms.plugin-ini-json.html
-rw-r--r--      3834 2017-03-28 06:06 openssl.ciphers.html
-rw-r--r--      3004 2017-03-28 06:06 swftext.setspacing.html
-rw-r--r--      2713 2017-03-28 06:06 function.ifx-nullformat.html
-rw-r--r--      7201 2017-03-28 06:06 arrayobject.construct.html
-rw-r--r--      2436 2017-03-28 06:05 id3v2attachedpictureframe.settype.html
-rw-r--r--      2214 2017-03-28 06:06 function.pdf-moveto.html
-rw-r--r--      4547 2017-03-28 06:07 ds-stack.peek.html
-rw-r--r--      4568 2017-03-28 06:06 mongocollection.getname.html
-rw-r--r--      3369 2017-03-28 06:06 function.trader-cdlconcealbabyswall.html
-rw-r--r--      5394 2017-03-28 06:06 ftp.examples-basic.html
-rw-r--r--      3146 2017-03-28 06:06 function.posix-initgroups.html
-rw-r--r--      1907 2017-03-28 06:06 mysql.requirements.html
-rw-r--r--      3584 2017-03-28 06:06 cairosurface.finish.html
-rw-r--r--      4545 2017-03-28 06:06 harupage.settextmatrix.html
-rw-r--r--      2995 2017-03-28 06:06 function.stats-rand-gen-noncentral-t.html
-rw-r--r--     15245 2017-03-28 06:06 function.imagejpeg.html
-rw-r--r--      1567 2017-03-28 06:07 reflection.setup.html
-rw-r--r--     19017 2017-03-28 06:06 gearman.examples-reverse-task.html
-rw-r--r--      6007 2017-03-28 06:07 ds-map.sum.html
-rw-r--r--      3315 2017-03-28 06:06 function.trader-cdlgravestonedoji.html
-rw-r--r--      3055 2017-03-28 06:07 ui-size.of.html
-rw-r--r--      6555 2017-03-28 06:07 function.array-chunk.html
-rw-r--r--      1789 2017-03-28 06:06 function.msql-tablename.html
-rw-r--r--      5080 2017-03-28 06:06 eventbuffer.appendfrom.html
-rw-r--r--      2929 2017-03-28 06:06 imagick.setimageextent.html
-rw-r--r--      3874 2017-03-28 06:07 sdo-model-reflectiondataobject.export.html
-rw-r--r--     19865 2017-03-28 06:06 function.stream-filter-register.html
-rw-r--r--      4657 2017-03-28 06:05 function.uopz-restore.html
-rw-r--r--      2507 2017-03-28 06:06 swftext.getascent.html
-rw-r--r--      2357 2017-03-28 06:06 imagick.getversion.html
-rw-r--r--      4623 2017-03-28 06:06 intlcalendar.isset.html
-rw-r--r--      5513 2017-03-28 06:07 internals2.opcodes.fe-fetch.html
-rw-r--r--      2602 2017-03-28 06:06 imagick.getimageblob.html
-rw-r--r--      4070 2017-03-28 06:06 function.fann-scale-output-train-data.html
-rw-r--r--      2680 2017-03-28 06:06 swfbutton.setmenu.html
-rw-r--r--      1608 2017-03-28 06:05 intro.opcache.html
-rw-r--r--      3488 2017-03-28 06:05 serializable.serialize.html
-rw-r--r--      6100 2017-03-28 06:06 intlchar.iscntrl.html
-rw-r--r--      5957 2017-03-28 06:06 directoryiterator.getgroup.html
-rw-r--r--      2250 2017-03-28 06:06 function.maxdb-master-query.html
-rw-r--r--      2431 2017-03-28 06:06 enchant.constants.html
-rw-r--r--      1342 2017-03-28 06:07 snmp.configuration.html
-rw-r--r--      3287 2017-03-28 06:07 about.translations.html
-rw-r--r--      3656 2017-03-28 06:06 function.jddayofweek.html
-rw-r--r--      4914 2017-03-28 06:07 ds-vector.unshift.html
-rw-r--r--      5480 2017-03-28 06:07 book.xml.html
-rw-r--r--      5142 2017-03-28 06:06 cairosurface.createsimilar.html
-rw-r--r--      4568 2017-03-28 06:06 function.cairo-ps-surface-dsc-begin-page-setup.html
-rw-r--r--      1520 2017-03-28 06:07 varnish.setup.html
-rw-r--r--     13883 2017-03-28 06:06 class.evperiodic.html
-rw-r--r--      2245 2017-03-28 06:06 imagick.getcopyright.html
-rw-r--r--      1340 2017-03-28 06:07 win32ps.examples.html
-rw-r--r--      9350 2017-03-28 06:06 mysqli.error.html
-rw-r--r--      3184 2017-03-28 06:06 function.dbplus-chdir.html
-rw-r--r--      2652 2017-03-28 06:06 function.trader-medprice.html
-rw-r--r--      2525 2017-03-28 06:06 book.cyrus.html
-rw-r--r--      4155 2017-03-28 06:05 function.sys-get-temp-dir.html
-rw-r--r--      2689 2017-03-28 06:06 intro.xdiff.html
-rw-r--r--     11999 2017-03-28 06:06 function.imap-get-quota.html
-rw-r--r--     10402 2017-03-28 06:06 imagickdraw.setfontfamily.html
-rw-r--r--     15265 2017-03-28 06:06 ref.image.html
-rw-r--r--      3821 2017-03-28 06:06 imagick.identifyimage.html
-rw-r--r--      1265 2017-03-28 06:06 intro.xattr.html
-rw-r--r--      5594 2017-03-28 06:05 class.ktaglib-id3v2-tag.html
-rw-r--r--      9268 2017-03-28 06:06 function.mysql-field-name.html
-rw-r--r--      5007 2017-03-28 06:06 imagick.setimageresolution.html
-rw-r--r--      7890 2017-03-28 06:06 ev.periodic-modes.html
-rw-r--r--      5018 2017-03-28 06:06 collator.getstrength.html
-rw-r--r--      2374 2017-03-28 06:06 swfdisplayitem.getxskew.html
-rw-r--r--      4537 2017-03-28 06:07 ds-stack.copy.html
-rw-r--r--      1300 2017-03-28 06:06 sem.resources.html
-rw-r--r--      4138 2017-03-28 06:06 function.sybase-query.html
-rw-r--r--      1272 2017-03-28 06:07 reflection.constants.html
-rw-r--r--      3564 2017-03-28 06:06 limititerator.valid.html
-rw-r--r--      4214 2017-03-28 06:06 function.stream-is-local.html
-rw-r--r--      3571 2017-03-28 06:05 book.kadm5.html
-rw-r--r--      1314 2017-03-28 06:06 xattr.resources.html
-rw-r--r--      5479 2017-03-28 06:06 directoryiterator.isreadable.html
-rw-r--r--      3201 2017-03-28 06:07 function.wddx-deserialize.html
-rw-r--r--      5467 2017-03-28 06:06 function.pg-version.html
-rw-r--r--      5494 2017-03-28 06:07 function.ssh2-sftp-rmdir.html
-rw-r--r--      9295 2017-03-28 06:06 function.imagecreatefromjpeg.html
-rw-r--r--     19508 2017-03-28 06:06 swfdisplayitem.setratio.html
-rw-r--r--      2348 2017-03-28 06:06 pool.resize.html
-rw-r--r--      4873 2017-03-28 06:06 cairofontoptions.status.html
-rw-r--r--      5801 2017-03-28 06:05 phar.addemptydir.html
-rw-r--r--      2471 2017-03-28 06:07 ui-draw-text-font.construct.html
-rw-r--r--      2796 2017-03-28 06:06 gmagick.commentimage.html
-rw-r--r--      2625 2017-03-28 06:07 function.udm-errno.html
-rw-r--r--      5829 2017-03-28 06:06 function.base-convert.html
-rw-r--r--     18083 2017-03-28 06:06 trader.constants.html
-rw-r--r--     21361 2017-03-28 06:06 function.mktime.html
-rw-r--r--      3684 2017-03-28 06:06 streamwrapper.dir-rewinddir.html
-rw-r--r--      5305 2017-03-28 06:07 function.strnatcasecmp.html
-rw-r--r--      5313 2017-03-28 06:06 function.pg-num-fields.html
-rw-r--r--      2495 2017-03-28 06:06 yaf-loader.import.html
-rw-r--r--      8721 2017-03-28 06:07 ds-set.reduce.html
-rw-r--r--      2864 2017-03-28 06:06 mysqlnd-qc.quickstart.html
-rw-r--r--      1593 2017-03-28 06:05 intro.info.html
-rw-r--r--      6703 2017-03-28 06:07 function.session-cache-expire.html
-rw-r--r--      1899 2017-03-28 06:07 ctype.installation.html
-rw-r--r--      1302 2017-03-28 06:07 ds.requirements.html
-rw-r--r--      7688 2017-03-28 06:06 function.maxdb-get-proto-info.html
-rw-r--r--      7718 2017-03-28 06:05 language.references.return.html
-rw-r--r--      3081 2017-03-28 06:06 swfbutton.setdown.html
-rw-r--r--      1918 2017-03-28 06:06 ref.mysqlnd-uh.html
-rw-r--r--      1988 2017-03-28 06:05 install.pecl.html
-rw-r--r--      3629 2017-03-28 06:06 function.openssl-x509-parse.html
-rw-r--r--      7180 2017-03-28 06:06 function.dbase-get-header-info.html
-rw-r--r--      4977 2017-03-28 06:06 function.fann-set-activation-function-layer.html
-rw-r--r--      4577 2017-03-28 06:07 quickhashstringinthash.savetostring.html
-rw-r--r--      3821 2017-03-28 06:06 function.fbsql-commit.html
-rw-r--r--     12346 2017-03-28 06:05 language.namespaces.basics.html
-rw-r--r--      3751 2017-03-28 06:06 function.log.html
-rw-r--r--      2937 2017-03-28 06:07 function.ssdeep-fuzzy-hash-filename.html
-rw-r--r--      4006 2017-03-28 06:06 tidy.examples.basic.html
-rw-r--r--      2288 2017-03-28 06:06 function.pdf-circle.html
-rw-r--r--     26606 2017-03-28 06:07 book.reflection.html
-rw-r--r--      1301 2017-03-28 06:06 intro.v8js.html
-rw-r--r--      5972 2017-03-28 06:06 function.dbx-error.html
-rw-r--r--      2720 2017-03-28 06:06 function.rewinddir.html
-rw-r--r--      5505 2017-03-28 06:07 function.apache-setenv.html
-rw-r--r--      2480 2017-03-28 06:06 intl.installation.html
-rw-r--r--      3760 2017-03-28 06:06 cairofontoptions.gethintstyle.html
-rw-r--r--      9267 2017-03-28 06:06 datetime.settimezone.html
-rw-r--r--      8637 2017-03-28 06:05 class.error.html
-rw-r--r--     12967 2017-03-28 06:06 imagick.setoption.html
-rw-r--r--      7778 2017-03-28 06:06 ref.pdo-mysql.connection.html
-rw-r--r--      3711 2017-03-28 06:05 function.ncurses-can-change-color.html
-rw-r--r--      9093 2017-03-28 06:07 function.simplexml-load-string.html
-rw-r--r--      3990 2017-03-28 06:06 yaf-route-simple.route.html
-rw-r--r--      3645 2017-03-28 06:06 swfdisplayitem.moveto.html
-rw-r--r--      2892 2017-03-28 06:06 gearmanworker.construct.html
-rw-r--r--      5328 2017-03-28 06:06 cairofontoptions.setantialias.html
-rw-r--r--      2674 2017-03-28 06:06 yaf-config-ini.offsetexists.html
-rw-r--r--      5871 2017-03-28 06:06 function.link.html
-rw-r--r--     10992 2017-03-28 06:06 messageformatter.setpattern.html
-rw-r--r--      4072 2017-03-28 06:07 class.ui-draw-brush.html
-rw-r--r--      6780 2017-03-28 06:07 class.ui-controls-editablecombo.html
-rw-r--r--      5287 2017-03-28 06:05 function.gzopen.html
-rw-r--r--      5549 2017-03-28 06:05 function.bzdecompress.html
-rw-r--r--      1985 2017-03-28 06:06 ps.installation.html
-rw-r--r--      3105 2017-03-28 06:06 class.cairofontweight.html
-rw-r--r--      8376 2017-03-28 06:06 imagickkernel.getmatrix.html
-rw-r--r--      9669 2017-03-28 06:06 function.iconv-mime-decode-headers.html
-rw-r--r--      5680 2017-03-28 06:07 function.is-array.html
-rw-r--r--      3398 2017-03-28 06:06 function.shm-remove-var.html
-rw-r--r--      8271 2017-03-28 06:07 function.strip-tags.html
-rw-r--r--      2335 2017-03-28 06:07 ui-draw-stroke.setmiterlimit.html
-rw-r--r--     18839 2017-03-28 06:06 class.yaf-controller-abstract.html
-rw-r--r--      9278 2017-03-28 06:05 pharfileinfo.decompress.html
-rw-r--r--      2534 2017-03-28 06:06 imagick.getregistry.html
-rw-r--r--      3677 2017-03-28 06:06 mysqli.dump-debug-info.html
-rw-r--r--      2752 2017-03-28 06:06 gearmantask.datasize.html
-rw-r--r--      2923 2017-03-28 06:06 haruencoder.getwritingmode.html
-rw-r--r--      6856 2017-03-28 06:06 class.mongodb-bson-decimal128.html
-rw-r--r--      2539 2017-03-28 06:07 solrresponse.getrawresponse.html
-rw-r--r--      2156 2017-03-28 06:07 xml.installation.html
-rw-r--r--      2201 2017-03-28 06:06 spl-types.installation.html
-rw-r--r--     22223 2017-03-28 06:07 function.usort.html
-rw-r--r--      3951 2017-03-28 06:07 book.swish.html
-rw-r--r--      8950 2017-03-28 06:06 mysqlnduhpreparedstatement.execute.html
-rw-r--r--      7732 2017-03-28 06:06 imagick.subimagematch.html
-rw-r--r--      4019 2017-03-28 06:05 function.apd-croak.html
-rw-r--r--      3915 2017-03-28 06:07 internals2.opcodes.post-dec-obj.html
-rw-r--r--      1388 2017-03-28 06:07 xmldiff.setup.html
-rw-r--r--      2735 2017-03-28 06:06 gmagickdraw.rotate.html
-rw-r--r--      3963 2017-03-28 06:06 function.ibase-blob-close.html
-rw-r--r--      2289 2017-03-28 06:06 intro.pdf.html
-rw-r--r--      4991 2017-03-28 06:06 mongodb-bson-binary.tostring.html
-rw-r--r--     19598 2017-03-28 06:06 eio.constants.html
-rw-r--r--      2387 2017-03-28 06:07 classkit.constants.html
-rw-r--r--      7484 2017-03-28 06:06 datetime.gettimezone.html
-rw-r--r--      8208 2017-03-28 06:06 cairocontext.appendpath.html
-rw-r--r--     10336 2017-03-28 06:06 evperiodic.construct.html
-rw-r--r--      2934 2017-03-28 06:06 hrtime-stopwatch.getelapsedtime.html
-rw-r--r--      5410 2017-03-28 06:07 reflectionparameter.getclass.html
-rw-r--r--      1285 2017-03-28 06:07 internals2.classes.html
-rw-r--r--      1594 2017-03-28 06:06 intro.imap.html
-rw-r--r--      2398 2017-03-28 06:07 ui-controls-group.construct.html
-rw-r--r--      3917 2017-03-28 06:06 tokyotyrant.construct.html
-rw-r--r--      5339 2017-03-28 06:07 swish.getpropertylist.html
-rw-r--r--      3491 2017-03-28 06:06 ref.calendar.html
-rw-r--r--      6430 2017-03-28 06:06 directoryiterator.current.html
-rw-r--r--      5827 2017-03-28 06:06 function.xdiff-file-bdiff.html
-rw-r--r--      5151 2017-03-28 06:06 cairocontext.showtext.html
-rw-r--r--      7543 2017-03-28 06:06 mysqlnduhconnection.getserverversion.html
-rw-r--r--      2370 2017-03-28 06:06 yaf-dispatcher.sleep.html
-rw-r--r--      3977 2017-03-28 06:07 ds-vector.last.html
-rw-r--r--      5443 2017-03-28 06:06 directoryiterator.seek.html
-rw-r--r--      3729 2017-03-28 06:07 reflectionfunction.export.html
-rw-r--r--      3820 2017-03-28 06:06 function.fbsql-clob-size.html
-rw-r--r--      3838 2017-03-28 06:06 function.proc-close.html
-rw-r--r--      2665 2017-03-28 06:06 yaf-request-abstract.getlanguage.html
-rw-r--r--      2629 2017-03-28 06:06 function.fann-destroy-train.html
-rw-r--r--      6197 2017-03-28 06:06 threaded.iswaiting.html
-rw-r--r--      2842 2017-03-28 06:06 function.pg-flush.html
-rw-r--r--      6411 2017-03-28 06:05 function.bzread.html
-rw-r--r--      3251 2017-03-28 06:06 eventhttpconnection.setmaxbodysize.html
-rw-r--r--      4186 2017-03-28 06:06 function.mysqlnd-ms-fabric-select-global.html
-rw-r--r--     11080 2017-03-28 06:06 mysqlnduhconnection.connect.html
-rw-r--r--      6638 2017-03-28 06:07 function.reset.html
-rw-r--r--      6369 2017-03-28 06:05 function.trigger-error.html
-rw-r--r--      2365 2017-03-28 06:07 migration53.sapi.html
-rw-r--r--      1299 2017-03-28 06:07 swish.examples.html
-rw-r--r--      7714 2017-03-28 06:06 function.grapheme-strpos.html
-rw-r--r--      4674 2017-03-28 06:06 imagick.opaquepaintimage.html
-rw-r--r--      5981 2017-03-28 06:05 function.ob-end-flush.html
-rw-r--r--      2396 2017-03-28 06:06 imagick.flattenimages.html
-rw-r--r--      4405 2017-03-28 06:06 evprepare.createstopped.html
-rw-r--r--     18412 2017-03-28 06:07 function.bbcode-set-arg-parser.html
-rw-r--r--      5630 2017-03-28 06:05 function.bcompiler-write-footer.html
-rw-r--r--      4782 2017-03-28 06:07 ds-map.haskey.html
-rw-r--r--      4851 2017-03-28 06:06 arrayiterator.rewind.html
-rw-r--r--      4069 2017-03-28 06:07 internals2.opcodes.post-inc-obj.html
-rw-r--r--      2455 2017-03-28 06:06 function.ibase-db-info.html
-rw-r--r--      9126 2017-03-28 06:06 function.pg-field-size.html
-rw-r--r--      3590 2017-03-28 06:07 xmlreader.setrelaxngschemasource.html
-rw-r--r--      3303 2017-03-28 06:05 function.newt-component-add-callback.html
-rw-r--r--      2162 2017-03-28 06:05 openal.installation.html
-rw-r--r--      2930 2017-03-28 06:05 function.ncurses-termname.html
-rw-r--r--      4251 2017-03-28 06:07 class.ui-draw-text-font-stretch.html
-rw-r--r--     13873 2017-03-28 06:06 imagickpixel.construct.html
-rw-r--r--      2667 2017-03-28 06:06 yaf-request-abstract.getmodulename.html
-rw-r--r--      4102 2017-03-28 06:07 internals2.opcodes.add-array-element.html
-rw-r--r--      7174 2017-03-28 06:06 tokyotyranttable.getquery.html
-rw-r--r--      7443 2017-03-28 06:07 xsltprocessor.registerphpfunctions.html
-rw-r--r--      5966 2017-03-28 06:06 directoryiterator.getctime.html
-rw-r--r--      2641 2017-03-28 06:06 lapack.identity.html
-rw-r--r--      2936 2017-03-28 06:06 judy.count.html
-rw-r--r--      2025 2017-03-28 06:07 migration53.class-constants.html
-rw-r--r--      3220 2017-03-28 06:06 function.ifxus-read-slob.html
-rw-r--r--      4236 2017-03-28 06:06 function.gnupg-geterror.html
-rw-r--r--      2679 2017-03-28 06:07 domnode.hasattributes.html
-rw-r--r--      4069 2017-03-28 06:05 function.xhprof-disable.html
-rw-r--r--      5160 2017-03-28 06:05 function.runkit-class-emancipate.html
-rw-r--r--      4929 2017-03-28 06:07 domentityreference.construct.html
-rw-r--r--      2821 2017-03-28 06:05 function.newt-form-set-timer.html
-rw-r--r--      8284 2017-03-28 06:07 function.ssh2-methods-negotiated.html
-rw-r--r--      6990 2017-03-28 06:06 function.cubrid-load-from-glo.html
-rw-r--r--      5763 2017-03-28 06:06 mongocollection.getwriteconcern.html
-rw-r--r--      5570 2017-03-28 06:07 reflectiongenerator.getexecutingfile.html
-rw-r--r--      2691 2017-03-28 06:06 function.eio-set-min-parallel.html
-rw-r--r--      5502 2017-03-28 06:06 function.mssql-min-error-severity.html
-rw-r--r--     11663 2017-03-28 06:07 class.solrupdateresponse.html
-rw-r--r--     12437 2017-03-28 06:07 changelog.strings.html
-rw-r--r--     13794 2017-03-28 06:06 mysqli.warning-count.html
-rw-r--r--      2725 2017-03-28 06:06 judy.firstempty.html
-rw-r--r--      1335 2017-03-28 06:05 lzf.configuration.html
-rw-r--r--      8856 2017-03-28 06:05 function.set-exception-handler.html
-rw-r--r--     18378 2017-03-28 06:05 language.types.integer.html
-rw-r--r--      1738 2017-03-28 06:06 function.fputs.html
-rw-r--r--     17445 2017-03-28 06:07 sammessage.header.html
-rw-r--r--      4783 2017-03-28 06:06 cairocontext.status.html
-rw-r--r--      4882 2017-03-28 06:07 ds-vector.push.html
-rw-r--r--      2941 2017-03-28 06:07 internals2.opcodes.assign-bw-or.html
-rw-r--r--      2547 2017-03-28 06:05 function.newt-button-bar.html
-rw-r--r--      4656 2017-03-28 06:06 gearmanclient.dolowbackground.html
-rw-r--r--      3548 2017-03-28 06:06 function.fann-set-cascade-weight-multiplier.html
-rw-r--r--      7707 2017-03-28 06:06 sqlite3stmt.bindvalue.html
-rw-r--r--      3795 2017-03-28 06:05 security.apache.html
-rw-r--r--      1429 2017-03-28 06:06 pspell.requirements.html
-rw-r--r--      2663 2017-03-28 06:06 mysqli-stmt.insert-id.html
-rw-r--r--      2851 2017-03-28 06:07 internals2.opcodes.assign-add.html
-rw-r--r--      2436 2017-03-28 06:06 gearmantask.construct.html
-rw-r--r--      3020 2017-03-28 06:06 recursiveiterator.getchildren.html
-rw-r--r--      1339 2017-03-28 06:06 intro.lua.html
-rw-r--r--      4815 2017-03-28 06:06 cairocontext.getdash.html
-rw-r--r--      2661 2017-03-28 06:07 migration5.databases.html
-rw-r--r--      6256 2017-03-28 06:07 reflectionfunctionabstract.hasreturntype.html
-rw-r--r--      4292 2017-03-28 06:06 worker.getstacked.html
-rw-r--r--      2413 2017-03-28 06:06 function.pdf-setgray.html
-rw-r--r--      4149 2017-03-28 06:06 function.imagesetclip.html
-rw-r--r--      2272 2017-03-28 06:06 function.stream-encoding.html
-rw-r--r--      5902 2017-03-28 06:06 ref.pdo-ibm.connection.html
-rw-r--r--      2875 2017-03-28 06:05 apc.installation.html
-rw-r--r--      3478 2017-03-28 06:06 tokyotyrant.restore.html
-rw-r--r--      6983 2017-03-28 06:07 samconnection.connect.html
-rw-r--r--      2882 2017-03-28 06:06 gmagick.removeimageprofile.html
-rw-r--r--      2593 2017-03-28 06:06 judy.bycount.html
-rw-r--r--      3226 2017-03-28 06:07 function.autoload.html
-rw-r--r--      1353 2017-03-28 06:05 openal.configuration.html
-rw-r--r--      1356 2017-03-28 06:07 mnogosearch.resources.html
-rw-r--r--      3476 2017-03-28 06:05 book.hash.html
-rw-r--r--      3812 2017-03-28 06:06 function.px-set-value.html
-rw-r--r--      2769 2017-03-28 06:06 mysqlnd-mux.architecture.html
-rw-r--r--      6671 2017-03-28 06:06 imagick.mergeimagelayers.html
-rw-r--r--      4571 2017-03-28 06:06 function.px-set-parameter.html
-rw-r--r--      5372 2017-03-28 06:07 function.socket-set-block.html
-rw-r--r--      6231 2017-03-28 06:06 cairocontext.setsourcergba.html
-rw-r--r--      3739 2017-03-28 06:06 imagick.getimageregion.html
-rw-r--r--      2518 2017-03-28 06:05 intro.memtrack.html
-rw-r--r--     11093 2017-03-28 06:06 mysqlnduhconnection.close.html
-rw-r--r--      4585 2017-03-28 06:06 function.openssl-pkey-export-to-file.html
-rw-r--r--     11767 2017-03-28 06:05 phardata.decompressfiles.html
-rw-r--r--      2646 2017-03-28 06:06 mysqli.get-warnings.html
-rw-r--r--      5019 2017-03-28 06:06 function.gmp-mul.html
-rw-r--r--      3001 2017-03-28 06:06 class.yaf-exception-loadfailed-module.html
-rw-r--r--      2236 2017-03-28 06:06 yaf-router.construct.html
-rw-r--r--      1515 2017-03-28 06:06 xattr.setup.html
-rw-r--r--     14702 2017-03-28 06:06 function.fread.html
-rw-r--r--      8438 2017-03-28 06:06 locale.getdisplayname.html
-rw-r--r--      4091 2017-03-28 06:06 class.cairocontent.html
-rw-r--r--      2995 2017-03-28 06:06 function.filepro.html
-rw-r--r--      3336 2017-03-28 06:06 function.trader-cdlcounterattack.html
-rw-r--r--      2922 2017-03-28 06:06 imagick.setregistry.html
-rw-r--r--      2238 2017-03-28 06:06 splfileobject.tostring.html
-rw-r--r--      3221 2017-03-28 06:05 function.newt-listbox-select-item.html
-rw-r--r--     15039 2017-03-28 06:06 ingres.configuration.html
-rw-r--r--      3599 2017-03-28 06:06 gmagick.chopimage.html
-rw-r--r--      4402 2017-03-28 06:06 function.cubrid-lob2-size.html
-rw-r--r--      8612 2017-03-28 06:07 function.array-intersect-assoc.html
-rw-r--r--      3234 2017-03-28 06:05 function.ncurses-erase.html
-rw-r--r--      6149 2017-03-28 06:05 class.generator.html
-rw-r--r--      1323 2017-03-28 06:05 hash.requirements.html
-rw-r--r--      3057 2017-03-28 06:07 sdo-model-type.isabstracttype.html
-rw-r--r--      2535 2017-03-28 06:06 function.ibase-errmsg.html
-rw-r--r--      2094 2017-03-28 06:06 swffont.getshape.html
-rw-r--r--      4030 2017-03-28 06:06 syncreaderwriter.writeunlock.html
-rw-r--r--      1723 2017-03-28 06:07 internals2.variables.html
-rw-r--r--      9754 2017-03-28 06:06 function.cubrid-lob2-bind.html
-rw-r--r--      4784 2017-03-28 06:07 function.ldap-rename.html
-rw-r--r--      3685 2017-03-28 06:07 internals2.counter.function.counter-bump-value.html
-rw-r--r--     10553 2017-03-28 06:06 function.maxdb-thread-id.html
-rw-r--r--      3939 2017-03-28 06:07 ds-set.clear.html
-rw-r--r--      4534 2017-03-28 06:06 function.cubrid-list-dbs.html
-rw-r--r--      4288 2017-03-28 06:06 function.ezmlm-hash.html
-rw-r--r--      6844 2017-03-28 06:07 function.get-defined-functions.html
-rw-r--r--      3234 2017-03-28 06:07 reflectionfunctionabstract.getfilename.html
-rw-r--r--      2181 2017-03-28 06:06 imagick.setlastiterator.html
-rw-r--r--      1356 2017-03-28 06:05 csprng.configuration.html
-rw-r--r--      6905 2017-03-28 06:06 function.xdiff-file-diff.html
-rw-r--r--      4852 2017-03-28 06:06 function.cairo-font-options-set-subpixel-order.html
-rw-r--r--      7626 2017-03-28 06:06 function.pg-fetch-row.html
-rw-r--r--      5205 2017-03-28 06:06 book.mssql.html
-rw-r--r--      3178 2017-03-28 06:07 internals2.opcodes.is-smaller-or-equal.html
-rw-r--r--      1562 2017-03-28 06:07 xmlwriter.setup.html
-rw-r--r--      3924 2017-03-28 06:06 swfdisplayitem.skewxto.html
-rw-r--r--      4623 2017-03-28 06:06 ref.libevent.html
-rw-r--r--      4713 2017-03-28 06:06 function.imap-fetchheader.html
-rw-r--r--      4927 2017-03-28 06:06 function.cairo-svg-surface-create.html
-rw-r--r--     12743 2017-03-28 06:06 function.sqlite-array-query.html
-rw-r--r--      2826 2017-03-28 06:06 imagick.setimagecompression.html
-rw-r--r--      6764 2017-03-28 06:07 function.compact.html
-rw-r--r--      2618 2017-03-28 06:07 solrquery.getmltmaxwordlength.html
-rw-r--r--      6579 2017-03-28 06:06 function.rename.html
-rw-r--r--      5806 2017-03-28 06:06 msql.examples-basic.html
-rw-r--r--      2055 2017-03-28 06:07 solrquery.getexpand.html
-rw-r--r--      1328 2017-03-28 06:06 gettext.resources.html
-rw-r--r--      2860 2017-03-28 06:06 evstat.set.html
-rw-r--r--      2843 2017-03-28 06:06 event.persistence.html
-rw-r--r--      3997 2017-03-28 06:06 splfileinfo.getpathname.html
-rw-r--r--      4529 2017-03-28 06:07 memcache.getstats.html
-rw-r--r--      1621 2017-03-28 06:07 extensions.html
-rw-r--r--      9985 2017-03-28 06:06 function.imagefilltoborder.html
-rw-r--r--      2006 2017-03-28 06:06 function.date-create-from-format.html
-rw-r--r--      6354 2017-03-28 06:06 odbc.installation.html
-rw-r--r--      4742 2017-03-28 06:07 ds-deque.allocate.html
-rw-r--r--      1580 2017-03-28 06:06 filesystem.setup.html
-rw-r--r--     19000 2017-03-28 06:06 mysqli-stmt.bind-param.html
-rw-r--r--      3534 2017-03-28 06:06 appenditerator.next.html
-rw-r--r--      8337 2017-03-28 06:05 ziparchive.getexternalattributesindex.html
-rw-r--r--      2140 2017-03-28 06:07 ui-area.redraw.html
-rw-r--r--      2607 2017-03-28 06:06 oci-collection.free.html
-rw-r--r--     11422 2017-03-28 06:07 filters.encryption.html
-rw-r--r--      2561 2017-03-28 06:06 judy.offsetexists.html
-rw-r--r--     15172 2017-03-28 06:05 ncurses.keyconsts.html
-rw-r--r--      4491 2017-03-28 06:06 function.fdf-get-value.html
-rw-r--r--      2457 2017-03-28 06:07 zmqsocket.ispersistent.html
-rw-r--r--      2765 2017-03-28 06:06 uconverter.setdestinationencoding.html
-rw-r--r--      4677 2017-03-28 06:06 mongodate.todatetime.html
-rw-r--r--     11312 2017-03-28 06:06 function.sqlsrv-fetch.html
-rw-r--r--      2682 2017-03-28 06:07 ref.win32service.html
-rw-r--r--      4116 2017-03-28 06:06 tokyotyrant.num.html
-rw-r--r--      4520 2017-03-28 06:06 lapack.pseudoinverse.html
-rw-r--r--      8218 2017-03-28 06:07 quickhashintset.exists.html
-rw-r--r--      4690 2017-03-28 06:06 function.cairo-ps-surface-set-eps.html
-rw-r--r--      2028 2017-03-28 06:06 intro.fbsql.html
-rw-r--r--     13368 2017-03-28 06:07 function.svn-diff.html
-rw-r--r--      1214 2017-03-28 06:07 wddx.constants.html
-rw-r--r--      2786 2017-03-28 06:05 apd.installation.html
-rw-r--r--      5524 2017-03-28 06:06 function.msg-stat-queue.html
-rw-r--r--      3707 2017-03-28 06:07 sdodasrel.limitations.html
-rw-r--r--     12845 2017-03-28 06:07 function.levenshtein.html
-rw-r--r--      1349 2017-03-28 06:06 cairo.configuration.html
-rw-r--r--      6257 2017-03-28 06:06 intlchar.istitle.html
-rw-r--r--     10210 2017-03-28 06:06 set.mongodb.html
-rw-r--r--      2730 2017-03-28 06:06 swffontchar.addutf8chars.html
-rw-r--r--      2832 2017-03-28 06:07 internals2.counter.counter-class.resetvalue.html
-rw-r--r--      2628 2017-03-28 06:06 gearmanclient.removeoptions.html
-rw-r--r--      5986 2017-03-28 06:06 function.stream-set-write-buffer.html
-rw-r--r--      2843 2017-03-28 06:06 eventdnsbase.addnameserverip.html
-rw-r--r--      2924 2017-03-28 06:06 imagick.setimageattribute.html
-rw-r--r--      6262 2017-03-28 06:07 class.ui-exception-runtimeexception.html
-rw-r--r--      1792 2017-03-28 06:06 intro.spl.html
-rw-r--r--      3219 2017-03-28 06:07 internals2.opcodes.nop.html
-rw-r--r--      6705 2017-03-28 06:06 function.chgrp.html
-rw-r--r--      6764 2017-03-28 06:06 mongo.getpoolsize.html
-rw-r--r--      5601 2017-03-28 06:06 book.fdf.html
-rw-r--r--     10048 2017-03-28 06:05 context.socket.html
-rw-r--r--      3445 2017-03-28 06:05 function.apd-dump-persistent-resources.html
-rw-r--r--      7033 2017-03-28 06:07 memcache.increment.html
-rw-r--r--      1772 2017-03-28 06:06 gmp.requirements.html
-rw-r--r--      1489 2017-03-28 06:06 ftp.setup.html
-rw-r--r--      5642 2017-03-28 06:06 messageformatter.getlocale.html
-rw-r--r--      9782 2017-03-28 06:05 rararchive.getentry.html
-rw-r--r--      4887 2017-03-28 06:06 function.ps-add-bookmark.html
-rw-r--r--      4591 2017-03-28 06:07 function.setrawcookie.html
-rw-r--r--      5551 2017-03-28 06:06 imagick.sharpenimage.html
-rw-r--r--      1742 2017-03-28 06:05 xhprof.requirements.html
-rw-r--r--      2012 2017-03-28 06:07 ref.wddx.html
-rw-r--r--      4518 2017-03-28 06:07 ds-queue.construct.html
-rw-r--r--      1459 2017-03-28 06:07 intro.fpm.html
-rw-r--r--      2139 2017-03-28 06:06 book.proctitle.html
-rw-r--r--      2758 2017-03-28 06:07 solrquery.settermsmaxcount.html
-rw-r--r--      5033 2017-03-28 06:07 ds.examples.html
-rw-r--r--      5156 2017-03-28 06:05 language.constants.html
-rw-r--r--      3028 2017-03-28 06:05 function.ncurses-whline.html
-rw-r--r--      2922 2017-03-28 06:07 solrquery.sethighlight.html
-rw-r--r--      2571 2017-03-28 06:07 xml.error-codes.html
-rw-r--r--      4507 2017-03-28 06:06 splobjectstorage.serialize.html
-rw-r--r--      1485 2017-03-28 06:06 intro.fann.html
-rw-r--r--      7909 2017-03-28 06:05 function.xhprof-enable.html
-rw-r--r--      8727 2017-03-28 06:06 mongodb-driver-writeresult.getinsertedcount.html
-rw-r--r--      3243 2017-03-28 06:05 function.m-setssl-files.html
-rw-r--r--     11115 2017-03-28 06:06 function.maxdb-stmt-num-rows.html
-rw-r--r--     20827 2017-03-28 06:07 sdo.sample.getset.html
-rw-r--r--      1296 2017-03-28 06:07 funchand.constants.html
-rw-r--r--      8010 2017-03-28 06:07 function.print.html
-rw-r--r--      2494 2017-03-28 06:06 splfixedarray.valid.html
-rw-r--r--      2671 2017-03-28 06:06 yaf-request-abstract.getrequesturi.html
-rw-r--r--      6786 2017-03-28 06:05 function.random-bytes.html
-rw-r--r--      5224 2017-03-28 06:07 memcached.addbykey.html
-rw-r--r--      4262 2017-03-28 06:05 function.uopz-backup.html
-rw-r--r--      5885 2017-03-28 06:06 function.gmp-clrbit.html
-rw-r--r--     15713 2017-03-28 06:07 function.socket-recv.html
-rw-r--r--      2938 2017-03-28 06:07 internals2.opcodes.assign-bw-xor.html
-rw-r--r--      1795 2017-03-28 06:07 function.doubleval.html
-rw-r--r--      3925 2017-03-28 06:06 evidle.construct.html
-rw-r--r--      4938 2017-03-28 06:07 internals2.opcodes.fetch-dim-rw.html
-rw-r--r--      1755 2017-03-28 06:06 function.msql.html
-rw-r--r--      3036 2017-03-28 06:07 function.libxml-get-last-error.html
-rw-r--r--      2602 2017-03-28 06:07 ui-draw-pen.write.html
-rw-r--r--      8658 2017-03-28 06:05 install.pecl.windows.html
-rw-r--r--      6138 2017-03-28 06:06 yaf-response-abstract.setbody.html
-rw-r--r--      2768 2017-03-28 06:05 function.ncurses-wrefresh.html
-rw-r--r--      9502 2017-03-28 06:07 function.substr-count.html
-rw-r--r--      5309 2017-03-28 06:07 function.xmlwriter-start-document.html
-rw-r--r--      2466 2017-03-28 06:06 function.trader-log10.html
-rw-r--r--      7347 2017-03-28 06:07 function.ldap-get-attributes.html
-rw-r--r--      9198 2017-03-28 06:06 book.openssl.html
-rw-r--r--      5563 2017-03-28 06:06 function.jdtojewish.html
-rw-r--r--      7310 2017-03-28 06:05 apciterator.construct.html
-rw-r--r--      2620 2017-03-28 06:06 function.vpopmail-alias-del.html
-rw-r--r--      4887 2017-03-28 06:05 function.newt-button.html
-rw-r--r--      3983 2017-03-28 06:06 imagick.getimagechanneldistortion.html
-rw-r--r--      1974 2017-03-28 06:07 book.tcpwrap.html
-rw-r--r--      4539 2017-03-28 06:07 function.variant-pow.html
-rw-r--r--      4091 2017-03-28 06:06 evloop.construct.html
-rw-r--r--      2550 2017-03-28 06:06 imagick.getimagegreenprimary.html
-rw-r--r--      8165 2017-03-28 06:06 mysqli.get-proto-info.html
-rw-r--r--      5911 2017-03-28 06:07 function.socket-connect.html
-rw-r--r--      6178 2017-03-28 06:06 function.pg-affected-rows.html
-rw-r--r--      3872 2017-03-28 06:07 ds-vector.reverse.html
-rw-r--r--      1672 2017-03-28 06:07 svm.installation.html
-rw-r--r--      5163 2017-03-28 06:06 function.gmp-invert.html
-rw-r--r--      5504 2017-03-28 06:07 function.preg-grep.html
-rw-r--r--      8440 2017-03-28 06:06 function.px-timestamp2string.html
-rw-r--r--      3442 2017-03-28 06:06 ref.pdo-sqlite.html
-rw-r--r--      2238 2017-03-28 06:06 mongocursor.reset.html
-rw-r--r--      3567 2017-03-28 06:05 function.openal-context-suspend.html
-rw-r--r--      3077 2017-03-28 06:05 function.m-responsekeys.html
-rw-r--r--      5606 2017-03-28 06:06 function.fdf-save-string.html
-rw-r--r--      1513 2017-03-28 06:05 blenc.setup.html
-rw-r--r--     19639 2017-03-28 06:06 class.datetime.html
-rw-r--r--      5283 2017-03-28 06:07 quickhashintset.savetofile.html
-rw-r--r--      1377 2017-03-28 06:06 spl-types.configuration.html
-rw-r--r--      4466 2017-03-28 06:06 function.fann-init-weights.html
-rw-r--r--     10986 2017-03-28 06:06 intlcalendar.equals.html
-rw-r--r--      7828 2017-03-28 06:06 intlchar.digit.html
-rw-r--r--      3789 2017-03-28 06:06 function.msql-db-query.html
-rw-r--r--      3393 2017-03-28 06:06 function.fann-get-sarprop-step-error-shift.html
-rw-r--r--      7141 2017-03-28 06:06 ref.oci8.html
-rw-r--r--      2201 2017-03-28 06:07 function.ldap-first-reference.html
-rw-r--r--     15281 2017-03-28 06:06 function.oci-new-connect.html
-rw-r--r--      4872 2017-03-28 06:07 memcached.deletemultibykey.html
-rw-r--r--      3184 2017-03-28 06:06 yaf-controller-abstract.construct.html
-rw-r--r--      3663 2017-03-28 06:06 mongodb-driver-server.ishidden.html
-rw-r--r--      1782 2017-03-28 06:05 control-structures.intro.html
-rw-r--r--      7392 2017-03-28 06:07 function.xml-set-unparsed-entity-decl-handler.html
-rw-r--r--      4173 2017-03-28 06:07 zookeeper.connect.html
-rw-r--r--      1335 2017-03-28 06:06 gmp.configuration.html
-rw-r--r--      1363 2017-03-28 06:06 filepro.configuration.html
-rw-r--r--      4933 2017-03-28 06:06 cairofontoptions.getantialias.html
-rw-r--r--      5733 2017-03-28 06:06 function.gmp-testbit.html
-rw-r--r--      1372 2017-03-28 06:05 bzip2.resources.html
-rw-r--r--      2199 2017-03-28 06:07 function.ldap-next-reference.html
-rw-r--r--      5897 2017-03-28 06:06 mongodb.repair.html
-rw-r--r--      4549 2017-03-28 06:07 quickhashintset.getsize.html
-rw-r--r--      9594 2017-03-28 06:07 domimplementation.hasfeature.html
-rw-r--r--      3193 2017-03-28 06:05 function.bzflush.html
-rw-r--r--      3247 2017-03-28 06:06 harupage.circle.html
-rw-r--r--      9627 2017-03-28 06:06 mysqli.ping.html
-rw-r--r--      2938 2017-03-28 06:06 hrtime-stopwatch.getlastelapsedtime.html
-rw-r--r--      3736 2017-03-28 06:06 sqlite3.exec.html
-rw-r--r--      5098 2017-03-28 06:07 function.session-id.html
-rw-r--r--      3522 2017-03-28 06:06 function.oci-lob-copy.html
-rw-r--r--      1649 2017-03-28 06:06 mysqlnd-ms.setup.html
-rw-r--r--      4877 2017-03-28 06:05 function.bzopen.html
-rw-r--r--      1502 2017-03-28 06:06 ref.proctitle.html
-rw-r--r--     20989 2017-03-28 06:05 function.include.html
-rw-r--r--      3205 2017-03-28 06:07 function.xml-error-string.html
-rw-r--r--      2694 2017-03-28 06:07 solrobject.offsetget.html
-rw-r--r--     11349 2017-03-28 06:07 function.count.html
-rw-r--r--      2296 2017-03-28 06:07 function.fastcgi-finish-request.html
-rw-r--r--      8401 2017-03-28 06:06 function.define.html
-rw-r--r--      3282 2017-03-28 06:07 migration70.removed-exts-sapis.html
-rw-r--r--     16204 2017-03-28 06:06 book.oci8.html
-rw-r--r--      2338 2017-03-28 06:07 ui-controls-radio.append.html
-rw-r--r--      4567 2017-03-28 06:06 function.cairo-scaled-font-get-font-face.html
-rw-r--r--     15925 2017-03-28 06:06 ref.sqlite.html
-rw-r--r--      3460 2017-03-28 06:06 function.pcntl-wifexited.html
-rw-r--r--      5175 2017-03-28 06:06 function.posix-setegid.html
-rw-r--r--      3254 2017-03-28 06:06 function.dbplus-unselect.html
-rw-r--r--      4169 2017-03-28 06:07 function.xml-parser-create-ns.html
-rw-r--r--      6687 2017-03-28 06:07 ds-map.map.html
-rw-r--r--      6286 2017-03-28 06:06 function.fann-train-on-data.html
-rw-r--r--      2763 2017-03-28 06:07 function.svn-fs-is-dir.html
-rw-r--r--      2975 2017-03-28 06:06 gmagick.readimagefile.html
-rw-r--r--      5978 2017-03-28 06:06 book.math.html
-rw-r--r--      4225 2017-03-28 06:05 function.newt-open-window.html
-rw-r--r--     12294 2017-03-28 06:06 function.mysql-fetch-assoc.html
-rw-r--r--      3184 2017-03-28 06:05 function.ncurses-clear.html
-rw-r--r--      2600 2017-03-28 06:07 ui-menu.appendquit.html
-rw-r--r--      2736 2017-03-28 06:06 function.trader-rocr100.html
-rw-r--r--     10464 2017-03-28 06:06 function.pg-fetch-object.html
-rw-r--r--      3425 2017-03-28 06:07 sdo-model-type.isinstance.html
-rw-r--r--      3341 2017-03-28 06:06 function.trader-cdlxsidegap3methods.html
-rw-r--r--      1286 2017-03-28 06:07 internals2.apiref.html
-rw-r--r--      3766 2017-03-28 06:06 function.acosh.html
-rw-r--r--      5360 2017-03-28 06:06 eventbufferevent.getinput.html
-rw-r--r--      5152 2017-03-28 06:05 function.crack-check.html
-rw-r--r--      1806 2017-03-28 06:06 ev.installation.html
-rw-r--r--      7380 2017-03-28 06:06 function.pg-lo-export.html
-rw-r--r--      6744 2017-03-28 06:06 imagick.getpixeliterator.html
-rw-r--r--      3559 2017-03-28 06:06 mysqli-stmt.attr-get.html
-rw-r--r--      2763 2017-03-28 06:07 solrdocument.getinputdocument.html
-rw-r--r--      5500 2017-03-28 06:06 function.fbsql-field-name.html
-rw-r--r--      3055 2017-03-28 06:05 function.mcrypt-enc-self-test.html
-rw-r--r--      3722 2017-03-28 06:07 internals2.opcodes.send-ref.html
-rw-r--r--      9233 2017-03-28 06:07 function.number-format.html
-rw-r--r--      8320 2017-03-28 06:06 imagick.setimagetickspersecond.html
-rw-r--r--      3514 2017-03-28 06:07 hwapi.insertcollection.html
-rw-r--r--      3209 2017-03-28 06:07 reflectionproperty.getdeclaringclass.html
-rw-r--r--      3444 2017-03-28 06:06 ref.mailparse.html
-rw-r--r--      2505 2017-03-28 06:06 emptyiterator.rewind.html
-rw-r--r--      2903 2017-03-28 06:07 about.generate.html
-rw-r--r--      2761 2017-03-28 06:07 solrquery.settermsmincount.html
-rw-r--r--      1397 2017-03-28 06:06 shmop.resources.html
-rw-r--r--      2925 2017-03-28 06:06 eventbufferevent.sslgetciphername.html
-rw-r--r--      2582 2017-03-28 06:06 spldoublylinkedlist.valid.html
-rw-r--r--      5847 2017-03-28 06:06 directoryiterator.getmtime.html
-rw-r--r--      2491 2017-03-28 06:06 yaf-dispatcher.getinstance.html
-rw-r--r--      3217 2017-03-28 06:06 gmagick.setimageredprimary.html
-rw-r--r--      7616 2017-03-28 06:06 streamwrapper.stream-metadata.html
-rw-r--r--      3376 2017-03-28 06:06 recursiveiteratoriterator.getmaxdepth.html
-rw-r--r--     14827 2017-03-28 06:05 book.newt.html
-rw-r--r--      2832 2017-03-28 06:06 function.vpopmail-auth-user.html
-rw-r--r--      5317 2017-03-28 06:06 function.mb-strrchr.html
-rw-r--r--      2550 2017-03-28 06:06 yaf-session.get.html
-rw-r--r--      8125 2017-03-28 06:06 book.tokyo-tyrant.html
-rw-r--r--      4063 2017-03-28 06:06 function.dio-close.html
-rw-r--r--      4633 2017-03-28 06:06 ref.curl.html
-rw-r--r--      3851 2017-03-28 06:07 reflectionobject.export.html
-rw-r--r--      3165 2017-03-28 06:05 function.m-getheader.html
-rw-r--r--      5588 2017-03-28 06:06 yaf-application.execute.html
-rw-r--r--      4888 2017-03-28 06:06 evchild.createstopped.html
-rw-r--r--      3942 2017-03-28 06:06 ref.pdo-firebird.connection.html
-rw-r--r--      2837 2017-03-28 06:05 function.radius-request-authenticator.html
-rw-r--r--      2762 2017-03-28 06:06 imagick.setimagefilename.html
-rw-r--r--      2973 2017-03-28 06:06 eventbase.priorityinit.html
-rw-r--r--      1780 2017-03-28 06:06 exif.installation.html
-rw-r--r--      7903 2017-03-28 06:06 recursivearrayiterator.getchildren.html
-rw-r--r--      2606 2017-03-28 06:06 gender-gender.construct.html
-rw-r--r--     12324 2017-03-28 06:07 yar.examples.html
-rw-r--r--      3266 2017-03-28 06:06 function.stats-cdf-logistic.html
-rw-r--r--      3608 2017-03-28 06:07 internals2.opcodes.is-equal.html
-rw-r--r--      3856 2017-03-28 06:07 sdo-das-xml.addtypes.html
-rw-r--r--      4297 2017-03-28 06:06 function.imap-gc.html
-rw-r--r--      3969 2017-03-28 06:07 oauth.setnonce.html
-rw-r--r--      4929 2017-03-28 06:06 mysqlnd-ms.transaction.html
-rw-r--r--      2573 2017-03-28 06:06 imagick.getimagepage.html
-rw-r--r--      3151 2017-03-28 06:07 soapclient.setcookie.html
-rw-r--r--      6419 2017-03-28 06:05 function.php-ini-scanned-files.html
-rw-r--r--      9128 2017-03-28 06:06 function.sqlsrv-send-stream-data.html
-rw-r--r--      2433 2017-03-28 06:06 function.pdf-setgray-stroke.html
-rw-r--r--      3095 2017-03-28 06:05 function.kadm5-destroy.html
-rw-r--r--      5260 2017-03-28 06:05 book.rar.html
-rw-r--r--      5241 2017-03-28 06:07 apache.configuration.html
-rw-r--r--      4056 2017-03-28 06:06 gmagick.raiseimage.html
-rw-r--r--      2313 2017-03-28 06:07 ui-controls-colorbutton.onchange.html
-rw-r--r--      2143 2017-03-28 06:05 function.lzf-optimized-for.html
-rw-r--r--      3126 2017-03-28 06:06 imagick.getimagepixelcolor.html
-rw-r--r--      3213 2017-03-28 06:06 evchild.set.html
-rw-r--r--      4272 2017-03-28 06:05 error.gettraceasstring.html
-rw-r--r--      5381 2017-03-28 06:06 cairocontext.setfontoptions.html
-rw-r--r--      3250 2017-03-28 06:06 function.trader-cdlhikkake.html
-rw-r--r--      6734 2017-03-28 06:07 memcached.fetch.html
-rw-r--r--      2770 2017-03-28 06:07 ui-window.construct.html
-rw-r--r--      8938 2017-03-28 06:06 pdo.pgsqllobcreate.html
-rw-r--r--      2415 2017-03-28 06:06 judy.free.html
-rw-r--r--      1318 2017-03-28 06:06 intro.sybase.html
-rw-r--r--      5087 2017-03-28 06:07 ref.sockets.html
-rw-r--r--      1764 2017-03-28 06:07 migration54.removed-extensions.html
-rw-r--r--      5225 2017-03-28 06:06 function.ingres-pconnect.html
-rw-r--r--      3920 2017-03-28 06:06 function.xdiff-string-bpatch.html
-rw-r--r--      5710 2017-03-28 06:06 splfileinfo.getfilename.html
-rw-r--r--      5256 2017-03-28 06:06 oci8.datatypes.html
-rw-r--r--      8932 2017-03-28 06:06 function.curl-multi-add-handle.html
-rw-r--r--      5911 2017-03-28 06:06 intlchar.isidignorable.html
-rw-r--r--      3115 2017-03-28 06:06 function.pdf-add-weblink.html
-rw-r--r--      2661 2017-03-28 06:06 intlbreakiterator.gettext.html
-rw-r--r--      5791 2017-03-28 06:06 function.mb-encoding-aliases.html
-rw-r--r--      2548 2017-03-28 06:06 evsignal.set.html
-rw-r--r--      3627 2017-03-28 06:07 regexp.reference.delimiters.html
-rw-r--r--      3706 2017-03-28 06:07 function.session-decode.html
-rw-r--r--      3248 2017-03-28 06:07 net-gopher.constants.html
-rw-r--r--      5817 2017-03-28 06:06 function.mongodb.bson-fromphp.html
-rw-r--r--      8868 2017-03-28 06:06 function.imap-delete.html
-rw-r--r--      3031 2017-03-28 06:06 imagick.setimageredprimary.html
-rw-r--r--      2857 2017-03-28 06:06 gmagickpixel.setcolor.html
-rw-r--r--      4840 2017-03-28 06:06 function.ifx-num-fields.html
-rw-r--r--      8791 2017-03-28 06:07 function.preg-replace-callback-array.html
-rw-r--r--      1363 2017-03-28 06:06 tokyo-tyrant.resources.html
-rw-r--r--      2645 2017-03-28 06:07 solrdocument.unserialize.html
-rw-r--r--      3338 2017-03-28 06:05 function.newt-entry.html
-rw-r--r--      4405 2017-03-28 06:06 function.fdf-set-submit-form-action.html
-rw-r--r--      7575 2017-03-28 06:06 function.mysql-list-processes.html
-rw-r--r--      3027 2017-03-28 06:06 intltimezone.fromdatetimezone.html
-rw-r--r--      2486 2017-03-28 06:05 oop5.intro.html
-rw-r--r--     20836 2017-03-28 06:07 com.constants.html
-rw-r--r--      2695 2017-03-28 06:06 function.odbc-close-all.html
-rw-r--r--      8156 2017-03-28 06:05 features.dtrace.systemtap.html
-rw-r--r--      2920 2017-03-28 06:06 intlbreakiterator.createcodepointinstance.html
-rw-r--r--      3368 2017-03-28 06:05 mpegfile.construct.html
-rw-r--r--      7638 2017-03-28 06:07 zookeeper.addauth.html
-rw-r--r--      4448 2017-03-28 06:06 function.cairo-pattern-get-surface.html
-rw-r--r--      6672 2017-03-28 06:07 function.classkit-import.html
-rw-r--r--     10440 2017-03-28 06:06 class.multipleiterator.html
-rw-r--r--      1322 2017-03-28 06:06 vpopmail.requirements.html
-rw-r--r--      6231 2017-03-28 06:06 function.fann-train-on-file.html
-rw-r--r--      8228 2017-03-28 06:05 function.assert-options.html
-rw-r--r--      3371 2017-03-28 06:06 function.posix-getuid.html
-rw-r--r--      6538 2017-03-28 06:07 swishresult.stem.html
-rw-r--r--      4313 2017-03-28 06:07 ds-sequence.reversed.html
-rw-r--r--      5648 2017-03-28 06:06 class.mongodb-driver-cursor.html
-rw-r--r--      6483 2017-03-28 06:07 solrdocument.toarray.html
-rw-r--r--      2430 2017-03-28 06:06 event.flags.html
-rw-r--r--      3124 2017-03-28 06:06 function.ps-save.html
-rw-r--r--      3445 2017-03-28 06:06 function.asin.html
-rw-r--r--      7356 2017-03-28 06:07 function.nl2br.html
-rw-r--r--     33937 2017-03-28 06:06 mysqlnd-ms.quickstart.gtid.html
-rw-r--r--      3667 2017-03-28 06:07 function.win32-start-service.html
-rw-r--r--      3736 2017-03-28 06:06 function.maxdb-init.html
-rw-r--r--      6214 2017-03-28 06:05 function.wincache-ucache-cas.html
-rw-r--r--     13966 2017-03-28 06:07 internals2.funcs.html
-rw-r--r--      4188 2017-03-28 06:06 imagick.liquidrescaleimage.html
-rw-r--r--      5090 2017-03-28 06:07 solrclient.optimize.html
-rw-r--r--      2251 2017-03-28 06:06 function.pdf-setlinejoin.html
-rw-r--r--      4120 2017-03-28 06:06 mysqli-stmt.reset.html
-rw-r--r--      8604 2017-03-28 06:06 yaf-plugin-abstract.routershutdown.html
-rw-r--r--      1329 2017-03-28 06:06 mailparse.requirements.html
-rw-r--r--     10827 2017-03-28 06:06 function.sqlsrv-get-field.html
-rw-r--r--      1851 2017-03-28 06:06 function.set-file-buffer.html
-rw-r--r--     20145 2017-03-28 06:07 sockets.examples.html
-rw-r--r--      3041 2017-03-28 06:06 haruannotation.setopened.html
-rw-r--r--      3099 2017-03-28 06:05 function.openal-buffer-destroy.html
-rw-r--r--      3294 2017-03-28 06:06 function.fann-get-mse.html
-rw-r--r--      2007 2017-03-28 06:06 function.date-get-last-errors.html
-rw-r--r--     39199 2017-03-28 06:05 language.operators.comparison.html
-rw-r--r--      2866 2017-03-28 06:06 uconverter.convert.html
-rw-r--r--      6408 2017-03-28 06:06 intlcalendar.gettime.html
-rw-r--r--      2794 2017-03-28 06:06 swffill.rotateto.html
-rw-r--r--      4566 2017-03-28 06:06 function.cubrid-lob2-size64.html
-rw-r--r--      3847 2017-03-28 06:06 function.dbplus-rchperm.html
-rw-r--r--     10563 2017-03-28 06:06 function.imap-fetch-overview.html
-rw-r--r--      3869 2017-03-28 06:06 function.fann-get-cascade-num-candidate-groups.html
-rw-r--r--      7245 2017-03-28 06:06 intldateformatter.getcalendarobject.html
-rw-r--r--      5947 2017-03-28 06:06 function.mb-eregi-replace.html
-rw-r--r--      2803 2017-03-28 06:05 function.ncurses-delay-output.html
-rw-r--r--      2454 2017-03-28 06:07 solrquery.getterms.html
-rw-r--r--    102082 2017-03-28 06:07 class.solrquery.html
-rw-r--r--      7198 2017-03-28 06:06 function.pg-result-status.html
-rw-r--r--     18454 2017-03-28 06:07 filter.constants.html
-rw-r--r--      2703 2017-03-28 06:06 function.pdf-get-pdi-value.html
-rw-r--r--      1529 2017-03-28 06:06 sqlite.setup.html
-rw-r--r--     11088 2017-03-28 06:07 sam.installation.html
-rw-r--r--      2506 2017-03-28 06:06 function.trader-ht-trendline.html
-rw-r--r--      4002 2017-03-28 06:06 function.sybase-close.html
-rw-r--r--     15402 2017-03-28 06:07 class.sessionhandlerinterface.html
-rw-r--r--      4741 2017-03-28 06:06 function.cairo-font-options-equal.html
-rw-r--r--      2645 2017-03-28 06:07 solrquery.getfacetprefix.html
-rw-r--r--      1796 2017-03-28 06:06 timezones.australia.html
-rw-r--r--      4487 2017-03-28 06:06 function.cairo-scaled-font-get-ctm.html
-rw-r--r--      7611 2017-03-28 06:06 mongocommandcursor.timeout.html
-rw-r--r--      1419 2017-03-28 06:07 intro.stomp.html
-rw-r--r--      6336 2017-03-28 06:06 function.imagecrop.html
-rw-r--r--     20707 2017-03-28 06:06 mysqli.construct.html
-rw-r--r--      2813 2017-03-28 06:07 solrquery.getfacetdatehardend.html
-rw-r--r--      3955 2017-03-28 06:07 ds-deque.first.html
-rw-r--r--      4466 2017-03-28 06:05 error.gettrace.html
-rw-r--r--      3847 2017-03-28 06:06 worker.stack.html
-rw-r--r--      2347 2017-03-28 06:07 ui-controls-button.settext.html
-rw-r--r--      1335 2017-03-28 06:06 mbstring.resources.html
-rw-r--r--      7366 2017-03-28 06:07 book.session.html
-rw-r--r--      2842 2017-03-28 06:07 solrinputdocument.getfieldboost.html
-rw-r--r--      2904 2017-03-28 06:06 function.odbc-field-num.html
-rw-r--r--      7553 2017-03-28 06:06 function.fseek.html
-rw-r--r--     27192 2017-03-28 06:06 eventbufferevent.connect.html
-rw-r--r--      7182 2017-03-28 06:07 stomp.getsessionid.html
-rw-r--r--      1345 2017-03-28 06:06 eio.resources.html
-rw-r--r--     10531 2017-03-28 06:05 function.phpinfo.html
-rw-r--r--      5311 2017-03-28 06:06 function.curl-close.html
-rw-r--r--      5273 2017-03-28 06:07 function.is-float.html
-rw-r--r--     14532 2017-03-28 06:07 function.ldap-control-paged-result.html
-rw-r--r--      5237 2017-03-28 06:06 cairocontext.setlinewidth.html
-rw-r--r--      4209 2017-03-28 06:06 cairosurface.setdeviceoffset.html
-rw-r--r--      3046 2017-03-28 06:06 intltimezone.getequivalentid.html
-rw-r--r--      6746 2017-03-28 06:07 domdocument.loadhtmlfile.html
-rw-r--r--      4587 2017-03-28 06:06 function.is-nan.html
-rw-r--r--     26920 2017-03-28 06:07 extensions.alphabetical.html
-rw-r--r--     16568 2017-03-28 06:06 pdo-4d.examples.html
-rw-r--r--      4677 2017-03-28 06:07 internals2.opcodes.jmpznz.html
-rw-r--r--      3341 2017-03-28 06:06 imagick.getimagelength.html
-rw-r--r--      8075 2017-03-28 06:06 mongodb-driver-command.construct.html
-rw-r--r--      6044 2017-03-28 06:07 class.gearmanexception.html
-rw-r--r--      1874 2017-03-28 06:07 intro.svn.html
-rw-r--r--      3036 2017-03-28 06:06 haru.builtin.fonts.html
-rw-r--r--      8643 2017-03-28 06:06 transliterator.transliterate.html
-rw-r--r--      1490 2017-03-28 06:06 yaf.setup.html
-rw-r--r--      2826 2017-03-28 06:06 ibase.installation.html
-rw-r--r--      2504 2017-03-28 06:06 sqlite3.lasterrorcode.html
-rw-r--r--     12605 2017-03-28 06:07 function.snmp3-set.html
-rw-r--r--      6873 2017-03-28 06:06 mongodb-driver-manager.getreadpreference.html
-rw-r--r--      6223 2017-03-28 06:06 function.openssl-pkcs7-verify.html
-rw-r--r--     32503 2017-03-28 06:06 function.oci-get-implicit-resultset.html
-rw-r--r--      3788 2017-03-28 06:06 function.fann-get-bit-fail-limit.html
-rw-r--r--      1381 2017-03-28 06:07 com.requirements.html
-rw-r--r--      8417 2017-03-28 06:06 locale.getdisplayscript.html
-rw-r--r--      1507 2017-03-28 06:05 csprng.setup.html
-rw-r--r--     12104 2017-03-28 06:06 function.cubrid-connect.html
-rw-r--r--      3073 2017-03-28 06:07 hwapi.unlock.html
-rw-r--r--      2440 2017-03-28 06:06 splfileinfo.iswritable.html
-rw-r--r--      2699 2017-03-28 06:06 imagick.getpointsize.html
-rw-r--r--      3773 2017-03-28 06:07 ui-draw-brush-gradient.setstop.html
-rw-r--r--      2739 2017-03-28 06:06 gmagick.getimagemattecolor.html
-rw-r--r--      4745 2017-03-28 06:06 mysqli.debug.html
-rw-r--r--      2158 2017-03-28 06:06 mysqlnd-mux.changes-one-o.html
-rw-r--r--      7354 2017-03-28 06:06 function.sqlite-busy-timeout.html
-rw-r--r--      1544 2017-03-28 06:06 parsekit.setup.html
-rw-r--r--      1964 2017-03-28 06:06 sqlite3.installation.html
-rw-r--r--      1307 2017-03-28 06:07 pcre.resources.html
-rw-r--r--      5503 2017-03-28 06:07 function.socket-send.html
-rw-r--r--      5338 2017-03-28 06:06 function.mb-strripos.html
-rw-r--r--      5361 2017-03-28 06:07 ds-set.remove.html
-rw-r--r--      2147 2017-03-28 06:06 lua.installation.html
-rw-r--r--      2459 2017-03-28 06:06 spldoublylinkedlist.next.html
-rw-r--r--      2690 2017-03-28 06:06 ref.intl.grapheme.html
-rw-r--r--      2843 2017-03-28 06:07 solrparams.set.html
-rw-r--r--     13428 2017-03-28 06:06 class.sqlite3.html
-rw-r--r--      4502 2017-03-28 06:06 syncsemaphore.unlock.html
-rw-r--r--      3301 2017-03-28 06:06 oci-lob.erase.html
-rw-r--r--      2681 2017-03-28 06:07 solrquery.getmltmintermfrequency.html
-rw-r--r--      3855 2017-03-28 06:07 sessionhandlerinterface.open.html
-rw-r--r--      2242 2017-03-28 06:07 zmqpoll.clear.html
-rw-r--r--      1356 2017-03-28 06:06 stream.configuration.html
-rw-r--r--      2277 2017-03-28 06:07 varnishlog.getline.html
-rw-r--r--     29681 2017-03-28 06:06 function.json-encode.html
-rw-r--r--     15095 2017-03-28 06:06 function.oci-rollback.html
-rw-r--r--      5282 2017-03-28 06:06 function.cubrid-client-encoding.html
-rw-r--r--     12291 2017-03-28 06:07 ref.strings.html
-rw-r--r--      5037 2017-03-28 06:05 class.assertionerror.html
-rw-r--r--     10313 2017-03-28 06:07 function.snmpset.html
-rw-r--r--      4002 2017-03-28 06:06 function.odbc-primarykeys.html
-rw-r--r--      4022 2017-03-28 06:06 gmagick.annotateimage.html
-rw-r--r--      2907 2017-03-28 06:07 sdo-dataobject.gettypenamespaceuri.html
-rw-r--r--      1788 2017-03-28 06:06 mysqlnd-memcache.changes.html
-rw-r--r--      2708 2017-03-28 06:06 recursivetreeiterator.valid.html
-rw-r--r--      1335 2017-03-28 06:07 msession.resources.html
-rw-r--r--      6051 2017-03-28 06:07 function.function-exists.html
-rw-r--r--      5365 2017-03-28 06:06 locale.getscript.html
-rw-r--r--      1342 2017-03-28 06:07 simplexml.resources.html
-rw-r--r--      1529 2017-03-28 06:06 fbsql.setup.html
-rw-r--r--      4137 2017-03-28 06:06 function.fbsql-insert-id.html
-rw-r--r--      3169 2017-03-28 06:06 gearmantask.unique.html
-rw-r--r--      3526 2017-03-28 06:06 function.posix-ttyname.html
-rw-r--r--      4558 2017-03-28 06:06 function.fann-test.html
-rw-r--r--      1923 2017-03-28 06:06 function.pdf-set-info-keywords.html
-rw-r--r--      2446 2017-03-28 06:07 solrdocument.reset.html
-rw-r--r--      3091 2017-03-28 06:05 function.newt-grid-get-size.html
-rw-r--r--      2400 2017-03-28 06:06 mysqlnd-memcache.requirements.html
-rw-r--r--      8345 2017-03-28 06:06 class.imagickpixeliterator.html
-rw-r--r--      2693 2017-03-28 06:06 xattr.constants.html
-rw-r--r--      4170 2017-03-28 06:05 function.id3-get-genre-name.html
-rw-r--r--      2999 2017-03-28 06:05 function.m-validateidentifier.html
-rw-r--r--      6222 2017-03-28 06:06 ingres.examples-basic.html
-rw-r--r--      6577 2017-03-28 06:05 phar.createdefaultstub.html
-rw-r--r--      7123 2017-03-28 06:06 class.recursivefilteriterator.html
-rw-r--r--      3123 2017-03-28 06:06 imagick.setimagecolormapcolor.html
-rw-r--r--      4826 2017-03-28 06:06 function.ps-arc.html
-rw-r--r--      8120 2017-03-28 06:06 function.mb-send-mail.html
-rw-r--r--      2777 2017-03-28 06:06 imagick.writeimagesfile.html
-rw-r--r--      2778 2017-03-28 06:06 function.fann-get-connection-rate.html
-rw-r--r--     11799 2017-03-28 06:06 class.yaf-action-abstract.html
-rw-r--r--      5280 2017-03-28 06:07 domnode.getnodepath.html
-rw-r--r--      5091 2017-03-28 06:07 memcached.getstats.html
-rw-r--r--     22219 2017-03-28 06:06 class.eventutil.html
-rw-r--r--      4290 2017-03-28 06:06 function.eio-busy.html
-rw-r--r--      3571 2017-03-28 06:06 fdf.installation.html
-rw-r--r--      1509 2017-03-28 06:06 oci8.setup.html
-rw-r--r--      3710 2017-03-28 06:07 internals2.opcodes.init-fcall-by-name.html
-rw-r--r--      2664 2017-03-28 06:06 splpriorityqueue.rewind.html
-rw-r--r--      5670 2017-03-28 06:07 quickhashintset.delete.html
-rw-r--r--     12743 2017-03-28 06:06 class.yaf-session.html
-rw-r--r--      5901 2017-03-28 06:06 class.mongoprotocolexception.html
-rw-r--r--      2467 2017-03-28 06:06 yaf-config-ini.current.html
-rw-r--r--      7543 2017-03-28 06:06 class.cairogradientpattern.html
-rw-r--r--      5319 2017-03-28 06:06 function.gmp-perfect-square.html
-rw-r--r--     13432 2017-03-28 06:06 book.ev.html
-rw-r--r--      2696 2017-03-28 06:06 uconverter.setsubstchars.html
-rw-r--r--      5624 2017-03-28 06:06 intlchar.isprint.html
-rw-r--r--      7272 2017-03-28 06:06 cairocontext.copypage.html
-rw-r--r--      1969 2017-03-28 06:06 ref.ming.html
-rw-r--r--     21400 2017-03-28 06:06 function.cubrid-bind.html
-rw-r--r--      2881 2017-03-28 06:06 gmagick.edgeimage.html
-rw-r--r--      9668 2017-03-28 06:07 reflectionfunction.invokeargs.html
-rw-r--r--      3039 2017-03-28 06:07 function.variant-set.html
-rw-r--r--      6697 2017-03-28 06:06 function.stream-filter-remove.html
-rw-r--r--      3362 2017-03-28 06:06 function.fann-set-quickprop-mu.html
-rw-r--r--      3670 2017-03-28 06:07 xmlreader.movetonextattribute.html
-rw-r--r--      4955 2017-03-28 06:06 spoofchecker.areconfusable.html
-rw-r--r--      2400 2017-03-28 06:05 audioproperties.getlayer.html
-rw-r--r--      1342 2017-03-28 06:07 wddx.configuration.html
-rw-r--r--      2170 2017-03-28 06:06 function.ocicollassignelem.html
-rw-r--r--      1377 2017-03-28 06:07 simplexml.configuration.html
-rw-r--r--     10619 2017-03-28 06:06 mongocursor.batchsize.html
-rw-r--r--      4147 2017-03-28 06:07 function.ldap-next-entry.html
-rw-r--r--     19184 2017-03-28 06:07 function.session-regenerate-id.html
-rw-r--r--      2784 2017-03-28 06:06 swftextfield.setlinespacing.html
-rw-r--r--      1746 2017-03-28 06:07 intro.memcache.html
-rw-r--r--      4518 2017-03-28 06:06 intro.maxdb.html
-rw-r--r--      5787 2017-03-28 06:06 function.eio-futime.html
-rw-r--r--      2400 2017-03-28 06:06 imagick.haspreviousimage.html
-rw-r--r--      7634 2017-03-28 06:06 mysqli.store-result.html
-rw-r--r--      2811 2017-03-28 06:07 solrinputdocument.setboost.html
-rw-r--r--      4690 2017-03-28 06:07 ds-map.skip.html
-rw-r--r--      1295 2017-03-28 06:06 intro.gnupg.html
-rw-r--r--      4365 2017-03-28 06:06 haruimage.setcolormask.html
-rw-r--r--     13151 2017-03-28 06:06 mongocollection.save.html
-rw-r--r--      2566 2017-03-28 06:07 soapheader.construct.html
-rw-r--r--      2493 2017-03-28 06:05 function.ncurses-panel-window.html
-rw-r--r--     12663 2017-03-28 06:06 datetime.add.html
-rw-r--r--      2493 2017-03-28 06:07 ui-draw-text-font-descriptor.getweight.html
-rw-r--r--     14200 2017-03-28 06:06 class.swfdisplayitem.html
-rw-r--r--      4475 2017-03-28 06:06 function.imap-body.html
-rw-r--r--      3455 2017-03-28 06:05 function.openal-source-play.html
-rw-r--r--      1821 2017-03-28 06:06 yaml.installation.html
-rw-r--r--     10896 2017-03-28 06:06 function.imagesetpixel.html
-rw-r--r--      1481 2017-03-28 06:07 quickhash.setup.html
-rw-r--r--      2356 2017-03-28 06:06 evloop.invokepending.html
-rw-r--r--      2516 2017-03-28 06:05 security.cgi-bin.shell.html
-rw-r--r--      1505 2017-03-28 06:06 msql.setup.html
-rw-r--r--      7481 2017-03-28 06:06 mysqli.connect-error.html
-rw-r--r--     14741 2017-03-28 06:05 function.mcrypt-module-open.html
-rw-r--r--      3495 2017-03-28 06:06 function.fann-set-quickprop-decay.html
-rw-r--r--      1499 2017-03-28 06:07 ctype.setup.html
-rw-r--r--      6819 2017-03-28 06:06 function.date-default-timezone-set.html
-rw-r--r--      2508 2017-03-28 06:06 function.pdf-fit-pdi-page.html
-rw-r--r--      7651 2017-03-28 06:07 function.ldap-get-values.html
-rw-r--r--     11403 2017-03-28 06:06 mongo.installation.html
-rw-r--r--      2189 2017-03-28 06:06 mssql.resources.html
-rw-r--r--      1698 2017-03-28 06:05 pharexception.intro.unused.html
-rw-r--r--      3137 2017-03-28 06:07 reflectionclass.getparentclass.html
-rw-r--r--      3698 2017-03-28 06:05 ref.apd.html
-rw-r--r--      7873 2017-03-28 06:06 function.mysql-fetch-row.html
-rw-r--r--      3132 2017-03-28 06:07 function.session-write-close.html
-rw-r--r--     10392 2017-03-28 06:06 intlcalendar.getrepeatedwalltimeoption.html
-rw-r--r--      1328 2017-03-28 06:07 win32ps.resources.html
-rw-r--r--     13707 2017-03-28 06:06 mysqlnd-ms.pooling.html
-rw-r--r--      2819 2017-03-28 06:06 gearmantask.jobhandle.html
-rw-r--r--      3588 2017-03-28 06:07 function.quoted-printable-decode.html
-rw-r--r--      3290 2017-03-28 06:06 harupage.getgmode.html
-rw-r--r--      8314 2017-03-28 06:07 quickhashinthash.exists.html
-rw-r--r--      3506 2017-03-28 06:05 reserved.variables.html
-rw-r--r--      1549 2017-03-28 06:06 intro.openssl.html
-rw-r--r--      4859 2017-03-28 06:06 cairocontext.resetclip.html
-rw-r--r--      3006 2017-03-28 06:06 imagickdraw.pathlinetohorizontalrelative.html
-rw-r--r--      2830 2017-03-28 06:07 function.get-declared-traits.html
-rw-r--r--      2359 2017-03-28 06:06 dba.configuration.html
-rw-r--r--      2746 2017-03-28 06:06 event.getsupportedmethods.html
-rw-r--r--      5160 2017-03-28 06:06 function.cairo-pattern-create-linear.html
-rw-r--r--     12267 2017-03-28 06:06 function.eio-read.html
-rw-r--r--      2663 2017-03-28 06:07 function.rrdc-disconnect.html
-rw-r--r--      1409 2017-03-28 06:07 intro.oauth.html
-rw-r--r--      3801 2017-03-28 06:05 function.mcrypt-module-is-block-algorithm.html
-rw-r--r--      2687 2017-03-28 06:05 security.cgi-bin.force-redirect.html
-rw-r--r--      5249 2017-03-28 06:06 arrayobject.offsetget.html
-rw-r--r--      7465 2017-03-28 06:06 function.openssl-spki-export-challenge.html
-rw-r--r--      1477 2017-03-28 06:06 ps.setup.html
-rw-r--r--      3885 2017-03-28 06:06 function.inotify-queue-len.html
-rw-r--r--      2146 2017-03-28 06:05 function.ncurses-reset-shell-mode.html
-rw-r--r--      4538 2017-03-28 06:06 gearmanclient.addservers.html
-rw-r--r--      3766 2017-03-28 06:06 intro.fdf.html
-rw-r--r--      2560 2017-03-28 06:06 harufont.getencodingname.html
-rw-r--r--      4244 2017-03-28 06:06 multipleiterator.attachiterator.html
-rw-r--r--      2674 2017-03-28 06:06 gmagickdraw.polygon.html
-rw-r--r--      8672 2017-03-28 06:06 arrayobject.uksort.html
-rw-r--r--      7189 2017-03-28 06:06 function.grapheme-strstr.html
-rw-r--r--      5398 2017-03-28 06:05 function.runkit-function-copy.html
-rw-r--r--      7373 2017-03-28 06:07 migration71.constants.html
-rw-r--r--      4623 2017-03-28 06:07 function.gupnp-service-proxy-callback-set.html
-rw-r--r--      2292 2017-03-28 06:07 varnishadmin.start.html
-rw-r--r--      7050 2017-03-28 06:05 function.radius-put-int.html
-rw-r--r--     21031 2017-03-28 06:05 security.database.sql-injection.html
-rw-r--r--      3139 2017-03-28 06:07 function.session-pgsql-set-field.html
-rw-r--r--      2008 2017-03-28 06:06 function.pdf-resume-page.html
-rw-r--r--      2283 2017-03-28 06:05 function.readline-on-new-line.html
-rw-r--r--      3758 2017-03-28 06:06 cairoscaledfont.getscalematrix.html
-rw-r--r--      3455 2017-03-28 06:06 function.sem-release.html
-rw-r--r--      3724 2017-03-28 06:06 function.fann-get-training-algorithm.html
-rw-r--r--      4557 2017-03-28 06:07 hwapi.checkin.html
-rw-r--r--      6393 2017-03-28 06:07 solrdismaxquery.removeboostquery.html
-rw-r--r--      5737 2017-03-28 06:05 function.restore-error-handler.html
-rw-r--r--      2308 2017-03-28 06:06 function.pdf-load-font.html
-rw-r--r--      7074 2017-03-28 06:06 refs.international.html
-rw-r--r--      4562 2017-03-28 06:07 memcached.appendbykey.html
-rw-r--r--      2781 2017-03-28 06:07 function.svn-fs-delete.html
-rw-r--r--      4223 2017-03-28 06:06 imagick.flopimage.html
-rw-r--r--      1520 2017-03-28 06:07 intro.gupnp.html
-rw-r--r--      1481 2017-03-28 06:06 mongo.gridfs.html
-rw-r--r--      2324 2017-03-28 06:06 function.pdf-info-font.html
-rw-r--r--      1498 2017-03-28 06:06 cairo.setup.html
-rw-r--r--      7539 2017-03-28 06:06 resourcebundle.create.html
-rw-r--r--      6194 2017-03-28 06:06 mongoid.tostring.html
-rw-r--r--      1600 2017-03-28 06:07 migration54.deprecated.html
-rw-r--r--      3219 2017-03-28 06:06 function.dgettext.html
-rw-r--r--      3795 2017-03-28 06:06 eventhttprequest.addheader.html
-rw-r--r--     12039 2017-03-28 06:07 function.get-class.html
-rw-r--r--      5970 2017-03-28 06:06 function.fdf-open.html
-rw-r--r--      7780 2017-03-28 06:07 class.ui-controls-form.html
-rw-r--r--      4542 2017-03-28 06:07 ds-deque.shift.html
-rw-r--r--      2552 2017-03-28 06:06 yaf-session.unset.html
-rw-r--r--      3010 2017-03-28 06:07 reflectionfunctionabstract.getclosurescopeclass.html
-rw-r--r--      4748 2017-03-28 06:07 simplexmlelement.getname.html
-rw-r--r--     21502 2017-03-28 06:07 sdodasrel.metadata.html
-rw-r--r--     27019 2017-03-28 06:06 class.harudoc.html
-rw-r--r--      2793 2017-03-28 06:06 imagickdraw.setresolution.html
-rw-r--r--      2714 2017-03-28 06:06 function.pdf-get-pdi-parameter.html
-rw-r--r--      5853 2017-03-28 06:06 imagick.evaluateimage.html
-rw-r--r--      8843 2017-03-28 06:06 imagickdraw.setstrokealpha.html
-rw-r--r--      5226 2017-03-28 06:06 function.imagecreatefromgd.html
-rw-r--r--      3508 2017-03-28 06:06 v8js.configuration.html
-rw-r--r--      6680 2017-03-28 06:07 class.ui-controls-colorbutton.html
-rw-r--r--      2929 2017-03-28 06:06 mongodb.dropcollection.html
-rw-r--r--      2923 2017-03-28 06:05 function.m-returnstatus.html
-rw-r--r--      2846 2017-03-28 06:06 oci-lob.eof.html
-rw-r--r--      6014 2017-03-28 06:07 function.is-null.html
-rw-r--r--      2898 2017-03-28 06:05 function.newt-checkbox-set-value.html
-rw-r--r--      5112 2017-03-28 06:06 class.mongodb-bson-minkey.html
-rw-r--r--      1403 2017-03-28 06:06 posix.installation.html
-rw-r--r--      3649 2017-03-28 06:07 sphinxclient.setgroupdistinct.html
-rw-r--r--     11018 2017-03-28 06:06 function.pg-connect.html
-rw-r--r--      2882 2017-03-28 06:07 solrquery.gethighlightsimplepre.html
-rw-r--r--      2203 2017-03-28 06:07 sdodasrel.installation.html
-rw-r--r--      2744 2017-03-28 06:06 book.dbx.html
-rw-r--r--      8418 2017-03-28 06:06 intldateformatter.gettimezone.html
-rw-r--r--      9623 2017-03-28 06:07 memcache.set.html
-rw-r--r--      2702 2017-03-28 06:07 function.iis-add-server.html
-rw-r--r--      3809 2017-03-28 06:06 function.ifx-errormsg.html
-rw-r--r--      4048 2017-03-28 06:07 internals2.opcodes.assign.html
-rw-r--r--     15131 2017-03-28 06:06 function.parse-url.html
-rw-r--r--      5505 2017-03-28 06:06 function.dbase-get-record.html
-rw-r--r--      1814 2017-03-28 06:07 function.dns-get-mx.html
-rw-r--r--      6555 2017-03-28 06:06 arrayobject.asort.html
-rw-r--r--      2987 2017-03-28 06:05 function.ncurses-savetty.html
-rw-r--r--      6794 2017-03-28 06:06 mongodb.getreadpreference.html
-rw-r--r--      8546 2017-03-28 06:07 stomp.error.html
-rw-r--r--      3900 2017-03-28 06:07 function.socket-close.html
-rw-r--r--     11942 2017-03-28 06:06 book.pgsql.html
-rw-r--r--      6163 2017-03-28 06:06 function.openssl-pkcs7-decrypt.html
-rw-r--r--      9488 2017-03-28 06:06 libevent.examples.html
-rw-r--r--      2850 2017-03-28 06:06 swfmorph.getshape2.html
-rw-r--r--      2935 2017-03-28 06:07 svmmodel.load.html
-rw-r--r--      8258 2017-03-28 06:07 quickhashinthash.loadfromfile.html
-rw-r--r--      5732 2017-03-28 06:06 class.mongomaxkey.html
-rw-r--r--      2478 2017-03-28 06:06 intliterator.valid.html
-rw-r--r--      4676 2017-03-28 06:07 rrd.examples-procedural.html
-rw-r--r--     13106 2017-03-28 06:06 dbplus.errorcodes.html
-rw-r--r--      4031 2017-03-28 06:07 simplexmlelement.tostring.html
-rw-r--r--      3836 2017-03-28 06:07 domelement.getelementsbytagnamens.html
-rw-r--r--     12573 2017-03-28 06:07 function.array-diff-ukey.html
-rw-r--r--      7634 2017-03-28 06:07 function.mqseries-open.html
-rw-r--r--      4999 2017-03-28 06:06 function.mysql-get-client-info.html
-rw-r--r--      8946 2017-03-28 06:07 function.ldap-bind.html
-rw-r--r--      7607 2017-03-28 06:06 class.mongodb-driver-readconcern.html
-rw-r--r--      2943 2017-03-28 06:06 function.sybase-get-last-message.html
-rw-r--r--      1335 2017-03-28 06:07 sca.configuration.html
-rw-r--r--      2154 2017-03-28 06:07 function.msession-inc.html
-rw-r--r--      8848 2017-03-28 06:06 function.imageflip.html
-rw-r--r--      1855 2017-03-28 06:06 function.diskfreespace.html
-rw-r--r--      4217 2017-03-28 06:06 cairosurface.setfallbackresolution.html
-rw-r--r--     11386 2017-03-28 06:06 mongodb-driver-bulkwrite.delete.html
-rw-r--r--      9678 2017-03-28 06:06 function.imagerectangle.html
-rw-r--r--      3661 2017-03-28 06:06 swftext.setcolor.html
-rw-r--r--      8140 2017-03-28 06:07 function.libxml-set-external-entity-loader.html
-rw-r--r--      6416 2017-03-28 06:05 class.iteratoraggregate.html
-rw-r--r--      5033 2017-03-28 06:06 function.tidy-warning-count.html
-rw-r--r--      4771 2017-03-28 06:06 mysqli.get-client-version.html
-rw-r--r--      3584 2017-03-28 06:06 function.fann-get-train-error-function.html
-rw-r--r--      5996 2017-03-28 06:06 function.yaml-parse-url.html
-rw-r--r--      2640 2017-03-28 06:06 oci-lob.tell.html
-rw-r--r--      3922 2017-03-28 06:06 class.swfsoundinstance.html
-rw-r--r--      1516 2017-03-28 06:06 pcntl.setup.html
-rw-r--r--      4324 2017-03-28 06:06 function.cairo-surface-flush.html
-rw-r--r--      1990 2017-03-28 06:07 regexp.reference.alternation.html
-rw-r--r--      2775 2017-03-28 06:06 swftext.getwidth.html
-rw-r--r--     12451 2017-03-28 06:06 function.mysql-affected-rows.html
-rw-r--r--     11382 2017-03-28 06:06 function.sqlite-fetch-array.html
-rw-r--r--      3128 2017-03-28 06:06 function.cosh.html
-rw-r--r--      3291 2017-03-28 06:05 function.zip-entry-close.html
-rw-r--r--      1816 2017-03-28 06:06 intro.dbx.html
-rw-r--r--      3731 2017-03-28 06:06 function.px-set-tablename.html
-rw-r--r--      8540 2017-03-28 06:06 yaf-dispatcher.catchexception.html
-rw-r--r--      2947 2017-03-28 06:05 function.m-iscommadelimited.html
-rw-r--r--      2818 2017-03-28 06:06 mongoint64.tostring.html
-rw-r--r--      2752 2017-03-28 06:05 function.ncurses-addchstr.html
-rw-r--r--      2743 2017-03-28 06:07 migration51.errorcheck.html
-rw-r--r--      2344 2017-03-28 06:07 varnishadmin.clearpanic.html
-rw-r--r--      2556 2017-03-28 06:06 harupage.fill.html
-rw-r--r--      2747 2017-03-28 06:05 function.newt-resume.html
-rw-r--r--      6298 2017-03-28 06:07 function.xmlwriter-write-element-ns.html
-rw-r--r--      7660 2017-03-28 06:07 ds-deque.contains.html
-rw-r--r--      5658 2017-03-28 06:07 function.ksort.html
-rw-r--r--      8335 2017-03-28 06:06 function.sqlsrv-rows-affected.html
-rw-r--r--      7356 2017-03-28 06:06 function.imagefilledrectangle.html
-rw-r--r--      7230 2017-03-28 06:07 internals2.opcodes.throw.html
-rw-r--r--      9368 2017-03-28 06:07 oauth.getaccesstoken.html
-rw-r--r--      5697 2017-03-28 06:06 function.ps-set-info.html
-rw-r--r--      1301 2017-03-28 06:06 dbase.requirements.html
-rw-r--r--     11112 2017-03-28 06:06 function.db2-procedure-columns.html
-rw-r--r--      6650 2017-03-28 06:06 splfileinfo.getrealpath.html
-rw-r--r--      1321 2017-03-28 06:05 kadm5.examples.html
-rw-r--r--      2447 2017-03-28 06:06 imagick.current.html
-rw-r--r--     10658 2017-03-28 06:06 class.OCI-Lob.html
-rw-r--r--      2904 2017-03-28 06:06 yaf-config-ini.offsetset.html
-rw-r--r--      3752 2017-03-28 06:06 function.ps-setlinecap.html
-rw-r--r--      3094 2017-03-28 06:06 intlbreakiterator.createlineinstance.html
-rw-r--r--      2810 2017-03-28 06:06 function.cyrus-query.html
-rw-r--r--      7062 2017-03-28 06:07 function.yaz-itemorder.html
-rw-r--r--     14219 2017-03-28 06:07 solrclient.adddocument.html
-rw-r--r--     13286 2017-03-28 06:06 class.recursivearrayiterator.html
-rw-r--r--      4462 2017-03-28 06:06 imagickdraw.pathcurvetoabsolute.html
-rw-r--r--      2580 2017-03-28 06:06 yaf-request-simple.getfiles.html
-rw-r--r--      3082 2017-03-28 06:06 swfmovie.setrate.html
-rw-r--r--      6255 2017-03-28 06:06 function.is-readable.html
-rw-r--r--      5317 2017-03-28 06:07 ds-vector.apply.html
-rw-r--r--      2121 2017-03-28 06:06 function.pdf-delete-pvf.html
-rw-r--r--      2477 2017-03-28 06:06 imagick.getimageextrema.html
-rw-r--r--      9797 2017-03-28 06:07 class.domentityreference.html
-rw-r--r--     10718 2017-03-28 06:05 language.constants.syntax.html
-rw-r--r--     25107 2017-03-28 06:06 pcntl.constants.html
-rw-r--r--      5874 2017-03-28 06:06 function.mssql-close.html
-rw-r--r--      3335 2017-03-28 06:06 function.fdf-get-encoding.html
-rw-r--r--      3221 2017-03-28 06:06 libevent.constants.html
-rw-r--r--      3006 2017-03-28 06:07 sdo-model-type.isdatatype.html
-rw-r--r--     96065 2017-03-28 06:06 function.curl-setopt.html
-rw-r--r--      4237 2017-03-28 06:06 function.pspell-check.html
-rw-r--r--      2572 2017-03-28 06:07 ui-draw-color.getchannel.html
-rw-r--r--      4620 2017-03-28 06:06 function.trader-stoch.html
-rw-r--r--      3045 2017-03-28 06:06 yaf-dispatcher.getapplication.html
-rw-r--r--      2760 2017-03-28 06:06 gmagick.getimagechanneldepth.html
-rw-r--r--      2602 2017-03-28 06:07 ui-controls-multilineentry.construct.html
-rw-r--r--      3782 2017-03-28 06:06 function.ps-setlinejoin.html
-rw-r--r--      6095 2017-03-28 06:06 function.xattr-remove.html
-rw-r--r--      3864 2017-03-28 06:06 function.fdf-get-ap.html
-rw-r--r--      2894 2017-03-28 06:07 internals2.opcodes.assign-sl.html
-rw-r--r--     11214 2017-03-28 06:06 mysqli.thread-id.html
-rw-r--r--     10450 2017-03-28 06:06 numberformatter.create.html
-rw-r--r--      3057 2017-03-28 06:06 gearmanworker.echo.html
-rw-r--r--     18088 2017-03-28 06:06 class.mongolog.html
-rw-r--r--     24524 2017-03-28 06:06 class.intlrulebasedbreakiterator.html
-rw-r--r--      4889 2017-03-28 06:06 recursivecallbackfilteriterator.construct.html
-rw-r--r--      1634 2017-03-28 06:07 iisfunc.installation.html
-rw-r--r--      2995 2017-03-28 06:07 reflectionproperty.getname.html
-rw-r--r--      3882 2017-03-28 06:06 cairopssurface.dsccomment.html
-rw-r--r--      4030 2017-03-28 06:06 function.fbsql-hostname.html
-rw-r--r--      3560 2017-03-28 06:05 language.references.arent.html
-rw-r--r--      7263 2017-03-28 06:06 function.eio-cancel.html
-rw-r--r--      1937 2017-03-28 06:06 function.pdf-get-image-width.html
-rw-r--r--      2508 2017-03-28 06:06 swftext.getdescent.html
-rw-r--r--      4967 2017-03-28 06:06 tidynode.getparent.html
-rw-r--r--      9314 2017-03-28 06:06 function.cubrid-fetch-assoc.html
-rw-r--r--      1349 2017-03-28 06:05 bzip2.configuration.html
-rw-r--r--      8341 2017-03-28 06:07 function.strnatcmp.html
-rw-r--r--      3232 2017-03-28 06:06 yaf-plugin-abstract.predispatch.html
-rw-r--r--      6624 2017-03-28 06:05 apcu.constants.html
-rw-r--r--      5376 2017-03-28 06:07 internals2.opcodes.switch-free.html
-rw-r--r--     15042 2017-03-28 06:07 function.setlocale.html
-rw-r--r--      6543 2017-03-28 06:07 function.array-merge-recursive.html
-rw-r--r--     11512 2017-03-28 06:06 intldateformatter.localtime.html
-rw-r--r--      2943 2017-03-28 06:05 arrayaccess.offsetunset.html
-rw-r--r--      3335 2017-03-28 06:05 features.cookies.html
-rw-r--r--      2713 2017-03-28 06:06 function.eio-set-max-idle.html
-rw-r--r--      3138 2017-03-28 06:07 xml.encoding.html
-rw-r--r--      1385 2017-03-28 06:05 scream.examples.html
-rw-r--r--      3065 2017-03-28 06:06 pdo-4d.constants.html
-rw-r--r--      3473 2017-03-28 06:07 zookeeper.isrecoverable.html
-rw-r--r--      2640 2017-03-28 06:06 function.stats-rand-gen-t.html
-rw-r--r--      2850 2017-03-28 06:06 function.mailparse-msg-get-part.html
-rw-r--r--     19700 2017-03-28 06:06 mysqli.rollback.html
-rw-r--r--      3093 2017-03-28 06:06 gmagickdraw.setstrokecolor.html
-rw-r--r--      1331 2017-03-28 06:05 memtrack.examples.html
-rw-r--r--      5239 2017-03-28 06:06 function.imap-savebody.html
-rw-r--r--      2714 2017-03-28 06:06 function.trader-linearreg.html
-rw-r--r--      5512 2017-03-28 06:06 function.filesize.html
-rw-r--r--      4649 2017-03-28 06:06 imagick.oilpaintimage.html
-rw-r--r--      3892 2017-03-28 06:07 reflectionproperty.export.html
-rw-r--r--      7266 2017-03-28 06:07 function.classkit-method-copy.html
-rw-r--r--      4208 2017-03-28 06:07 function.xmlrpc-decode.html
-rw-r--r--      2789 2017-03-28 06:07 function.svn-fs-file-length.html
-rw-r--r--      4707 2017-03-28 06:06 mongodb-bson-javascript.getcode.html
-rw-r--r--      2434 2017-03-28 06:06 imagick.getinterlacescheme.html
-rw-r--r--      2964 2017-03-28 06:05 function.ncurses-wvline.html
-rw-r--r--      2259 2017-03-28 06:07 ui-point.setx.html
-rw-r--r--      8870 2017-03-28 06:06 pdo.pgsqllobopen.html
-rw-r--r--      7189 2017-03-28 06:06 imagick.setsamplingfactors.html
-rw-r--r--      8957 2017-03-28 06:06 function.mysql-list-fields.html
-rw-r--r--      4460 2017-03-28 06:07 reflectionclass.newinstancewithoutconstructor.html
-rw-r--r--      3411 2017-03-28 06:06 function.fann-get-rprop-increase-factor.html
-rw-r--r--      3713 2017-03-28 06:06 mysqli-stmt.close.html
-rw-r--r--      1825 2017-03-28 06:07 intro.mqseries.html
-rw-r--r--      4459 2017-03-28 06:06 function.cairo-pattern-get-linear-points.html
-rw-r--r--      3241 2017-03-28 06:07 migration53.html
-rw-r--r--      6503 2017-03-28 06:06 function.fbsql-fetch-object.html
-rw-r--r--      4381 2017-03-28 06:06 fam.constants.html
-rw-r--r--      3427 2017-03-28 06:06 eventbase.gotexit.html
-rw-r--r--      2464 2017-03-28 06:06 yaf-loader.clone.html
-rw-r--r--      4719 2017-03-28 06:06 function.sin.html
-rw-r--r--      9449 2017-03-28 06:06 mysqlnd-ms.quickstart.configuration.html
-rw-r--r--      4355 2017-03-28 06:07 function.ldap-mod-replace.html
-rw-r--r--      2509 2017-03-28 06:06 pdo.intransaction.html
-rw-r--r--      2422 2017-03-28 06:06 imagickdraw.getgravity.html
-rw-r--r--      3021 2017-03-28 06:05 function.mcrypt-enc-get-key-size.html
-rw-r--r--      6927 2017-03-28 06:05 language.constants.predefined.html
-rw-r--r--      4504 2017-03-28 06:06 yaf-application.environ.html
-rw-r--r--      3555 2017-03-28 06:05 function.runkit-constant-remove.html
-rw-r--r--      7764 2017-03-28 06:06 mongodb.overview.html
-rw-r--r--      2547 2017-03-28 06:07 about.notes.html
-rw-r--r--      6502 2017-03-28 06:06 globiterator.construct.html
-rw-r--r--      1214 2017-03-28 06:06 chdb.constants.html
-rw-r--r--      2276 2017-03-28 06:06 function.event-free.html
-rw-r--r--      2306 2017-03-28 06:06 splfixedarray.key.html
-rw-r--r--      4677 2017-03-28 06:06 mongoregex.tostring.html
-rw-r--r--      8607 2017-03-28 06:06 intlchar.hasbinaryproperty.html
-rw-r--r--      3189 2017-03-28 06:06 function.trader-willr.html
-rw-r--r--      3896 2017-03-28 06:07 samconnection.commit.html
-rw-r--r--      1308 2017-03-28 06:07 apache.requirements.html
-rw-r--r--      6197 2017-03-28 06:06 class.yaf-bootstrap-abstract.html
-rw-r--r--      3520 2017-03-28 06:06 evloop.prepare.html
-rw-r--r--      3297 2017-03-28 06:07 userlandnaming.tips.html
-rw-r--r--      4907 2017-03-28 06:06 class.mutex.html
-rw-r--r--      5962 2017-03-28 06:06 imagick.roundcorners.html
-rw-r--r--      8441 2017-03-28 06:06 function.ibase-blob-import.html
-rw-r--r--      2961 2017-03-28 06:06 yaf-config-simple.offsetset.html
-rw-r--r--      1531 2017-03-28 06:07 ref.stomp.html
-rw-r--r--      4355 2017-03-28 06:06 function.tan.html
-rw-r--r--      2755 2017-03-28 06:06 recursivetreeiterator.rewind.html
-rw-r--r--     13149 2017-03-28 06:06 mysqli-result.fetch-row.html
-rw-r--r--      6596 2017-03-28 06:05 phar.setdefaultstub.html
-rw-r--r--      3278 2017-03-28 06:06 function.eio-init.html
-rw-r--r--      2225 2017-03-28 06:07 ui-controls-box.ispadded.html
-rw-r--r--      5762 2017-03-28 06:07 regexp.reference.internal-options.html
-rw-r--r--      7917 2017-03-28 06:06 mysqlnduhconnection.getsqlstate.html
-rw-r--r--      6501 2017-03-28 06:06 function.ps-add-note.html
-rw-r--r--      7968 2017-03-28 06:07 function.next.html
-rw-r--r--      7330 2017-03-28 06:06 book.ibase.html
-rw-r--r--      2057 2017-03-28 06:06 function.ocisavelob.html
-rw-r--r--      2565 2017-03-28 06:06 function.pdf-fill-imageblock.html
-rw-r--r--      2225 2017-03-28 06:06 function.pdf-scale.html
-rw-r--r--      8862 2017-03-28 06:06 mongodb-driver-writeresult.getupsertedcount.html
-rw-r--r--      3303 2017-03-28 06:06 gmagick.mapimage.html
-rw-r--r--      9933 2017-03-28 06:07 migration52.methods.html
-rw-r--r--      4622 2017-03-28 06:05 ziparchive.addemptydir.html
-rw-r--r--      3126 2017-03-28 06:05 function.ncurses-wmouse-trafo.html
-rw-r--r--      8272 2017-03-28 06:07 function.array-keys.html
-rw-r--r--      1372 2017-03-28 06:05 errorfunc.installation.html
-rw-r--r--      3546 2017-03-28 06:06 tokyotyrantiterator.current.html
-rw-r--r--      2963 2017-03-28 06:06 gmagick.setimageunits.html
-rw-r--r--     14155 2017-03-28 06:06 function.cubrid-execute.html
-rw-r--r--      2869 2017-03-28 06:07 function.svn-fs-dir-entries.html
-rw-r--r--      1710 2017-03-28 06:06 intro.oci8.html
-rw-r--r--      1549 2017-03-28 06:07 filter.filters.html
-rw-r--r--      3371 2017-03-28 06:06 eventbase.gotstop.html
-rw-r--r--      2294 2017-03-28 06:06 function.judy-version.html
-rw-r--r--      2620 2017-03-28 06:06 function.taint.html
-rw-r--r--      4794 2017-03-28 06:06 imagick.rollimage.html
-rw-r--r--      5077 2017-03-28 06:06 imagick.setimageproperty.html
-rw-r--r--      2871 2017-03-28 06:06 intltimezone.createtimezone.html
-rw-r--r--      4405 2017-03-28 06:06 function.odbc-gettypeinfo.html
-rw-r--r--      5648 2017-03-28 06:07 function.lcfirst.html
-rw-r--r--      2857 2017-03-28 06:06 spldoublylinkedlist.offsetexists.html
-rw-r--r--      2184 2017-03-28 06:06 function.pdf-get-majorversion.html
-rw-r--r--      3745 2017-03-28 06:06 harupage.arc.html
-rw-r--r--      2724 2017-03-28 06:06 gmagick.getimagerenderingintent.html
-rw-r--r--      2794 2017-03-28 06:06 function.fann-get-layer-array.html
-rw-r--r--     19328 2017-03-28 06:07 configure.about.html
-rw-r--r--      2292 2017-03-28 06:07 ui-controls-label.settext.html
-rw-r--r--      7846 2017-03-28 06:07 function.gupnp-context-timeout-add.html
-rw-r--r--      5959 2017-03-28 06:05 wincache.reroutes.html
-rw-r--r--      6672 2017-03-28 06:06 function.iconv-strpos.html
-rw-r--r--      2551 2017-03-28 06:06 function.eio-set-max-poll-reqs.html
-rw-r--r--     13601 2017-03-28 06:05 functions.variable-functions.html
-rw-r--r--      8346 2017-03-28 06:05 closure.bind.html
-rw-r--r--      2266 2017-03-28 06:06 function.pdf-pcos-get-number.html
-rw-r--r--      7243 2017-03-28 06:07 memcached.getserverbykey.html
-rw-r--r--     42621 2017-03-28 06:06 class.numberformatter.html
-rw-r--r--      5506 2017-03-28 06:07 simplexmliterator.haschildren.html
-rw-r--r--      1339 2017-03-28 06:06 expect.examples.html
-rw-r--r--      2189 2017-03-28 06:06 imagick.previousimage.html
-rw-r--r--      8907 2017-03-28 06:07 ds-sequence.reduce.html
-rw-r--r--      6054 2017-03-28 06:05 function.newt-form-add-component.html
-rw-r--r--      6040 2017-03-28 06:06 book.curl.html
-rw-r--r--     10558 2017-03-28 06:06 mongocommandcursor.createfromdocument.html
-rw-r--r--     11077 2017-03-28 06:06 mysqli.field-count.html
-rw-r--r--      2323 2017-03-28 06:06 event.delsignal.html
-rw-r--r--      8494 2017-03-28 06:07 function.strripos.html
-rw-r--r--      5230 2017-03-28 06:07 ds-set.intersect.html
-rw-r--r--      2399 2017-03-28 06:06 function.pdf-set-info.html
-rw-r--r--      5437 2017-03-28 06:07 yar-server.construct.html
-rw-r--r--      2792 2017-03-28 06:06 judy.offsetset.html
-rw-r--r--      3865 2017-03-28 06:06 mongodb.reseterror.html
-rw-r--r--      4342 2017-03-28 06:06 function.bcmod.html
-rw-r--r--      5806 2017-03-28 06:07 solrquery.addgroupquery.html
-rw-r--r--      4842 2017-03-28 06:07 domcharacterdata.deletedata.html
-rw-r--r--      4769 2017-03-28 06:06 splfileobject.setflags.html
-rw-r--r--      2968 2017-03-28 06:05 configuration.file.per-user.html
-rw-r--r--      1370 2017-03-28 06:07 stomp.resources.html
-rw-r--r--      5487 2017-03-28 06:07 function.ssh2-fingerprint.html
-rw-r--r--     13793 2017-03-28 06:07 function.filter-var.html
-rw-r--r--     12264 2017-03-28 06:06 function.cubrid-fetch-object.html
-rw-r--r--      2597 2017-03-28 06:05 function.m-transnew.html
-rw-r--r--      1559 2017-03-28 06:06 mysqlnd-mux.setup.html
-rw-r--r--      2535 2017-03-28 06:06 function.trader-ht-dcperiod.html
-rw-r--r--     17023 2017-03-28 06:06 mysqli-result.fetch-field.html
-rw-r--r--      2757 2017-03-28 06:07 ref.rrd.html
-rw-r--r--     15817 2017-03-28 06:06 yaf.appconfig.html
-rw-r--r--      4128 2017-03-28 06:06 function.rpm-close.html
-rw-r--r--      1973 2017-03-28 06:05 constants.newt.fd-flags.html
-rw-r--r--      4192 2017-03-28 06:06 function.fbsql-list-tables.html
-rw-r--r--      5278 2017-03-28 06:06 function.posix-geteuid.html
-rw-r--r--      3805 2017-03-28 06:06 mongo.setslaveokay.html
-rw-r--r--      8628 2017-03-28 06:06 gearmanworker.wait.html
-rw-r--r--     11487 2017-03-28 06:06 function.cubrid-put.html
-rw-r--r--      2891 2017-03-28 06:07 hwapi.hwstat.html
-rw-r--r--      4565 2017-03-28 06:06 yaf-application.getmodules.html
-rw-r--r--      2865 2017-03-28 06:06 mongocursor.current.html
-rw-r--r--      7888 2017-03-28 06:06 function.get-meta-tags.html
-rw-r--r--      3182 2017-03-28 06:06 function.sybase-free-result.html
-rw-r--r--      5655 2017-03-28 06:06 directoryiterator.iswritable.html
-rw-r--r--      2866 2017-03-28 06:05 function.ncurses-wmove.html
-rw-r--r--      8308 2017-03-28 06:06 function.maxdb-get-server-version.html
-rw-r--r--      4437 2017-03-28 06:07 sphinxclient.setgeoanchor.html
-rw-r--r--      4550 2017-03-28 06:05 function.ob-get-length.html
-rw-r--r--      3891 2017-03-28 06:06 function.fann-randomize-weights.html
-rw-r--r--      2684 2017-03-28 06:06 uconverter.getaliases.html
-rw-r--r--      2451 2017-03-28 06:07 svm.setoptions.html
-rw-r--r--      2395 2017-03-28 06:06 imagick.getimagesignature.html
-rw-r--r--      6082 2017-03-28 06:06 limititerator.getposition.html
-rw-r--r--      4492 2017-03-28 06:07 ui-controls-grid.append.html
-rw-r--r--      2657 2017-03-28 06:06 function.mysqli-get-metadata.html
-rw-r--r--      7185 2017-03-28 06:06 mongodb-driver-bulkwrite.count.html
-rw-r--r--      1621 2017-03-28 06:05 install.cloud.html
-rw-r--r--      9197 2017-03-28 06:06 function.time-nanosleep.html
-rw-r--r--     16025 2017-03-28 06:06 imagickkernel.addunitykernel.html
-rw-r--r--      3464 2017-03-28 06:07 function.gupnp-root-device-get-available.html
-rw-r--r--      5607 2017-03-28 06:06 imagick.compareimagelayers.html
-rw-r--r--      2818 2017-03-28 06:05 function.ncurses-slk-attroff.html
-rw-r--r--      5096 2017-03-28 06:06 datetimezone.getlocation.html
-rw-r--r--     12079 2017-03-28 06:05 runkit.sandbox-parent.html
-rw-r--r--      2883 2017-03-28 06:07 solrquery.gethighlightfragmenter.html
-rw-r--r--      5805 2017-03-28 06:05 weakref.construct.html
-rw-r--r--      1445 2017-03-28 06:06 curl.requirements.html
-rw-r--r--      2892 2017-03-28 06:06 function.mailparse-msg-create.html
-rw-r--r--     12772 2017-03-28 06:06 function.openssl-verify.html
-rw-r--r--      3464 2017-03-28 06:05 function.newt-vertical-scrollbar.html
-rw-r--r--      7040 2017-03-28 06:06 splobjectstorage.key.html
-rw-r--r--      2439 2017-03-28 06:06 gmagickdraw.getfontsize.html
-rw-r--r--      2891 2017-03-28 06:06 swfmovie.remove.html
-rw-r--r--      2603 2017-03-28 06:06 evembed.set.html
-rw-r--r--      3786 2017-03-28 06:07 samconnection.rollback.html
-rw-r--r--      6456 2017-03-28 06:06 yaf-application.getlasterrorno.html
-rw-r--r--      2682 2017-03-28 06:05 function.ncurses-panel-below.html
-rw-r--r--      1238 2017-03-28 06:06 sybase.constants.html
-rw-r--r--      3468 2017-03-28 06:05 function.ncurses-mvaddchnstr.html
-rw-r--r--      2801 2017-03-28 06:05 function.ob-get-level.html
-rw-r--r--      7330 2017-03-28 06:06 class.norewinditerator.html
-rw-r--r--      1642 2017-03-28 06:06 intl.requirements.html
-rw-r--r--      3579 2017-03-28 06:05 function.openal-context-process.html
-rw-r--r--      3986 2017-03-28 06:05 function.radius-config.html
-rw-r--r--      2055 2017-03-28 06:07 simplexmlelement.savexml.html
-rw-r--r--     13527 2017-03-28 06:06 class.evstat.html
-rw-r--r--      1349 2017-03-28 06:06 dbase.configuration.html
-rw-r--r--     17442 2017-03-28 06:06 swfbitmap.construct.html
-rw-r--r--      5909 2017-03-28 06:06 function.ftp-mkdir.html
-rw-r--r--      9272 2017-03-28 06:06 imagickdraw.roundrectangle.html
-rw-r--r--     10612 2017-03-28 06:06 ref.paradox.html
-rw-r--r--     16914 2017-03-28 06:07 dom.constants.html
-rw-r--r--      2500 2017-03-28 06:05 function.ncurses-bottom-panel.html
-rw-r--r--      3723 2017-03-28 06:05 crack.examples.html
-rw-r--r--      6919 2017-03-28 06:05 ziparchive.addfile.html
-rw-r--r--      6222 2017-03-28 06:07 function.gupnp-device-action-callback-set.html
-rw-r--r--      1266 2017-03-28 06:06 fann.resources.html
-rw-r--r--      3118 2017-03-28 06:07 ds-priorityqueue.construct.html
-rw-r--r--      8575 2017-03-28 06:07 internals2.variables.arrays.html
-rw-r--r--      5410 2017-03-28 06:06 function.enchant-dict-describe.html
-rw-r--r--      8515 2017-03-28 06:07 function.classkit-method-add.html
-rw-r--r--      4579 2017-03-28 06:06 intlcalendar.getweekendtransition.html
-rw-r--r--      1489 2017-03-28 06:06 yaml.setup.html
-rw-r--r--      2753 2017-03-28 06:06 yaf-request-abstract.setrouted.html
-rw-r--r--      7306 2017-03-28 06:07 memcached.addserver.html
-rw-r--r--      1363 2017-03-28 06:06 gearman.configuration.html
-rw-r--r--     17943 2017-03-28 06:06 class.event.html
-rw-r--r--      8931 2017-03-28 06:06 intlcalendar.indaylighttime.html
-rw-r--r--      1377 2017-03-28 06:07 xmlwriter.configuration.html
-rw-r--r--      2528 2017-03-28 06:05 ref.uopz.html
-rw-r--r--      4485 2017-03-28 06:07 ref.xml.html
-rw-r--r--      3660 2017-03-28 06:06 harupage.curveto3.html
-rw-r--r--      8726 2017-03-28 06:07 swishsearch.setphrasedelimiter.html
-rw-r--r--      4235 2017-03-28 06:06 function.oci-new-collection.html
-rw-r--r--      6740 2017-03-28 06:06 function.geoip-db-get-all-info.html
-rw-r--r--      6298 2017-03-28 06:06 function.pg-copy-to.html
-rw-r--r--      2807 2017-03-28 06:05 function.newt-form-set-width.html
-rw-r--r--      3699 2017-03-28 06:06 mongogridfscursor.construct.html
-rw-r--r--      3083 2017-03-28 06:06 refs.remote.mail.html
-rw-r--r--      3006 2017-03-28 06:07 function.svn-fs-change-node-prop.html
-rw-r--r--      2941 2017-03-28 06:07 solrquery.settimeallowed.html
-rw-r--r--      4868 2017-03-28 06:06 function.stream-get-wrappers.html
-rw-r--r--      9056 2017-03-28 06:06 function.mysqlnd-qc-set-cache-condition.html
-rw-r--r--      8589 2017-03-28 06:07 soapvar.soapvar.html
-rw-r--r--      7122 2017-03-28 06:05 function.apcu-store.html
-rw-r--r--      2443 2017-03-28 06:05 function.ncurses-slk-noutrefresh.html
-rw-r--r--      6843 2017-03-28 06:07 function.soundex.html
-rw-r--r--     13551 2017-03-28 06:07 class.reflectionparameter.html
-rw-r--r--     12876 2017-03-28 06:06 function.maxdb-real-escape-string.html
-rw-r--r--      1476 2017-03-28 06:07 xmldiff.requirements.html
-rw-r--r--      4290 2017-03-28 06:06 ref.enchant.html
-rw-r--r--      2846 2017-03-28 06:06 function.fann-shuffle-train-data.html
-rw-r--r--      2899 2017-03-28 06:07 function.hwapi-content-new.html
-rw-r--r--      6613 2017-03-28 06:06 pdo.errorinfo.html
-rw-r--r--      3279 2017-03-28 06:06 function.trader-cdlinvertedhammer.html
-rw-r--r--      2701 2017-03-28 06:06 function.openssl-free-key.html
-rw-r--r--      6697 2017-03-28 06:06 tidynode.isjste.html
-rw-r--r--      3409 2017-03-28 06:06 eventbuffer.addbuffer.html
-rw-r--r--     10785 2017-03-28 06:06 function.curl-multi-exec.html
-rw-r--r--     10258 2017-03-28 06:06 function.imap-mail-compose.html
-rw-r--r--      4224 2017-03-28 06:05 function.gzclose.html
-rw-r--r--      1930 2017-03-28 06:07 snmp.requirements.html
-rw-r--r--      4491 2017-03-28 06:06 splfileinfo.gettype.html
-rw-r--r--      3658 2017-03-28 06:06 ev.suspend.html
-rw-r--r--      4566 2017-03-28 06:06 function.cairo-pattern-set-extend.html
-rw-r--r--      2996 2017-03-28 06:06 function.fbsql-field-len.html
-rw-r--r--     10017 2017-03-28 06:06 class.threaded.html
-rw-r--r--      1853 2017-03-28 06:07 internals2.opcodes.zend-jmp-set.html
-rw-r--r--      2164 2017-03-28 06:07 hwapi.reason-description.html
-rw-r--r--      2918 2017-03-28 06:07 varnishadmin.setparam.html
-rw-r--r--      2540 2017-03-28 06:07 solrquery.gettermsprefix.html
-rw-r--r--      4622 2017-03-28 06:06 function.cal-days-in-month.html
-rw-r--r--     10518 2017-03-28 06:05 phardata.converttoexecutable.html
-rw-r--r--      5777 2017-03-28 06:07 refs.ui.html
-rw-r--r--     19961 2017-03-28 06:06 class.tokyotyranttable.html
-rw-r--r--      2729 2017-03-28 06:07 migration55.html
-rw-r--r--      2266 2017-03-28 06:05 phar.fileformat.flags.html
-rw-r--r--     16262 2017-03-28 06:07 function.unserialize.html
-rw-r--r--      2868 2017-03-28 06:06 swfsprite.remove.html
-rw-r--r--      9402 2017-03-28 06:06 function.msg-receive.html
-rw-r--r--      4420 2017-03-28 06:06 function.cairo-surface-copy-page.html
-rw-r--r--      6771 2017-03-28 06:06 function.ps-begin-page.html
-rw-r--r--      2918 2017-03-28 06:06 harupage.getflatness.html
-rw-r--r--      5569 2017-03-28 06:07 function.strcmp.html
-rw-r--r--      2994 2017-03-28 06:07 reflectionfunctionabstract.getclosurethis.html
-rw-r--r--      3322 2017-03-28 06:06 gearmantask.sendworkload.html
-rw-r--r--      3059 2017-03-28 06:06 gmagickdraw.annotate.html
-rw-r--r--     11677 2017-03-28 06:05 phardata.buildfromiterator.html
-rw-r--r--      4923 2017-03-28 06:06 evloop.run.html
-rw-r--r--      3553 2017-03-28 06:06 function.fam-next-event.html
-rw-r--r--      2553 2017-03-28 06:06 imagick.deconstructimages.html
-rw-r--r--      3676 2017-03-28 06:07 book.pcre.html
-rw-r--r--      3381 2017-03-28 06:06 yaf-router.getroute.html
-rw-r--r--      1377 2017-03-28 06:07 libxml.requirements.html
-rw-r--r--      4153 2017-03-28 06:07 solrclient.deletebyid.html
-rw-r--r--      3063 2017-03-28 06:06 gmagick.writeimage.html
-rw-r--r--     10109 2017-03-28 06:06 function.maxdb-warning-count.html
-rw-r--r--      3593 2017-03-28 06:07 function.libxml-disable-entity-loader.html
-rw-r--r--      2477 2017-03-28 06:06 fannconnection.getfromneuron.html
-rw-r--r--      5151 2017-03-28 06:06 cairocontext.rotate.html
-rw-r--r--      2692 2017-03-28 06:05 function.ncurses-panel-above.html
-rw-r--r--      7430 2017-03-28 06:06 function.ingres-fetch-proc-return.html
-rw-r--r--      6463 2017-03-28 06:06 threaded.synchronized.html
-rw-r--r--      3531 2017-03-28 06:06 yaf-request-http.getpost.html
-rw-r--r--      6890 2017-03-28 06:06 function.imap-setflag-full.html
-rw-r--r--      8853 2017-03-28 06:05 phar.startbuffering.html
-rw-r--r--      2423 2017-03-28 06:06 yaf-loader.wakeup.html
-rw-r--r--      2828 2017-03-28 06:06 emptyiterator.current.html
-rw-r--r--      2361 2017-03-28 06:06 function.is-tainted.html
-rw-r--r--      7661 2017-03-28 06:06 tidy.root.html
-rw-r--r--      3644 2017-03-28 06:06 function.dngettext.html
-rw-r--r--     16024 2017-03-28 06:05 rarentry.getattr.html
-rw-r--r--      5752 2017-03-28 06:05 phar.loadphar.html
-rw-r--r--      2476 2017-03-28 06:07 internals2.pdo.building.html
-rw-r--r--      7897 2017-03-28 06:06 book.pdo.html
-rw-r--r--     11297 2017-03-28 06:06 ref.stats.html
-rw-r--r--      3389 2017-03-28 06:07 reflectionparameter.getdeclaringfunction.html
-rw-r--r--      3730 2017-03-28 06:07 reflectionfunctionabstract.getnumberofparameters.html
-rw-r--r--     20856 2017-03-28 06:06 swfdisplayitem.rotateto.html
-rw-r--r--      4917 2017-03-28 06:07 class.xmldiff-file.html
-rw-r--r--      6061 2017-03-28 06:07 domdocument.createentityreference.html
-rw-r--r--     10895 2017-03-28 06:05 pharfileinfo.iscompressedgz.html
-rw-r--r--      5409 2017-03-28 06:07 domdocument.createcomment.html
-rw-r--r--     13258 2017-03-28 06:06 function.file-put-contents.html
-rw-r--r--      3130 2017-03-28 06:06 harupage.setflatness.html
-rw-r--r--      2875 2017-03-28 06:06 book.url.html
-rw-r--r--      1609 2017-03-28 06:06 mysqlinfo.concepts.html
-rw-r--r--      9291 2017-03-28 06:06 imagickdraw.setclipunits.html
-rw-r--r--      2786 2017-03-28 06:06 imagick.morphimages.html
-rw-r--r--      4166 2017-03-28 06:06 function.ps-stringwidth.html
-rw-r--r--     17610 2017-03-28 06:06 function.maxdb-fetch-array.html
-rw-r--r--      4386 2017-03-28 06:06 function.ps-set-border-style.html
-rw-r--r--      2317 2017-03-28 06:06 ref.bc.html
-rw-r--r--      2527 2017-03-28 06:07 ui-controls-tab.hasmargin.html
-rw-r--r--      4464 2017-03-28 06:06 function.cairo-scaled-font-get-type.html
-rw-r--r--      2366 2017-03-28 06:06 imagickdraw.pathfinish.html
-rw-r--r--      4149 2017-03-28 06:06 function.odbc-fetch-object.html
-rw-r--r--      4967 2017-03-28 06:06 ref.ftp.html
-rw-r--r--      8971 2017-03-28 06:06 intlcalendar.geterrorcode.html
-rw-r--r--      2766 2017-03-28 06:07 solrquery.getgroupcachepercent.html
-rw-r--r--      5712 2017-03-28 06:06 intlcalendar.gettype.html
-rw-r--r--      2020 2017-03-28 06:05 ktaglib.installation.html
-rw-r--r--      2687 2017-03-28 06:06 dir.constants.html
-rw-r--r--      3023 2017-03-28 06:06 yaf-route-interface.assemble.html
-rw-r--r--      9851 2017-03-28 06:06 mongo.constants.html
-rw-r--r--      5666 2017-03-28 06:07 regex.examples.html
-rw-r--r--      2644 2017-03-28 06:05 function.ncurses-wcolor-set.html
-rw-r--r--      7052 2017-03-28 06:06 book.sqlite.html
-rw-r--r--     10218 2017-03-28 06:07 function.ldap-get-option.html
-rw-r--r--     13497 2017-03-28 06:06 class.eventbase.html
-rw-r--r--      2409 2017-03-28 06:07 ui-draw-stroke.getcap.html
-rw-r--r--      3028 2017-03-28 06:05 function.bcompiler-write-included-filename.html
-rw-r--r--      2571 2017-03-28 06:06 gmagick.getimagescene.html
-rw-r--r--      4464 2017-03-28 06:07 memcache.flush.html
-rw-r--r--      4752 2017-03-28 06:07 function.yp-match.html
-rw-r--r--      5812 2017-03-28 06:07 function.gupnp-root-device-new.html
-rw-r--r--      2642 2017-03-28 06:05 function.ncurses-wattroff.html
-rw-r--r--      5307 2017-03-28 06:06 function.fbsql-close.html
-rw-r--r--      4837 2017-03-28 06:06 class.mongoresultexception.html
-rw-r--r--      3010 2017-03-28 06:07 internals2.opcodes.sub.html
-rw-r--r--      4454 2017-03-28 06:06 function.cairo-font-options-status.html
-rw-r--r--      4941 2017-03-28 06:07 ds-queue.allocate.html
-rw-r--r--      3793 2017-03-28 06:06 function.posix-isatty.html
-rw-r--r--     13379 2017-03-28 06:06 function.max.html
-rw-r--r--      8073 2017-03-28 06:06 mysqli.quickstart.transactions.html
-rw-r--r--      3084 2017-03-28 06:06 function.fam-pending.html
-rw-r--r--      3044 2017-03-28 06:06 imagick.setimagechanneldepth.html
-rw-r--r--      3960 2017-03-28 06:06 mongodb-bson-minkey.construct.html
-rw-r--r--      7751 2017-03-28 06:06 mysqlnduhconnection.gethostinformation.html
-rw-r--r--      2955 2017-03-28 06:06 gmagick.setsamplingfactors.html
-rw-r--r--      1336 2017-03-28 06:06 filesystem.requirements.html
-rw-r--r--      2500 2017-03-28 06:07 function.yp-errno.html
-rw-r--r--      5339 2017-03-28 06:06 yaf-view-simple.clear.html
-rw-r--r--     19183 2017-03-28 06:07 migration51.references.html
-rw-r--r--      1284 2017-03-28 06:06 lua.resources.html
-rw-r--r--      4213 2017-03-28 06:06 function.ingres-commit.html
-rw-r--r--      5148 2017-03-28 06:07 function.array-sum.html
-rw-r--r--      7016 2017-03-28 06:06 swfshape.construct.html
-rw-r--r--      6849 2017-03-28 06:07 reflectionclass.getname.html
-rw-r--r--     20834 2017-03-28 06:05 zip.constants.html
-rw-r--r--     19997 2017-03-28 06:06 eventhttp.construct.html
-rw-r--r--      5262 2017-03-28 06:06 cairocontext.settolerance.html
-rw-r--r--      2532 2017-03-28 06:06 function.eio-nready.html
-rw-r--r--      5529 2017-03-28 06:06 splobjectstorage.count.html
-rw-r--r--      4848 2017-03-28 06:06 cairoscaledfont.construct.html
-rw-r--r--      2681 2017-03-28 06:05 oggvorbis.constants.html
-rw-r--r--      3432 2017-03-28 06:07 function.yaz-addinfo.html
-rw-r--r--      5621 2017-03-28 06:07 solrquery.setgroupoffset.html
-rw-r--r--      3944 2017-03-28 06:06 mongo.tutorial.indexes.html
-rw-r--r--     12610 2017-03-28 06:06 function.imagedashedline.html
-rw-r--r--      2920 2017-03-28 06:06 posix.constants.access.html
-rw-r--r--      5234 2017-03-28 06:06 cairopattern.setmatrix.html
-rw-r--r--     23144 2017-03-28 06:05 phar.using.intro.html
-rw-r--r--      3033 2017-03-28 06:06 function.stats-rand-gen-iuniform.html
-rw-r--r--      9697 2017-03-28 06:06 tokyotyrantquery.count.html
-rw-r--r--      3316 2017-03-28 06:06 oci-lob.export.html
-rw-r--r--     81647 2017-03-28 06:05 language.types.string.html
-rw-r--r--      4800 2017-03-28 06:05 ziparchive.renameindex.html
-rw-r--r--      1315 2017-03-28 06:07 strings.requirements.html
-rw-r--r--      2964 2017-03-28 06:06 imagick.readimagefile.html
-rw-r--r--      6539 2017-03-28 06:05 function.uopz-compose.html
-rw-r--r--      3631 2017-03-28 06:06 function.fann-set-sarprop-step-error-shift.html
-rw-r--r--      3110 2017-03-28 06:07 internals2.opcodes.div.html
-rw-r--r--      3017 2017-03-28 06:06 function.hypot.html
-rw-r--r--      5102 2017-03-28 06:06 mongo.pooldebug.html
-rw-r--r--      6490 2017-03-28 06:06 pdo.pgsqllobunlink.html
-rw-r--r--      6678 2017-03-28 06:06 function.fbsql-database-password.html
-rw-r--r--     10358 2017-03-28 06:05 function.runkit-method-add.html
-rw-r--r--     17294 2017-03-28 06:07 class.ds-sequence.html
-rw-r--r--      3255 2017-03-28 06:06 function.ps-end-page.html
-rw-r--r--      2543 2017-03-28 06:06 function.mysqli-fetch.html
-rw-r--r--      3315 2017-03-28 06:06 function.stats-cdf-f.html
-rw-r--r--      3850 2017-03-28 06:06 cairofontoptions.merge.html
-rw-r--r--      2089 2017-03-28 06:06 book.fribidi.html
-rw-r--r--      4654 2017-03-28 06:06 function.event-buffer-set-callback.html
-rw-r--r--     21959 2017-03-28 06:06 pdostatement.fetchall.html
-rw-r--r--      3353 2017-03-28 06:05 function.readline-info.html
-rw-r--r--      2998 2017-03-28 06:06 intltimezone.geterrorcode.html
-rw-r--r--      5970 2017-03-28 06:05 ziparchive.statname.html
-rw-r--r--      2780 2017-03-28 06:07 function.svn-fs-apply-text.html
-rw-r--r--      3155 2017-03-28 06:06 gmagick.cropthumbnailimage.html
-rw-r--r--      9869 2017-03-28 06:05 install.macosx.bundled.html
-rw-r--r--      8250 2017-03-28 06:06 function.imap-rfc822-parse-adrlist.html
-rw-r--r--      6062 2017-03-28 06:07 migration51.databases.html
-rw-r--r--      7185 2017-03-28 06:06 function.tempnam.html
-rw-r--r--      7045 2017-03-28 06:07 function.ctype-graph.html
-rw-r--r--      3167 2017-03-28 06:05 function.newt-listbox-append-entry.html
-rw-r--r--      3490 2017-03-28 06:06 function.msql-num-fields.html
-rw-r--r--      4324 2017-03-28 06:06 recursivecallbackfilteriterator.getchildren.html
-rw-r--r--      4979 2017-03-28 06:05 class.divisionbyzeroerror.html
-rw-r--r--      3388 2017-03-28 06:07 hwapi.content.html
-rw-r--r--      1905 2017-03-28 06:07 internals2.opcodes.declare-inherited-class-delayed.html
-rw-r--r--      7825 2017-03-28 06:07 function.is-a.html
-rw-r--r--      1821 2017-03-28 06:06 function.imap-fetchtext.html
-rw-r--r--      3528 2017-03-28 06:06 function.shm-has-var.html
-rw-r--r--      4624 2017-03-28 06:06 splfileobject.fgetc.html
-rw-r--r--     62811 2017-03-28 06:06 book.imagick.html
-rw-r--r--      2981 2017-03-28 06:06 mongocursorinterface.dead.html
-rw-r--r--      4622 2017-03-28 06:06 cairosolidpattern.construct.html
-rw-r--r--      3287 2017-03-28 06:06 function.trader-cdlinneck.html
-rw-r--r--      3212 2017-03-28 06:06 intro.ming.html
-rw-r--r--      2425 2017-03-28 06:07 solrquery.getfacetqueries.html
-rw-r--r--      1315 2017-03-28 06:07 session-pgsql.constants.html
-rw-r--r--      4459 2017-03-28 06:06 mongo.getslave.html
-rw-r--r--      7009 2017-03-28 06:07 reflectiongenerator.gettrace.html
-rw-r--r--      1376 2017-03-28 06:07 ref.tcpwrap.html
-rw-r--r--      2038 2017-03-28 06:06 function.pdf-end-template.html
-rw-r--r--     12807 2017-03-28 06:06 intlcalendar.getskippedwalltimeoption.html
-rw-r--r--      6628 2017-03-28 06:05 phar.unlinkarchive.html
-rw-r--r--      1342 2017-03-28 06:06 sync.configuration.html
-rw-r--r--      5200 2017-03-28 06:06 norewinditerator.rewind.html
-rw-r--r--      3374 2017-03-28 06:06 function.odbc-longreadlen.html
-rw-r--r--      7806 2017-03-28 06:07 migration53.new-features.html
-rw-r--r--      3920 2017-03-28 06:06 function.openssl-x509-export-to-file.html
-rw-r--r--     11697 2017-03-28 06:06 book.stream.html
-rw-r--r--      2054 2017-03-28 06:06 sybase.installation.html
-rw-r--r--      4831 2017-03-28 06:06 dateperiod.getdateinterval.html
-rw-r--r--      8004 2017-03-28 06:06 function.mysql-free-result.html
-rw-r--r--