"Fossies" - the Fresh Open Source Software Archive

Contents of php_manual_de.tar.gz (8 Dec 06:20, 12077569 Bytes)

About: PHP is a server-side html-embedded scripting language. Documentation (multiple HTML-files; German language).



Fossies path:  /linux/www/php_manual_de.tar.gz   [Download | CLOC analysis]
Alternative downloads:  tar.bz2 | tar.xz | zip
Member paths+URLs:  Shortened | full
Member sort order:  docs related | original | size (top100) | date | path | name | ext | top-path files

drwxr-xr-x         0 2016-12-08 06:20 
-rw-r--r--      2815 2016-12-08 06:18 function.ncurses-halfdelay.html
-rw-r--r--      7349 2016-12-08 06:19 function.mb-convert-encoding.html
-rw-r--r--      4936 2016-12-08 06:19 maxdb.constants.html
-rw-r--r--      4437 2016-12-08 06:19 function.ps-set-border-dash.html
-rw-r--r--      2556 2016-12-08 06:18 constants.newt.reasons.html
-rw-r--r--      1365 2016-12-08 06:18 hash.configuration.html
-rw-r--r--      2296 2016-12-08 06:19 function.pdf-stringwidth.html
-rw-r--r--      4185 2016-12-08 06:19 gmagick.frameimage.html
-rw-r--r--      3119 2016-12-08 06:20 internals2.opcodes.assign-ref.html
-rw-r--r--      5043 2016-12-08 06:19 book.enchant.html
-rw-r--r--      8157 2016-12-08 06:19 function.grapheme-stripos.html
-rw-r--r--      3056 2016-12-08 06:19 imagickdraw.pathlinetohorizontalabsolute.html
-rw-r--r--      3228 2016-12-08 06:20 internals2.counter.counter-class.bumpvalue.html
-rw-r--r--      3835 2016-12-08 06:19 function.dcngettext.html
-rw-r--r--      3275 2016-12-08 06:19 function.imap-num-recent.html
-rw-r--r--      3474 2016-12-08 06:20 function.svn-client-version.html
-rw-r--r--      2523 2016-12-08 06:18 book.password.html
-rw-r--r--      3946 2016-12-08 06:20 internals2.opcodes.declare-class.html
-rw-r--r--      4407 2016-12-08 06:18 refs.compression.html
-rw-r--r--      3325 2016-12-08 06:18 function.ibase-fetch-object.html
-rw-r--r--      8775 2016-12-08 06:20 ds-map.get.html
-rw-r--r--      5510 2016-12-08 06:19 memcached.replacebykey.html
-rw-r--r--     13078 2016-12-08 06:19 mysqli-stmt.error.html
-rw-r--r--      4615 2016-12-08 06:18 function.error-get-last.html
-rw-r--r--     18909 2016-12-08 06:19 imap.constants.html
-rw-r--r--      3777 2016-12-08 06:20 sdo-das-xml.loadstring.html
-rw-r--r--      5286 2016-12-08 06:20 ds-deque.rotate.html
-rw-r--r--      9880 2016-12-08 06:19 tokyotyrantquery.next.html
-rw-r--r--      9174 2016-12-08 06:19 function.mt-rand.html
-rw-r--r--      2704 2016-12-08 06:19 function.trader-rocr.html
-rw-r--r--      5815 2016-12-08 06:20 function.md5-file.html
-rw-r--r--      6401 2016-12-08 06:19 function.rewind.html
-rw-r--r--      1352 2016-12-08 06:20 intro.yar.html
-rw-r--r--      2691 2016-12-08 06:19 function.mysqli-bind-result.html
-rw-r--r--      9294 2016-12-08 06:19 function.imageellipse.html
-rw-r--r--      2440 2016-12-08 06:19 yaf-config-simple.toarray.html
-rw-r--r--      7640 2016-12-08 06:19 splobjectstorage.setinfo.html
-rw-r--r--      2233 2016-12-08 06:19 imagick.installation.html
-rw-r--r--      2743 2016-12-08 06:20 internals2.counter.html
-rw-r--r--     11978 2016-12-08 06:20 function.array-replace-recursive.html
-rw-r--r--      7860 2016-12-08 06:19 function.pg-escape-literal.html
-rw-r--r--      3165 2016-12-08 06:20 xsl.examples-collection.html
-rw-r--r--      2614 2016-12-08 06:19 stream.contexts.html
-rw-r--r--      2929 2016-12-08 06:19 class.yaf-exception-routerfailed.html
-rw-r--r--      4333 2016-12-08 06:19 function.sqlite-next.html
-rw-r--r--      3449 2016-12-08 06:19 book.exec.html
-rw-r--r--      2579 2016-12-08 06:18 function.newt-entry-get-value.html
-rw-r--r--      2694 2016-12-08 06:20 intro.session-pgsql.html
-rw-r--r--      1255 2016-12-08 06:20 ssdeep.constants.html
-rw-r--r--      3276 2016-12-08 06:18 function.gzrewind.html
-rw-r--r--      4235 2016-12-08 06:20 ds-set.toarray.html
-rw-r--r--      3441 2016-12-08 06:19 function.dio-read.html
-rw-r--r--      3388 2016-12-08 06:18 function.apd-dump-regular-resources.html
-rw-r--r--      7044 2016-12-08 06:19 appenditerator.getinneriterator.html
-rw-r--r--      2882 2016-12-08 06:20 reflectionclass.gettraitaliases.html
-rw-r--r--      3271 2016-12-08 06:19 function.trader-cdltristar.html
-rw-r--r--      3227 2016-12-08 06:19 streamwrapper.stream-close.html
-rw-r--r--      6656 2016-12-08 06:19 function.mysql-info.html
-rw-r--r--      6256 2016-12-08 06:19 mongocursor.doquery.html
-rw-r--r--      3399 2016-12-08 06:20 function.session-abort.html
-rw-r--r--      9749 2016-12-08 06:19 function.pg-send-query.html
-rw-r--r--      3446 2016-12-08 06:20 refs.basic.text.html
-rw-r--r--     15831 2016-12-08 06:20 index.html
-rw-r--r--      1754 2016-12-08 06:20 function.strchr.html
-rw-r--r--      3808 2016-12-08 06:20 sphinxclient.addquery.html
-rw-r--r--      6268 2016-12-08 06:18 function.wincache-ucache-exists.html
-rw-r--r--      5576 2016-12-08 06:19 memcached.incrementbykey.html
-rw-r--r--      1436 2016-12-08 06:18 dbx.resources.html
-rw-r--r--      2176 2016-12-08 06:20 ui-point.gety.html
-rw-r--r--      5782 2016-12-08 06:19 function.sqlsrv-close.html
-rw-r--r--      2299 2016-12-08 06:19 mysqlnd-memcache.installation.html
-rw-r--r--      6410 2016-12-08 06:19 imagick.unsharpmaskimage.html
-rw-r--r--      1574 2016-12-08 06:19 libevent.setup.html
-rw-r--r--      1593 2016-12-08 06:19 event.requirements.html
-rw-r--r--      2846 2016-12-08 06:18 function.ncurses-insstr.html
-rw-r--r--      3494 2016-12-08 06:20 internals2.opcodes.add-var.html
-rw-r--r--      9225 2016-12-08 06:18 language.namespaces.dynamic.html
-rw-r--r--      1528 2016-12-08 06:18 ifx.setup.html
-rw-r--r--      3090 2016-12-08 06:19 harupage.setwidth.html
-rw-r--r--      1989 2016-12-08 06:20 solrquery.getexpandsortfields.html
-rw-r--r--      1981 2016-12-08 06:19 function.pdf-set-text-rendering.html
-rw-r--r--      2387 2016-12-08 06:19 imagickdraw.getclipunits.html
-rw-r--r--      3608 2016-12-08 06:20 function.hebrevc.html
-rw-r--r--      2211 2016-12-08 06:19 function.pdf-setlinewidth.html
-rw-r--r--      5532 2016-12-08 06:20 function.strpbrk.html
-rw-r--r--      3436 2016-12-08 06:20 ui-draw-pen.fill.html
-rw-r--r--      5221 2016-12-08 06:19 function.ps-setcolor.html
-rw-r--r--     10247 2016-12-08 06:18 language.namespaces.nsconstants.html
-rw-r--r--      1326 2016-12-08 06:19 dir.requirements.html
-rw-r--r--      3383 2016-12-08 06:20 ds-map.capacity.html
-rw-r--r--      4832 2016-12-08 06:20 function.chr.html
-rw-r--r--      3080 2016-12-08 06:19 class.mongodb-driver-cursorid.html
-rw-r--r--     21911 2016-12-08 06:20 class.domelement.html
-rw-r--r--      2830 2016-12-08 06:19 v8js.getpendingexception.html
-rw-r--r--      2951 2016-12-08 06:19 eventbufferevent.sslgetcipherversion.html
-rw-r--r--      6391 2016-12-08 06:19 intlchar.isjavaidstart.html
-rw-r--r--     12395 2016-12-08 06:19 function.fgetcsv.html
-rw-r--r--     18376 2016-12-08 06:20 function.extract.html
-rw-r--r--      5733 2016-12-08 06:19 mongocollection.setwriteconcern.html
-rw-r--r--     27693 2016-12-08 06:18 language.oop5.overloading.html
-rw-r--r--     10868 2016-12-08 06:19 mysqli.poll.html
-rw-r--r--      3359 2016-12-08 06:19 class.yaf-route-interface.html
-rw-r--r--      2089 2016-12-08 06:19 function.pdf-stroke.html
-rw-r--r--      2564 2016-12-08 06:19 yaf-session.isset.html
-rw-r--r--     11566 2016-12-08 06:20 stomp.examples.html
-rw-r--r--      2736 2016-12-08 06:19 gmagick.getimageprofile.html
-rw-r--r--      9084 2016-12-08 06:18 pharfileinfo.iscompressed.html
-rw-r--r--      3063 2016-12-08 06:19 function.event-base-loop.html
-rw-r--r--      3072 2016-12-08 06:20 reflectionparameter.isarray.html
-rw-r--r--      2620 2016-12-08 06:19 curl.configuration.html
-rw-r--r--     12015 2016-12-08 06:19 class.splstack.html
-rw-r--r--      6857 2016-12-08 06:19 filesystemiterator.setflags.html
-rw-r--r--      2788 2016-12-08 06:19 hrtime-performancecounter.getelapsedticks.html
-rw-r--r--     12841 2016-12-08 06:19 imagick.setprogressmonitor.html
-rw-r--r--      1670 2016-12-08 06:19 mongo.setup.html
-rw-r--r--      4855 2016-12-08 06:20 internals2.opcodes.init-static-method-call.html
-rw-r--r--      3752 2016-12-08 06:19 limititerator.current.html
-rw-r--r--      3156 2016-12-08 06:19 function.fdf-close.html
-rw-r--r--      2769 2016-12-08 06:19 recursivetreeiterator.endchildren.html
-rw-r--r--      7490 2016-12-08 06:19 yaf.tutorials.html
-rw-r--r--      6007 2016-12-08 06:19 swftext.construct.html
-rw-r--r--      2867 2016-12-08 06:20 sdo-dataobject.clear.html
-rw-r--r--      8312 2016-12-08 06:19 mysqlnd.plugin.api.html
-rw-r--r--      3105 2016-12-08 06:19 function.event-buffer-base-set.html
-rw-r--r--     23653 2016-12-08 06:20 function.preg-replace.html
-rw-r--r--      5303 2016-12-08 06:19 intlchar.isisocontrol.html
-rw-r--r--     16442 2016-12-08 06:20 regexp.reference.escape.html
-rw-r--r--      3840 2016-12-08 06:20 about.phpversions.html
-rw-r--r--      4703 2016-12-08 06:19 function.stream-get-line.html
-rw-r--r--      2871 2016-12-08 06:20 function.rrd-tune.html
-rw-r--r--      3063 2016-12-08 06:19 function.event-buffer-enable.html
-rw-r--r--      7540 2016-12-08 06:19 class.mongodb-driver-exception-bulkwriteexception.html
-rw-r--r--      7139 2016-12-08 06:18 ziparchive.setexternalattributesname.html
-rw-r--r--      1320 2016-12-08 06:20 svm.resources.html
-rw-r--r--      3646 2016-12-08 06:19 splpriorityqueue.setextractflags.html
-rw-r--r--      1713 2016-12-08 06:20 classkit.installation.html
-rw-r--r--      5685 2016-12-08 06:19 appenditerator.append.html
-rw-r--r--      7649 2016-12-08 06:20 migration51.oop.html
-rw-r--r--      4179 2016-12-08 06:20 function.xmlwriter-flush.html
-rw-r--r--      3643 2016-12-08 06:19 arrayiterator.append.html
-rw-r--r--      4790 2016-12-08 06:20 rrdupdater.update.html
-rw-r--r--      6849 2016-12-08 06:20 book.xmlwriter.html
-rw-r--r--      3195 2016-12-08 06:19 function.trader-atr.html
-rw-r--r--      2843 2016-12-08 06:19 gmagickdraw.settextdecoration.html
-rw-r--r--      3765 2016-12-08 06:19 gmagick.cropimage.html
-rw-r--r--     13129 2016-12-08 06:19 function.sqlite-create-function.html
-rw-r--r--      3190 2016-12-08 06:20 solrquery.setfacetmissing.html
-rw-r--r--      4390 2016-12-08 06:18 function.get-cfg-var.html
-rw-r--r--      3399 2016-12-08 06:18 ref.pdo-ibm.html
-rw-r--r--      3321 2016-12-08 06:19 filesystemiterator.getflags.html
-rw-r--r--      5753 2016-12-08 06:19 imagick.rotateimage.html
-rw-r--r--      2629 2016-12-08 06:19 v8jsexception.getjssourceline.html
-rw-r--r--      5314 2016-12-08 06:20 internals2.memory.persistence.html
-rw-r--r--      5859 2016-12-08 06:18 context.mongodb.html
-rw-r--r--      3060 2016-12-08 06:20 reflectionparameter.tostring.html
-rw-r--r--      4090 2016-12-08 06:19 mongocollection.setslaveokay.html
-rw-r--r--      4648 2016-12-08 06:19 function.ps-set-border-color.html
-rw-r--r--     20048 2016-12-08 06:18 rar.examples.html
-rw-r--r--      9633 2016-12-08 06:19 datetime.settimestamp.html
-rw-r--r--      2118 2016-12-08 06:19 intro.judy.html
-rw-r--r--      5134 2016-12-08 06:20 oauth.setrsacertificate.html
-rw-r--r--      7182 2016-12-08 06:20 book.oauth.html
-rw-r--r--      5740 2016-12-08 06:20 ds-sequence.find.html
-rw-r--r--      3477 2016-12-08 06:20 function.hebrev.html
-rw-r--r--      3029 2016-12-08 06:19 harupage.moveto.html
-rw-r--r--      2508 2016-12-08 06:20 solrquery.getfacetdatefields.html
-rw-r--r--      2821 2016-12-08 06:19 recursiveiteratoriterator.getdepth.html
-rw-r--r--      9303 2016-12-08 06:19 cairocontext.setfontface.html
-rw-r--r--      1550 2016-12-08 06:18 opcache.setup.html
-rw-r--r--      2488 2016-12-08 06:20 varnishadmin.connect.html
-rw-r--r--      3967 2016-12-08 06:20 domdocument.relaxngvalidatesource.html
-rw-r--r--     13437 2016-12-08 06:20 function.get-html-translation-table.html
-rw-r--r--      6833 2016-12-08 06:20 internals2.pdo.pdo-stmt-t.html
-rw-r--r--    133921 2016-12-08 06:19 imagick.constants.html
-rw-r--r--      2903 2016-12-08 06:19 class.yaf-exception-loadfailed-view.html
-rw-r--r--      9956 2016-12-08 06:18 arrayaccess.offsetexists.html
-rw-r--r--      7999 2016-12-08 06:20 function.xml-set-element-handler.html
-rw-r--r--      8756 2016-12-08 06:19 function.imagechar.html
-rw-r--r--      1333 2016-12-08 06:20 pcre.requirements.html
-rw-r--r--      4342 2016-12-08 06:19 thread.getcreatorid.html
-rw-r--r--      3500 2016-12-08 06:19 function.enchant-dict-is-in-session.html
-rw-r--r--      2758 2016-12-08 06:18 openssl.key-types.html
-rw-r--r--      1544 2016-12-08 06:18 dbplus.setup.html
-rw-r--r--      7402 2016-12-08 06:19 arrayobject.natcasesort.html
-rw-r--r--      3520 2016-12-08 06:19 function.is-infinite.html
-rw-r--r--      2725 2016-12-08 06:20 solrserverexception.getinternalinfo.html
-rw-r--r--      5627 2016-12-08 06:20 internals2.opcodes.fetch-func-arg.html
-rw-r--r--      2998 2016-12-08 06:19 spltype.construct.html
-rw-r--r--      6483 2016-12-08 06:19 intlchar.getintpropertyminvalue.html
-rw-r--r--      3350 2016-12-08 06:19 function.stats-rand-gen-noncenral-chisquare.html
-rw-r--r--     14559 2016-12-08 06:18 function.cubrid-get-db-parameter.html
-rw-r--r--      1835 2016-12-08 06:19 function.pdf-open-tiff.html
-rw-r--r--      4912 2016-12-08 06:19 cairocontext.pathextents.html
-rw-r--r--      3959 2016-12-08 06:18 function.dbplus-aql.html
-rw-r--r--      3275 2016-12-08 06:19 evtimer.again.html
-rw-r--r--      3133 2016-12-08 06:19 imagick.profileimage.html
-rw-r--r--      2619 2016-12-08 06:20 varnishadmin.banurl.html
-rw-r--r--      5497 2016-12-08 06:18 phardata.addemptydir.html
-rw-r--r--     10467 2016-12-08 06:18 language.generators.overview.html
-rw-r--r--      2735 2016-12-08 06:19 evwatcher.invoke.html
-rw-r--r--      1441 2016-12-08 06:18 intro.scream.html
-rw-r--r--      3455 2016-12-08 06:19 function.fann-save-train.html
-rw-r--r--      4575 2016-12-08 06:19 function.cairo-surface-get-font-options.html
-rw-r--r--      5549 2016-12-08 06:20 function.get-resource-type.html
-rw-r--r--      8996 2016-12-08 06:19 class.swftextfield.html
-rw-r--r--     14827 2016-12-08 06:19 maxdb.examples-basic.html
-rw-r--r--      7353 2016-12-08 06:19 function.pg-meta-data.html
-rw-r--r--      4342 2016-12-08 06:18 htscanner.configuration.html
-rw-r--r--      2617 2016-12-08 06:19 yaf-controller-abstract.getview.html
-rw-r--r--      3760 2016-12-08 06:19 harudestination.setfitr.html
-rw-r--r--      5029 2016-12-08 06:19 function.pspell-config-ignore.html
-rw-r--r--      1951 2016-12-08 06:19 function.pdf-end-font.html
-rw-r--r--      1883 2016-12-08 06:20 internals2.ze1.intro.html
-rw-r--r--      1266 2016-12-08 06:18 filepro.constants.html
-rw-r--r--      2772 2016-12-08 06:19 function.pdf-setcolor.html
-rw-r--r--      4978 2016-12-08 06:19 imagick.setimageiterations.html
-rw-r--r--     22562 2016-12-08 06:19 mongocollection.aggregatecursor.html
-rw-r--r--      2368 2016-12-08 06:19 function.pdf-load-image.html
-rw-r--r--     19813 2016-12-08 06:19 swfshape.setline.html
-rw-r--r--      4911 2016-12-08 06:19 cairocontext.getlinejoin.html
-rw-r--r--      8861 2016-12-08 06:19 function.oci-field-type-raw.html
-rw-r--r--      6865 2016-12-08 06:19 intlcalendar.fromdatetime.html
-rw-r--r--      6393 2016-12-08 06:19 cond.wait.html
-rw-r--r--      3684 2016-12-08 06:19 function.msql-drop-db.html
-rw-r--r--      3035 2016-12-08 06:19 function.stats-cdf-exponential.html
-rw-r--r--      2928 2016-12-08 06:19 hwapi.attribute-langdepvalue.html
-rw-r--r--      2461 2016-12-08 06:18 function.ncurses-slk-restore.html
-rw-r--r--      8792 2016-12-08 06:19 function.xdiff-file-patch.html
-rw-r--r--      6413 2016-12-08 06:19 function.mssql-fetch-batch.html
-rw-r--r--      1838 2016-12-08 06:19 ref.rpmreader.html
-rw-r--r--      3574 2016-12-08 06:19 function.fann-set-cascade-min-out-epochs.html
-rw-r--r--     14739 2016-12-08 06:19 function.imap-createmailbox.html
-rw-r--r--      2208 2016-12-08 06:19 function.ocifreecollection.html
-rw-r--r--      4447 2016-12-08 06:20 ds-map.reversed.html
-rw-r--r--      5101 2016-12-08 06:20 soapclient.gettypes.html
-rw-r--r--      2664 2016-12-08 06:20 internals2.pdo.html
-rw-r--r--      2437 2016-12-08 06:19 yaf-session.current.html
-rw-r--r--      2106 2016-12-08 06:19 function.ocinumcols.html
-rw-r--r--      3029 2016-12-08 06:20 solrquery.setfacetmincount.html
-rw-r--r--      2562 2016-12-08 06:20 solrquery.setquery.html
-rw-r--r--      1731 2016-12-08 06:20 internals2.counter.setup.html
-rw-r--r--      2792 2016-12-08 06:20 domnode.issamenode.html
-rw-r--r--      3805 2016-12-08 06:19 class.cairolinecap.html
-rw-r--r--      4000 2016-12-08 06:20 ds-sequence.reverse.html
-rw-r--r--      7253 2016-12-08 06:18 wrappers.audio.html
-rw-r--r--      2996 2016-12-08 06:20 sdo-das-xml-document.setxmldeclaration.html
-rw-r--r--      2671 2016-12-08 06:19 function.fann-get-num-output.html
-rw-r--r--      2698 2016-12-08 06:19 function.trader-midpoint.html
-rw-r--r--      2825 2016-12-08 06:20 sdo-das-changesummary.endlogging.html
-rw-r--r--      2823 2016-12-08 06:19 mysqlnd-uh.changes-one-o.html
-rw-r--r--      5200 2016-12-08 06:19 class.splstring.html
-rw-r--r--      3049 2016-12-08 06:18 function.odbc-exec.html
-rw-r--r--      3015 2016-12-08 06:19 gmagick.cyclecolormapimage.html
-rw-r--r--      3231 2016-12-08 06:19 function.ps-end-template.html
-rw-r--r--      5308 2016-12-08 06:18 reserved.variables.globals.html
-rw-r--r--      3301 2016-12-08 06:20 function.yaz-database.html
-rw-r--r--      3955 2016-12-08 06:18 exception.construct.html
-rw-r--r--      2624 2016-12-08 06:20 migration5.oop.html
-rw-r--r--     17766 2016-12-08 06:18 rararchive.open.html
-rw-r--r--      4670 2016-12-08 06:19 function.sybase-fetch-assoc.html
-rw-r--r--      9222 2016-12-08 06:18 function.db2-fetch-object.html
-rw-r--r--      6517 2016-12-08 06:19 function.gmp-sqrtrem.html
-rw-r--r--      4273 2016-12-08 06:19 function.gupnp-service-info-get-introspection.html
-rw-r--r--      2423 2016-12-08 06:20 book.win32ps.html
-rw-r--r--      3271 2016-12-08 06:20 migration55.classes.html
-rw-r--r--     11237 2016-12-08 06:19 mysqli.insert-id.html
-rw-r--r--      5894 2016-12-08 06:19 function.imap-sort.html
-rw-r--r--      1700 2016-12-08 06:20 ds-vector.count.html
-rw-r--r--      2855 2016-12-08 06:19 eventlistener.disable.html
-rw-r--r--      3167 2016-12-08 06:20 sdo-das-changesummary.getchangeddataobjects.html
-rw-r--r--      3354 2016-12-08 06:19 function.curl-multi-getcontent.html
-rw-r--r--      2848 2016-12-08 06:19 intltimezone.countequivalentids.html
-rw-r--r--      2848 2016-12-08 06:19 book.shmop.html
-rw-r--r--      3497 2016-12-08 06:19 mongo.tutorial.connecting.html
-rw-r--r--      2188 2016-12-08 06:20 ui-control.destroy.html
-rw-r--r--      2797 2016-12-08 06:18 function.ncurses-bkgd.html
-rw-r--r--      2221 2016-12-08 06:20 ui-controls-form.ispadded.html
-rw-r--r--      5157 2016-12-08 06:20 reflectionclass.iscloneable.html
-rw-r--r--      3874 2016-12-08 06:19 function.ps-symbol-name.html
-rw-r--r--     11589 2016-12-08 06:19 function.sqlite-exec.html
-rw-r--r--      3593 2016-12-08 06:18 function.newt-checkbox-tree-multi.html
-rw-r--r--      8656 2016-12-08 06:19 mysqlnduhconnection.getfieldcount.html
-rw-r--r--      1568 2016-12-08 06:18 openssl.setup.html
-rw-r--r--      2680 2016-12-08 06:19 intltimezone.gettzdataversion.html
-rw-r--r--      6014 2016-12-08 06:19 function.mysql-set-charset.html
-rw-r--r--      6683 2016-12-08 06:19 book.posix.html
-rw-r--r--      3531 2016-12-08 06:19 function.ldap-first-attribute.html
-rw-r--r--      5869 2016-12-08 06:19 function.cairo-pattern-add-color-stop-rgba.html
-rw-r--r--      1353 2016-12-08 06:19 imagick.resources.html
-rw-r--r--      4688 2016-12-08 06:19 mongodb-bson-timestamp.tostring.html
-rw-r--r--      4119 2016-12-08 06:19 function.oci-client-version.html
-rw-r--r--      3962 2016-12-08 06:19 cairogradientpattern.getcolorstopcount.html
-rw-r--r--     15697 2016-12-08 06:19 book.datetime.html
-rw-r--r--      1629 2016-12-08 06:19 tokyo-tyrant.setup.html
-rw-r--r--     16534 2016-12-08 06:19 mysqli-result.current-field.html
-rw-r--r--      8881 2016-12-08 06:18 features.remote-files.html
-rw-r--r--      3950 2016-12-08 06:19 function.enchant-broker-set-dict-path.html
-rw-r--r--      3085 2016-12-08 06:20 function.svn-fs-props-changed.html
-rw-r--r--      2517 2016-12-08 06:19 class.countable.html
-rw-r--r--      1506 2016-12-08 06:19 judy.setup.html
-rw-r--r--      8307 2016-12-08 06:19 mongodb-driver-manager.getservers.html
-rw-r--r--      1393 2016-12-08 06:18 password.configuration.html
-rw-r--r--      2775 2016-12-08 06:19 gearmanclient.geterrno.html
-rw-r--r--      5413 2016-12-08 06:19 intlchar.ismirrored.html
-rw-r--r--      3391 2016-12-08 06:20 ui-draw-path.newfigurewitharc.html
-rw-r--r--      2650 2016-12-08 06:19 function.stats-absolute-deviation.html
-rw-r--r--      3647 2016-12-08 06:20 function.variant-cast.html
-rw-r--r--      3026 2016-12-08 06:19 iteratoriterator.construct.html
-rw-r--r--      8111 2016-12-08 06:18 class.serializable.html
-rw-r--r--      1323 2016-12-08 06:20 intro.svm.html
-rw-r--r--      4590 2016-12-08 06:19 syncsharedmemory.size.html
-rw-r--r--      7460 2016-12-08 06:19 function.iconv-substr.html
-rw-r--r--      3597 2016-12-08 06:20 internals2.counter.function.counter-get-value.html
-rw-r--r--      6727 2016-12-08 06:18 closure.call.html
-rw-r--r--     12825 2016-12-08 06:19 memcache.addserver.html
-rw-r--r--      5048 2016-12-08 06:19 iconv.configuration.html
-rw-r--r--      3811 2016-12-08 06:20 function.stomp-connect-error.html
-rw-r--r--      2187 2016-12-08 06:19 function.pdf-setflat.html
-rw-r--r--      4968 2016-12-08 06:20 ds-priorityqueue.allocate.html
-rw-r--r--      5481 2016-12-08 06:19 cairocontext.instroke.html
-rw-r--r--      3165 2016-12-08 06:18 function.zip-close.html
-rw-r--r--      2442 2016-12-08 06:19 function.vpopmail-error.html
-rw-r--r--      5614 2016-12-08 06:20 reflectionfunctionabstract.isclosure.html
-rw-r--r--      3557 2016-12-08 06:19 mongocursor.limit.html
-rw-r--r--      5458 2016-12-08 06:20 ds-set.sum.html
-rw-r--r--      5724 2016-12-08 06:19 ref.gmp.html
-rw-r--r--     17229 2016-12-08 06:18 install.unix.sun.html
-rw-r--r--      1926 2016-12-08 06:19 mysqlnd-qc.changes.html
-rw-r--r--      3021 2016-12-08 06:19 function.stats-dens-cauchy.html
-rw-r--r--      3625 2016-12-08 06:19 function.ps-open-file.html
-rw-r--r--     13637 2016-12-08 06:19 function.ingres-set-environment.html
-rw-r--r--     16838 2016-12-08 06:19 mysqli.affected-rows.html
-rw-r--r--      2900 2016-12-08 06:18 function.ncurses-slk-set.html
-rw-r--r--      2947 2016-12-08 06:20 solrquery.setmltmindocfrequency.html
-rw-r--r--      1782 2016-12-08 06:19 intro.gmagick.html
-rw-r--r--      2465 2016-12-08 06:19 splpriorityqueue.key.html
-rw-r--r--      6378 2016-12-08 06:20 xsltprocessor.transformtouri.html
-rw-r--r--      7615 2016-12-08 06:18 function.db2-table-privileges.html
-rw-r--r--      1354 2016-12-08 06:20 tcpwrap.requirements.html
-rw-r--r--      8252 2016-12-08 06:18 ziparchive.addglob.html
-rw-r--r--      3245 2016-12-08 06:20 function.long2ip.html
-rw-r--r--      3095 2016-12-08 06:20 solrquery.addsortfield.html
-rw-r--r--      2748 2016-12-08 06:19 function.vpopmail-alias-add.html
-rw-r--r--      3137 2016-12-08 06:20 internals2.counter.counter-class.setcounterclass.html
-rw-r--r--      1660 2016-12-08 06:18 constants.newt.listbox-flags.html
-rw-r--r--      2830 2016-12-08 06:18 function.newt-wait-for-key.html
-rw-r--r--      2453 2016-12-08 06:20 ui-controls-entry.construct.html
-rw-r--r--      4951 2016-12-08 06:19 function.ps-place-image.html
-rw-r--r--     10667 2016-12-08 06:20 function.session-create-id.html
-rw-r--r--     25536 2016-12-08 06:20 book.ds.html
-rw-r--r--      1514 2016-12-08 06:20 pcre.setup.html
-rw-r--r--      2755 2016-12-08 06:18 function.newt-set-help-callback.html
-rw-r--r--      3083 2016-12-08 06:19 yaf-request-simple.construct.html
-rw-r--r--      2388 2016-12-08 06:19 imagick.getimageiterations.html
-rw-r--r--      5682 2016-12-08 06:20 class.ui-draw-brush-lineargradient.html
-rw-r--r--      4840 2016-12-08 06:18 install.windows.recommended.html
-rw-r--r--      2976 2016-12-08 06:19 function.ldap-free-result.html
-rw-r--r--     11441 2016-12-08 06:20 function.each.html
-rw-r--r--      3595 2016-12-08 06:20 function.yaz-range.html
-rw-r--r--      2224 2016-12-08 06:20 ui-window.onclosing.html
-rw-r--r--      2561 2016-12-08 06:19 judy.offsetget.html
-rw-r--r--     10784 2016-12-08 06:19 cairocontext.getcurrentpoint.html
-rw-r--r--      2749 2016-12-08 06:19 imagick.displayimages.html
-rw-r--r--      1483 2016-12-08 06:19 gmagick.setup.html
-rw-r--r--      2878 2016-12-08 06:20 function.svn-fs-revision-root.html
-rw-r--r--      6642 2016-12-08 06:19 function.log-cmd-update.html
-rw-r--r--      8458 2016-12-08 06:19 function.imagecropauto.html
-rw-r--r--      2705 2016-12-08 06:19 function.bson-encode.html
-rw-r--r--      3072 2016-12-08 06:20 solrquery.addfacetdateother.html
-rw-r--r--      4652 2016-12-08 06:19 mysqli.persistconns.html
-rw-r--r--      6266 2016-12-08 06:19 memcache.getserverstatus.html
-rw-r--r--      9757 2016-12-08 06:20 function.socket-set-option.html
-rw-r--r--      3704 2016-12-08 06:20 xmlreader.setrelaxngschema.html
-rw-r--r--     11347 2016-12-08 06:19 numberformatter.gettextattribute.html
-rw-r--r--      2934 2016-12-08 06:19 intlbreakiterator.following.html
-rw-r--r--      6688 2016-12-08 06:20 filter.filters.validate.html
-rw-r--r--      2371 2016-12-08 06:18 id3v2tag.getframelist.html
-rw-r--r--     13182 2016-12-08 06:19 function.ps-begin-pattern.html
-rw-r--r--      2614 2016-12-08 06:19 yaf-request-abstract.isput.html
-rw-r--r--      3885 2016-12-08 06:19 function.spl-autoload.html
-rw-r--r--      2053 2016-12-08 06:18 features.commandline.html
-rw-r--r--      3168 2016-12-08 06:18 function.fbsql-free-result.html
-rw-r--r--     16779 2016-12-08 06:19 mysqli-result.fetch-field-direct.html
-rw-r--r--      3209 2016-12-08 06:19 eventutil.getlastsocketerror.html
-rw-r--r--      4456 2016-12-08 06:20 class.ds-collection.html
-rw-r--r--      6909 2016-12-08 06:20 function.strval.html
-rw-r--r--      2709 2016-12-08 06:19 function.fann-get-num-layers.html
-rw-r--r--      4334 2016-12-08 06:19 ref.pcntl.html
-rw-r--r--      3989 2016-12-08 06:18 function.crack-opendict.html
-rw-r--r--      4662 2016-12-08 06:19 syncsemaphore.lock.html
-rw-r--r--      4680 2016-12-08 06:19 function.decoct.html
-rw-r--r--      4880 2016-12-08 06:19 class.cairopatterntype.html
-rw-r--r--      4058 2016-12-08 06:18 function.radius-salt-encrypt-attr.html
-rw-r--r--      2678 2016-12-08 06:19 yaf-request-abstract.getparams.html
-rw-r--r--      4497 2016-12-08 06:19 mysqli.client-info.html
-rw-r--r--      3042 2016-12-08 06:19 harupage.gettextmatrix.html
-rw-r--r--      4126 2016-12-08 06:19 cairopdfsurface.setsize.html
-rw-r--r--      2821 2016-12-08 06:19 function.trader-linearreg-slope.html
-rw-r--r--      3049 2016-12-08 06:19 mime-magic.installation.html
-rw-r--r--      3930 2016-12-08 06:19 gmagickdraw.arc.html
-rw-r--r--      3222 2016-12-08 06:19 imagickdraw.pathmovetoabsolute.html
-rw-r--r--     15199 2016-12-08 06:20 reflectionproperty.construct.html
-rw-r--r--      5617 2016-12-08 06:19 geoip.constants.html
-rw-r--r--      3473 2016-12-08 06:18 phar.isvalidpharfilename.html
-rw-r--r--      8982 2016-12-08 06:19 yaml.constants.html
-rw-r--r--      5969 2016-12-08 06:19 function.log-cmd-insert.html
-rw-r--r--      8654 2016-12-08 06:19 class.appenditerator.html
-rw-r--r--      2534 2016-12-08 06:19 sem.configuration.html
-rw-r--r--      5948 2016-12-08 06:19 class.filteriterator.html
-rw-r--r--      3116 2016-12-08 06:20 solrquery.sethighlightregexmaxanalyzedchars.html
-rw-r--r--      6488 2016-12-08 06:19 intlchar.getintpropertymaxvalue.html
-rw-r--r--      2810 2016-12-08 06:19 function.trader-sub.html
-rw-r--r--      2393 2016-12-08 06:18 function.ibase-service-attach.html
-rw-r--r--      7885 2016-12-08 06:20 class.solrparams.html
-rw-r--r--     15566 2016-12-08 06:19 mysqlnd-uh.quickstart.proxy-installation.html
-rw-r--r--      2923 2016-12-08 06:19 harudoc.usejpencodings.html
-rw-r--r--      2054 2016-12-08 06:19 function.pdf-get-apiname.html
-rw-r--r--     13179 2016-12-08 06:19 swfgradient.construct.html
-rw-r--r--      6202 2016-12-08 06:20 regexp.reference.onlyonce.html
-rw-r--r--      2965 2016-12-08 06:19 gearmanclient.echo.html
-rw-r--r--      7214 2016-12-08 06:18 function.mcrypt-create-iv.html
-rw-r--r--      1558 2016-12-08 06:19 fileinfo.resources.html
-rw-r--r--      2873 2016-12-08 06:20 migration51.datetime.html
-rw-r--r--      3461 2016-12-08 06:18 function.ingres-autocommit-state.html
-rw-r--r--      7537 2016-12-08 06:20 quickhashintset.add.html
-rw-r--r--      5177 2016-12-08 06:19 cairogradientpattern.addcolorstoprgba.html
-rw-r--r--      5013 2016-12-08 06:20 ds-sequence.push.html
-rw-r--r--      1553 2016-12-08 06:18 inclued.setup.html
-rw-r--r--      3706 2016-12-08 06:19 function.imap-close.html
-rw-r--r--      3620 2016-12-08 06:19 mongocursor.dead.html
-rw-r--r--      4466 2016-12-08 06:19 mongolog.getlevel.html
-rw-r--r--      1352 2016-12-08 06:18 opcache.requirements.html
-rw-r--r--      5433 2016-12-08 06:19 function.ftp-pwd.html
-rw-r--r--      3028 2016-12-08 06:19 function.stats-dens-laplace.html
-rw-r--r--      7269 2016-12-08 06:19 class.resourcebundle.html
-rw-r--r--      2496 2016-12-08 06:19 imagick.readimage.html
-rw-r--r--      2614 2016-12-08 06:19 mongo.manual.html
-rw-r--r--      6919 2016-12-08 06:18 function.fbsql-error.html
-rw-r--r--      2056 2016-12-08 06:19 xdiff.installation.html
-rw-r--r--     14236 2016-12-08 06:19 function.stream-socket-server.html
-rw-r--r--      3861 2016-12-08 06:18 function.ncurses-prefresh.html
-rw-r--r--      8013 2016-12-08 06:19 splobjectstorage.getinfo.html
-rw-r--r--      7698 2016-12-08 06:20 migration71.other-changes.html
-rw-r--r--      3302 2016-12-08 06:19 function.fdf-error.html
-rw-r--r--      3418 2016-12-08 06:19 gearmanworker.unregister.html
-rw-r--r--      7047 2016-12-08 06:20 reflectionmethod.invokeargs.html
-rw-r--r--     12431 2016-12-08 06:19 class.mongowritebatch.html
-rw-r--r--      3199 2016-12-08 06:19 event.free.html
-rw-r--r--      5890 2016-12-08 06:19 splobjectstorage.valid.html
-rw-r--r--     18189 2016-12-08 06:18 language.variables.external.html
-rw-r--r--      1340 2016-12-08 06:19 shmop.requirements.html
-rw-r--r--      1510 2016-12-08 06:19 event.setup.html
-rw-r--r--      3337 2016-12-08 06:19 function.memcache-debug.html
-rw-r--r--     11903 2016-12-08 06:18 class.errorexception.html
-rw-r--r--      7703 2016-12-08 06:20 ds-deque.sort.html
-rw-r--r--      2030 2016-12-08 06:19 intro.event.html
-rw-r--r--      2940 2016-12-08 06:19 imagick.getimagecolormapcolor.html
-rw-r--r--      4912 2016-12-08 06:20 ds-queue.push.html
-rw-r--r--      7592 2016-12-08 06:18 function.wincache-ucache-clear.html
-rw-r--r--      2847 2016-12-08 06:19 function.imap-headers.html
-rw-r--r--      8664 2016-12-08 06:20 samconnection.peekall.html
-rw-r--r--      6283 2016-12-08 06:19 imagick.haldclutimage.html
-rw-r--r--      6393 2016-12-08 06:18 class.ktaglib-mpeg-audioproperties.html
-rw-r--r--      6769 2016-12-08 06:19 tokyotyrant.fwmkeys.html
-rw-r--r--      3987 2016-12-08 06:19 cairosurfacepattern.setfilter.html
-rw-r--r--     10486 2016-12-08 06:18 function.dba-open.html
-rw-r--r--      2565 2016-12-08 06:19 gearmanjob.setreturn.html
-rw-r--r--      6174 2016-12-08 06:19 imagick.gaussianblurimage.html
-rw-r--r--      2500 2016-12-08 06:19 imagickdraw.render.html
-rw-r--r--      2899 2016-12-08 06:19 function.trader-trange.html
-rw-r--r--      4666 2016-12-08 06:20 ds-set.allocate.html
-rw-r--r--      2735 2016-12-08 06:19 function.vpopmail-add-alias-domain.html
-rw-r--r--      4060 2016-12-08 06:19 arrayiterator.key.html
-rw-r--r--      3337 2016-12-08 06:19 arrayiterator.asort.html
-rw-r--r--      2352 2016-12-08 06:20 solrdocument.destruct.html
-rw-r--r--      4744 2016-12-08 06:20 function.ssh2-auth-agent.html
-rw-r--r--      6486 2016-12-08 06:20 samconnection.peek.html
-rw-r--r--      1468 2016-12-08 06:19 rpmreader.resources.html
-rw-r--r--      2499 2016-12-08 06:19 splpriorityqueue.valid.html
-rw-r--r--      4219 2016-12-08 06:20 function.ord.html
-rw-r--r--      2686 2016-12-08 06:20 svn.installation.html
-rw-r--r--      4912 2016-12-08 06:19 function.cairo-pattern-create-rgb.html
-rw-r--r--      7353 2016-12-08 06:19 function.mssql-field-length.html
-rw-r--r--      3138 2016-12-08 06:19 function.imap-utf8.html
-rw-r--r--      2808 2016-12-08 06:18 function.ncurses-scr-dump.html
-rw-r--r--      4143 2016-12-08 06:18 pdo.pgsqlcopyfromarray.html
-rw-r--r--      1733 2016-12-08 06:18 features.gc.html
-rw-r--r--      3056 2016-12-08 06:18 function.ncurses-has-il.html
-rw-r--r--      3783 2016-12-08 06:19 function.gupnp-context-unhost-path.html
-rw-r--r--     14779 2016-12-08 06:18 function.cubrid-pconnect-with-url.html
-rw-r--r--      5001 2016-12-08 06:20 function.xmlwriter-write-dtd-attlist.html
-rw-r--r--      1543 2016-12-08 06:20 libxml.setup.html
-rw-r--r--      2484 2016-12-08 06:19 function.trader-tan.html
-rw-r--r--     16084 2016-12-08 06:19 function.stream-socket-client.html
-rw-r--r--     11016 2016-12-08 06:19 function.mysql-db-query.html
-rw-r--r--      3878 2016-12-08 06:20 ds-set.first.html
-rw-r--r--      3179 2016-12-08 06:19 function.gupnp-service-action-return.html
-rw-r--r--      1326 2016-12-08 06:19 sem.requirements.html
-rw-r--r--      6227 2016-12-08 06:19 imagickpixel.getcolor.html
-rw-r--r--      4469 2016-12-08 06:20 sam.errors.html
-rw-r--r--      2192 2016-12-08 06:19 function.pdf-close-image.html
-rw-r--r--      3285 2016-12-08 06:19 imagick.getimagedistortion.html
-rw-r--r--      7986 2016-12-08 06:19 eventhttp.setdefaultcallback.html
-rw-r--r--     25171 2016-12-08 06:19 swfbutton.construct.html
-rw-r--r--      5483 2016-12-08 06:20 zookeeper.delete.html
-rw-r--r--      4807 2016-12-08 06:18 function.ob-get-contents.html
-rw-r--r--      3567 2016-12-08 06:18 function.password-get-info.html
-rw-r--r--      1512 2016-12-08 06:20 varnish.examples.html
-rw-r--r--      9716 2016-12-08 06:18 language.oop5.object-comparison.html
-rw-r--r--      3620 2016-12-08 06:19 cairomatrix.invert.html
-rw-r--r--      4195 2016-12-08 06:19 function.ldap-get-entries.html
-rw-r--r--      5455 2016-12-08 06:18 memtrack.ini.html
-rw-r--r--      2384 2016-12-08 06:20 ui-controls-button.construct.html
-rw-r--r--      1556 2016-12-08 06:20 win32ps.setup.html
-rw-r--r--      2440 2016-12-08 06:19 imagickdraw.getfillcolor.html
-rw-r--r--      1332 2016-12-08 06:18 apcu.resources.html
-rw-r--r--      6409 2016-12-08 06:19 imagick.textureimage.html
-rw-r--r--      5783 2016-12-08 06:19 mongodb-driver-server.getport.html
-rw-r--r--      3597 2016-12-08 06:20 book.sdodasrel.html
-rw-r--r--     12306 2016-12-08 06:19 imagickdraw.setstrokemiterlimit.html
-rw-r--r--     14033 2016-12-08 06:19 class.spldoublylinkedlist.html
-rw-r--r--      4545 2016-12-08 06:18 rarentry.isdirectory.html
-rw-r--r--      2288 2016-12-08 06:19 function.imagefontheight.html
-rw-r--r--      2421 2016-12-08 06:18 rarentry.getfiletime.html
-rw-r--r--      7156 2016-12-08 06:19 mongodb-driver-writeconcernerror.getcode.html
-rw-r--r--      4398 2016-12-08 06:18 function.mhash-keygen-s2k.html
-rw-r--r--      3592 2016-12-08 06:19 function.fann-set-sarprop-weight-decay-shift.html
-rw-r--r--      2468 2016-12-08 06:19 splpriorityqueue.next.html
-rw-r--r--      3497 2016-12-08 06:19 recursivefilteriterator.haschildren.html
-rw-r--r--      8790 2016-12-08 06:19 function.pg-fetch-assoc.html
-rw-r--r--      5275 2016-12-08 06:19 evwatcher.keepalive.html
-rw-r--r--      2734 2016-12-08 06:20 function.wddx-serialize-value.html
-rw-r--r--      5613 2016-12-08 06:19 mongo.connecting.persistent.html
-rw-r--r--      2739 2016-12-08 06:19 mysql.html
-rw-r--r--      2777 2016-12-08 06:19 swftextfield.setfont.html
-rw-r--r--      2675 2016-12-08 06:19 yaf-route-static.match.html
-rw-r--r--      2544 2016-12-08 06:19 harudoc.construct.html
-rw-r--r--      5494 2016-12-08 06:20 class.ui-draw-text-font-descriptor.html
-rw-r--r--      8750 2016-12-08 06:20 refs.xml.html
-rw-r--r--      4858 2016-12-08 06:20 class.zmqcontext.html
-rw-r--r--      2884 2016-12-08 06:20 internals2.opcodes.cast.html
-rw-r--r--      2235 2016-12-08 06:20 ui-window.save.html
-rw-r--r--      4418 2016-12-08 06:18 function.newt-form-run.html
-rw-r--r--      4707 2016-12-08 06:19 function.ps-set-value.html
-rw-r--r--     10520 2016-12-08 06:19 intlcalendar.settimezone.html
-rw-r--r--      1542 2016-12-08 06:19 iconv.setup.html
-rw-r--r--      6312 2016-12-08 06:19 function.imagecolorclosesthwb.html
-rw-r--r--      5768 2016-12-08 06:19 mongocommandcursor.rewind.html
-rw-r--r--     15673 2016-12-08 06:19 mysqli.use-result.html
-rw-r--r--      9630 2016-12-08 06:18 security.errors.html
-rw-r--r--      7072 2016-12-08 06:19 mongodb-driver-readconcern.construct.html
-rw-r--r--      6403 2016-12-08 06:19 function.pg-end-copy.html
-rw-r--r--     12593 2016-12-08 06:19 function.imagesetstyle.html
-rw-r--r--      5661 2016-12-08 06:19 function.cairo-pattern-create-radial.html
-rw-r--r--      5077 2016-12-08 06:20 domdocument.createdocumentfragment.html
-rw-r--r--      4888 2016-12-08 06:20 domnode.insertbefore.html
-rw-r--r--      3762 2016-12-08 06:18 exception.getfile.html
-rw-r--r--      2627 2016-12-08 06:20 solrinputdocument.getboost.html
-rw-r--r--      1950 2016-12-08 06:20 function.socket-set-blocking.html
-rw-r--r--      3250 2016-12-08 06:20 sdo-model-type.issequencedtype.html
-rw-r--r--      8751 2016-12-08 06:19 function.sqlsrv-num-fields.html
-rw-r--r--      1404 2016-12-08 06:19 intro.msql.html
-rw-r--r--      1518 2016-12-08 06:19 ming.setup.html
-rw-r--r--      5545 2016-12-08 06:19 function.gnupg-setsignmode.html
-rw-r--r--     12119 2016-12-08 06:20 bbcode.constants.html
-rw-r--r--      2244 2016-12-08 06:20 ui-window.open.html
-rw-r--r--     13544 2016-12-08 06:19 book.mongodb.html
-rw-r--r--      5570 2016-12-08 06:19 function.ingres-num-rows.html
-rw-r--r--      1827 2016-12-08 06:19 ref.bson.html
-rw-r--r--     18351 2016-12-08 06:19 function.mysql-connect.html
-rw-r--r--      1284 2016-12-08 06:19 judy.resources.html
-rw-r--r--      1250 2016-12-08 06:19 intro.sqlite3.html
-rw-r--r--      5629 2016-12-08 06:19 imagick.setfont.html
-rw-r--r--      3610 2016-12-08 06:19 cairosurface.flush.html
-rw-r--r--      2071 2016-12-08 06:20 solrquery.getexpandquery.html
-rw-r--r--      3129 2016-12-08 06:18 function.ncurses-noecho.html
-rw-r--r--      1877 2016-12-08 06:19 function.msql-fieldtype.html
-rw-r--r--      2539 2016-12-08 06:19 yaf-config-ini.readonly.html
-rw-r--r--      1742 2016-12-08 06:20 sockets.installation.html
-rw-r--r--      5760 2016-12-08 06:18 wrappers.glob.html
-rw-r--r--     17916 2016-12-08 06:18 function.db2-lob-read.html
-rw-r--r--     16123 2016-12-08 06:19 intldateformatter.islenient.html
-rw-r--r--      1821 2016-12-08 06:19 enchant.installation.html
-rw-r--r--      8753 2016-12-08 06:19 class.gearmantask.html
-rw-r--r--      5392 2016-12-08 06:19 tokyotyrant.out.html
-rw-r--r--      2825 2016-12-08 06:19 yaf-config-ini.construct.html
-rw-r--r--     13473 2016-12-08 06:20 yar-concurrent-client.loop.html
-rw-r--r--     11617 2016-12-08 06:20 class.solrqueryresponse.html
-rw-r--r--      5360 2016-12-08 06:19 mongodb-bson-objectid.construct.html
-rw-r--r--      6819 2016-12-08 06:20 rrd.examples-oop.html
-rw-r--r--      5179 2016-12-08 06:20 function.ssh2-sftp.html
-rw-r--r--      4333 2016-12-08 06:20 book.msession.html
-rw-r--r--      4086 2016-12-08 06:20 function.xmlwriter-end-element.html
-rw-r--r--      2561 2016-12-08 06:19 imagick.getimageattribute.html
-rw-r--r--      2951 2016-12-08 06:20 sdo-dataobject.getcontainer.html
-rw-r--r--      3368 2016-12-08 06:18 constants.newt.components-flags.html
-rw-r--r--      2812 2016-12-08 06:20 solrinputdocument.deletefield.html
-rw-r--r--     30026 2016-12-08 06:19 function.imagefilter.html
-rw-r--r--      2644 2016-12-08 06:19 swftext.setheight.html
-rw-r--r--      2963 2016-12-08 06:18 function.m-numrows.html
-rw-r--r--      3415 2016-12-08 06:19 function.ps-restore.html
-rw-r--r--      5966 2016-12-08 06:19 imagick.cropimage.html
-rw-r--r--      2398 2016-12-08 06:19 intro.json.html
-rw-r--r--     43136 2016-12-08 06:18 class.rarentry.html
-rw-r--r--      3188 2016-12-08 06:20 function.snmpget.html
-rw-r--r--     29476 2016-12-08 06:19 mysqli.quickstart.statements.html
-rw-r--r--     10941 2016-12-08 06:19 intldateformatter.getlocale.html
-rw-r--r--      5519 2016-12-08 06:19 mongodb.getwriteconcern.html
-rw-r--r--      4058 2016-12-08 06:19 imagickdraw.pathcurvetoquadraticbezierrelative.html
-rw-r--r--      2705 2016-12-08 06:19 function.event-buffer-read.html
-rw-r--r--      8782 2016-12-08 06:19 function.mysql-errno.html
-rw-r--r--      3285 2016-12-08 06:20 sdo-das-setting.getlistindex.html
-rw-r--r--      3279 2016-12-08 06:19 function.event-buffer-priority-set.html
-rw-r--r--      8593 2016-12-08 06:20 solrclient.construct.html
-rw-r--r--      6422 2016-12-08 06:19 function.curl-init.html
-rw-r--r--      3217 2016-12-08 06:19 function.imap-num-msg.html
-rw-r--r--      7092 2016-12-08 06:19 cairocontext.clipextents.html
-rw-r--r--      6283 2016-12-08 06:18 phar.offsetexists.html
-rw-r--r--      6019 2016-12-08 06:19 imagick.newimage.html
-rw-r--r--      1583 2016-12-08 06:20 xmlreader.requirements.html
-rw-r--r--      6458 2016-12-08 06:19 mongocollection.setreadpreference.html
-rw-r--r--      5851 2016-12-08 06:19 pgsql.configuration.html
-rw-r--r--      3749 2016-12-08 06:20 oauthprovider.callconsumerhandler.html
-rw-r--r--      1354 2016-12-08 06:18 weakref.requirements.html
-rw-r--r--      4892 2016-12-08 06:19 transliterator.createfromrules.html
-rw-r--r--      7840 2016-12-08 06:18 phar.extractto.html
-rw-r--r--      2000 2016-12-08 06:20 ui.installation.html
-rw-r--r--      6540 2016-12-08 06:20 zookeeper.set.html
-rw-r--r--      1872 2016-12-08 06:19 function.imap-create.html
-rw-r--r--      2470 2016-12-08 06:20 solrquery.gettermslowerbound.html
-rw-r--r--      2791 2016-12-08 06:19 imagick.setsize.html
-rw-r--r--      4331 2016-12-08 06:19 syncreaderwriter.writelock.html
-rw-r--r--      2451 2016-12-08 06:19 mysqli-warning.construct.html
-rw-r--r--      5706 2016-12-08 06:18 function.blenc-encrypt.html
-rw-r--r--      5634 2016-12-08 06:18 function.bzwrite.html
-rw-r--r--      1936 2016-12-08 06:20 sca.requirements.html
-rw-r--r--      1332 2016-12-08 06:19 chdb.resources.html
-rw-r--r--      3656 2016-12-08 06:19 evprepare.construct.html
-rw-r--r--      9662 2016-12-08 06:18 function.wincache-ocache-fileinfo.html
-rw-r--r--      1677 2016-12-08 06:20 stomp.installation.html
-rw-r--r--      4528 2016-12-08 06:19 function.sqlite-close.html
-rw-r--r--      4479 2016-12-08 06:19 function.msql-list-fields.html
-rw-r--r--     10514 2016-12-08 06:18 language.pseudo-types.html
-rw-r--r--     53580 2016-12-08 06:20 book.solr.html
-rw-r--r--      1372 2016-12-08 06:20 ctype.configuration.html
-rw-r--r--      6951 2016-12-08 06:19 appenditerator.getiteratorindex.html
-rw-r--r--      5112 2016-12-08 06:19 gearmanclient.addserver.html
-rw-r--r--      2660 2016-12-08 06:18 function.newt-listbox-get-selection.html
-rw-r--r--     27513 2016-12-08 06:19 eventlistener.construct.html
-rw-r--r--      4739 2016-12-08 06:19 class.mongogridfscursor.html
-rw-r--r--      8514 2016-12-08 06:20 ds-map.ksorted.html
-rw-r--r--     10362 2016-12-08 06:20 quickhashstringinthash.loadfromfile.html
-rw-r--r--      3737 2016-12-08 06:19 function.sybase-min-error-severity.html
-rw-r--r--      3541 2016-12-08 06:19 function.imageaffine.html
-rw-r--r--      6984 2016-12-08 06:19 yaf-route-simple.assemble.html
-rw-r--r--      8877 2016-12-08 06:19 imagickdraw.setclippath.html
-rw-r--r--      6619 2016-12-08 06:19 intlchar.isulowercase.html
-rw-r--r--      6201 2016-12-08 06:20 function.ctype-cntrl.html
-rw-r--r--     11580 2016-12-08 06:19 class.yaf-router.html
-rw-r--r--      5543 2016-12-08 06:19 function.fann-set-callback.html
-rw-r--r--      3826 2016-12-08 06:20 function.use-soap-error-handler.html
-rw-r--r--      1825 2016-12-08 06:19 function.read-exif-data.html
-rw-r--r--      3780 2016-12-08 06:19 function.trader-adosc.html
-rw-r--r--      2319 2016-12-08 06:19 imagick.getimagedelay.html
-rw-r--r--      2690 2016-12-08 06:18 id3v2attachedpictureframe.getdescription.html
-rw-r--r--      2543 2016-12-08 06:20 varnishadmin.ban.html
-rw-r--r--      6239 2016-12-08 06:18 function.wincache-ucache-inc.html
-rw-r--r--      8684 2016-12-08 06:19 imagick.adaptiveresizeimage.html
-rw-r--r--      5888 2016-12-08 06:19 yaf-response-abstract.appendbody.html
-rw-r--r--      2265 2016-12-08 06:20 ui-controls-radio.onselected.html
-rw-r--r--      6086 2016-12-08 06:19 class.overflowexception.html
-rw-r--r--      5914 2016-12-08 06:19 class.yaf-registry.html
-rw-r--r--      2390 2016-12-08 06:19 imagickdraw.poppattern.html
-rw-r--r--      3891 2016-12-08 06:19 function.stats-rand-gen-noncentral-f.html
-rw-r--r--      2573 2016-12-08 06:19 harudoc.reseterror.html
-rw-r--r--      2394 2016-12-08 06:19 ref.fam.html
-rw-r--r--      7627 2016-12-08 06:18 phar.configuration.html
-rw-r--r--      2583 2016-12-08 06:19 mbstring.installation.html
-rw-r--r--      7326 2016-12-08 06:19 function.maxdb-stat.html
-rw-r--r--      5126 2016-12-08 06:20 simplexmlelement.count.html
-rw-r--r--      6156 2016-12-08 06:19 class.badfunctioncallexception.html
-rw-r--r--      2011 2016-12-08 06:18 book.memtrack.html
-rw-r--r--      9556 2016-12-08 06:18 function.cubrid-set-drop.html
-rw-r--r--      3773 2016-12-08 06:19 expect.constants.html
-rw-r--r--      7080 2016-12-08 06:20 reflectiontype.isbuiltin.html
-rw-r--r--      7154 2016-12-08 06:19 function.pg-last-oid.html
-rw-r--r--      2924 2016-12-08 06:20 sessionhandlerinterface.close.html
-rw-r--r--      2424 2016-12-08 06:19 imagick.getsizeoffset.html
-rw-r--r--      1351 2016-12-08 06:19 yaml.callbacks.html
-rw-r--r--      1317 2016-12-08 06:19 exec.constants.html
-rw-r--r--      2941 2016-12-08 06:19 gearmanjob.unique.html
-rw-r--r--      2476 2016-12-08 06:20 function.rrd-last.html
-rw-r--r--      2882 2016-12-08 06:20 ref.apache.html
-rw-r--r--      3052 2016-12-08 06:20 rrdcreator.addarchive.html
-rw-r--r--      2356 2016-12-08 06:19 imagickpixel.getindex.html
-rw-r--r--      2748 2016-12-08 06:19 hwapi.content-read.html
-rw-r--r--      8931 2016-12-08 06:19 imagickdraw.translate.html
-rw-r--r--      4726 2016-12-08 06:19 cond.destroy.html
-rw-r--r--      7029 2016-12-08 06:19 function.chown.html
-rw-r--r--      4139 2016-12-08 06:19 syncmutex.unlock.html
-rw-r--r--      7884 2016-12-08 06:19 fdf.examples.html
-rw-r--r--      1566 2016-12-08 06:19 mongo.batch.html
-rw-r--r--      3345 2016-12-08 06:19 function.trader-cdlclosingmarubozu.html
-rw-r--r--      1516 2016-12-08 06:18 security.sessions.html
-rw-r--r--      2954 2016-12-08 06:20 solrcollapsefunction.setfield.html
-rw-r--r--      3767 2016-12-08 06:18 function.openssl-error-string.html
-rw-r--r--      4924 2016-12-08 06:19 cairopattern.getmatrix.html
-rw-r--r--     11619 2016-12-08 06:18 function.db2-fetch-array.html
-rw-r--r--      5869 2016-12-08 06:19 mongodb-driver-server.getinfo.html
-rw-r--r--      2587 2016-12-08 06:20 ui-controls-label.gettext.html
-rw-r--r--      2169 2016-12-08 06:19 function.ocicolumnisnull.html
-rw-r--r--      3194 2016-12-08 06:20 varnish.example.log.html
-rw-r--r--      1510 2016-12-08 06:19 intro.proctitle.html
-rw-r--r--      9122 2016-12-08 06:18 pharfileinfo.setmetadata.html
-rw-r--r--      8842 2016-12-08 06:20 ds-vector.reduce.html
-rw-r--r--      1678 2016-12-08 06:20 ds-stack.count.html
-rw-r--r--      8236 2016-12-08 06:19 function.mkdir.html
-rw-r--r--      4467 2016-12-08 06:19 function.cairo-ps-surface-get-eps.html
-rw-r--r--      1856 2016-12-08 06:19 function.msql-createdb.html
-rw-r--r--      3369 2016-12-08 06:18 function.dbplus-freealllocks.html
-rw-r--r--      2808 2016-12-08 06:18 id3v2attachedpictureframe.setpicture.html
-rw-r--r--      4314 2016-12-08 06:18 function.return.html
-rw-r--r--      3138 2016-12-08 06:19 tokyotyranttable.setindex.html
-rw-r--r--     10400 2016-12-08 06:19 hwapi.object.html
-rw-r--r--      8621 2016-12-08 06:19 imagick.annotateimage.html
-rw-r--r--      4484 2016-12-08 06:19 eventbuffer.readfrom.html
-rw-r--r--      4207 2016-12-08 06:19 class.mysqli-warning.html
-rw-r--r--      6760 2016-12-08 06:20 domnode.removechild.html
-rw-r--r--      2376 2016-12-08 06:18 iterator.current.html
-rw-r--r--      3783 2016-12-08 06:19 gearmanclient.runtasks.html
-rw-r--r--      1981 2016-12-08 06:18 constants.newt.sense-flags.html
-rw-r--r--      2807 2016-12-08 06:20 solrcollapsefunction.gethint.html
-rw-r--r--     69960 2016-12-08 06:18 function.db2-set-option.html
-rw-r--r--      6131 2016-12-08 06:19 function.mb-ereg.html
-rw-r--r--      3085 2016-12-08 06:19 harudestination.setfitbh.html
-rw-r--r--      4944 2016-12-08 06:19 yaf-application.getconfig.html
-rw-r--r--      3086 2016-12-08 06:19 intltimezone.createenumeration.html
-rw-r--r--      6884 2016-12-08 06:19 intlcalendar.todatetime.html
-rw-r--r--      3059 2016-12-08 06:19 imagick.cropthumbnailimage.html
-rw-r--r--      3771 2016-12-08 06:18 book.dba.html
-rw-r--r--     13064 2016-12-08 06:19 imagick.forwardfouriertransformimage.html
-rw-r--r--     10531 2016-12-08 06:20 function.xml-set-object.html
-rw-r--r--      5122 2016-12-08 06:20 function.xml-set-default-handler.html
-rw-r--r--      7431 2016-12-08 06:20 function.array-combine.html
-rw-r--r--      5112 2016-12-08 06:19 function.mysqlnd-qc-get-available-handlers.html
-rw-r--r--      7916 2016-12-08 06:18 function.openssl-spki-new.html
-rw-r--r--      2542 2016-12-08 06:19 harufont.getfontname.html
-rw-r--r--      1517 2016-12-08 06:20 intro.rrd.html
-rw-r--r--      4547 2016-12-08 06:20 ds-deque.construct.html
-rw-r--r--      4600 2016-12-08 06:20 ds-vector.allocate.html
-rw-r--r--      1713 2016-12-08 06:20 internals2.counter.examples.html
-rw-r--r--      4148 2016-12-08 06:18 generator.getreturn.html
-rw-r--r--     11546 2016-12-08 06:19 mongodb.tutorial.library.html
-rw-r--r--      4610 2016-12-08 06:19 function.getcwd.html
-rw-r--r--      4419 2016-12-08 06:20 ds-deque.copy.html
-rw-r--r--      6876 2016-12-08 06:19 intlchar.islower.html
-rw-r--r--      3041 2016-12-08 06:19 evtimer.set.html
-rw-r--r--      1505 2016-12-08 06:19 ref.intl.idn.html
-rw-r--r--      5668 2016-12-08 06:20 win32ps.examples-process.html
-rw-r--r--      1566 2016-12-08 06:18 intro.cubrid.html
-rw-r--r--      2738 2016-12-08 06:18 function.openal-buffer-create.html
-rw-r--r--      7292 2016-12-08 06:20 function.svn-checkout.html
-rw-r--r--      2936 2016-12-08 06:20 internals2.opcodes.assign-bw-and.html
-rw-r--r--      1379 2016-12-08 06:18 radius.configuration.html
-rw-r--r--      7449 2016-12-08 06:19 function.basename.html
-rw-r--r--      6671 2016-12-08 06:20 function.method-exists.html
-rw-r--r--      7008 2016-12-08 06:19 cairocontext.relcurveto.html
-rw-r--r--      3433 2016-12-08 06:19 function.msql-affected-rows.html
-rw-r--r--      7580 2016-12-08 06:18 phardata.decompress.html
-rw-r--r--      2565 2016-12-08 06:19 yaf-exception.getprevious.html
-rw-r--r--      3656 2016-12-08 06:19 harudoc.readfromstream.html
-rw-r--r--      2657 2016-12-08 06:19 yaf-response-abstract.tostring.html
-rw-r--r--     13126 2016-12-08 06:19 class.mongocommandcursor.html
-rw-r--r--      4481 2016-12-08 06:20 book.mnogosearch.html
-rw-r--r--      1713 2016-12-08 06:19 intro.yaf.html
-rw-r--r--     22313 2016-12-08 06:19 class.filesystemiterator.html
-rw-r--r--      1557 2016-12-08 06:18 ingres.setup.html
-rw-r--r--      2082 2016-12-08 06:19 function.pdf-fill.html
-rw-r--r--      3072 2016-12-08 06:19 yaf-view-interface.display.html
-rw-r--r--      3227 2016-12-08 06:19 streamwrapper.stream-truncate.html
-rw-r--r--      5933 2016-12-08 06:19 mysql.examples-basic.html
-rw-r--r--      3332 2016-12-08 06:19 function.gmp-rootrem.html
-rw-r--r--      2568 2016-12-08 06:18 function.odbc-prepare.html
-rw-r--r--      3711 2016-12-08 06:20 function.apache-reset-timeout.html
-rw-r--r--      8851 2016-12-08 06:18 class.exception.html
-rw-r--r--      2668 2016-12-08 06:19 imagick.getquantumrange.html
-rw-r--r--      1530 2016-12-08 06:20 swish.setup.html
-rw-r--r--     26016 2016-12-08 06:18 class.ziparchive.html
-rw-r--r--      2686 2016-12-08 06:19 function.oci-cancel.html
-rw-r--r--      2350 2016-12-08 06:19 function.pdf-begin-template-ext.html
-rw-r--r--      2841 2016-12-08 06:20 reflectionfunction.getclosure.html
-rw-r--r--      2805 2016-12-08 06:19 cachingiterator.offsetunset.html
-rw-r--r--      4910 2016-12-08 06:19 function.gupnp-context-get-host-ip.html
-rw-r--r--      2602 2016-12-08 06:19 yaf-request-simple.getpost.html
-rw-r--r--     11299 2016-12-08 06:19 yaf.configuration.html
-rw-r--r--      6252 2016-12-08 06:20 function.strlen.html
-rw-r--r--      7186 2016-12-08 06:20 stomp.setreadtimeout.html
-rw-r--r--      2219 2016-12-08 06:20 svm.construct.html
-rw-r--r--     26070 2016-12-08 06:18 install.fpm.configuration.html
-rw-r--r--      8563 2016-12-08 06:19 mysqlnduhconnection.getlastmessage.html
-rw-r--r--      4594 2016-12-08 06:18 scream.examples-simple.html
-rw-r--r--      6098 2016-12-08 06:19 splqueue.construct.html
-rw-r--r--      3601 2016-12-08 06:20 domelement.getelementsbytagname.html
-rw-r--r--      1860 2016-12-08 06:19 function.recode.html
-rw-r--r--      3148 2016-12-08 06:19 recursivedirectoryiterator.haschildren.html
-rw-r--r--      2927 2016-12-08 06:19 function.fann-get-total-neurons.html
-rw-r--r--      5523 2016-12-08 06:19 gearmanclient.setclientcallback.html
-rw-r--r--      4574 2016-12-08 06:18 function.error-clear-last.html
-rw-r--r--      3018 2016-12-08 06:19 mongodate.tostring.html
-rw-r--r--      8811 2016-12-08 06:20 ds-deque.reduce.html
-rw-r--r--      6125 2016-12-08 06:19 syncsemaphore.construct.html
-rw-r--r--      6127 2016-12-08 06:20 book.sockets.html
-rw-r--r--      1358 2016-12-08 06:20 xml.configuration.html
-rw-r--r--      1574 2016-12-08 06:19 vpopmail.setup.html
-rw-r--r--      6091 2016-12-08 06:19 intlchar.isidstart.html
-rw-r--r--      7528 2016-12-08 06:19 function.escapeshellcmd.html
-rw-r--r--      2481 2016-12-08 06:19 yaf-registry.del.html
-rw-r--r--      3267 2016-12-08 06:19 harudoc.loadjpeg.html
-rw-r--r--      1362 2016-12-08 06:19 math.installation.html
-rw-r--r--      3923 2016-12-08 06:20 function.com-message-pump.html
-rw-r--r--      1379 2016-12-08 06:18 dbplus.configuration.html
-rw-r--r--      2868 2016-12-08 06:19 datetime.constants.html
-rw-r--r--      3134 2016-12-08 06:18 apcuiterator.current.html
-rw-r--r--      3686 2016-12-08 06:19 limititerator.rewind.html
-rw-r--r--     10033 2016-12-08 06:18 pdostatement.bindvalue.html
-rw-r--r--      3102 2016-12-08 06:19 gmagick.getimageblueprimary.html
-rw-r--r--      2469 2016-12-08 06:20 ui-area.scrollto.html
-rw-r--r--      2542 2016-12-08 06:20 ui-controls-multilineentry.setreadonly.html
-rw-r--r--      7435 2016-12-08 06:18 function.apc-cache-info.html
-rw-r--r--     16417 2016-12-08 06:18 function.cubrid-commit.html
-rw-r--r--      4926 2016-12-08 06:20 function.variant-int.html
-rw-r--r--      8431 2016-12-08 06:19 function.urlencode.html
-rw-r--r--      4272 2016-12-08 06:19 splfileobject.ftell.html
-rw-r--r--      1360 2016-12-08 06:18 readline.resources.html
-rw-r--r--      2573 2016-12-08 06:20 varnishadmin.setcompat.html
-rw-r--r--      5905 2016-12-08 06:19 directoryiterator.isfile.html
-rw-r--r--      6458 2016-12-08 06:19 function.mb-convert-variables.html
-rw-r--r--      2919 2016-12-08 06:19 function.trader-typprice.html
-rw-r--r--      8404 2016-12-08 06:20 function.strstr.html
-rw-r--r--     13337 2016-12-08 06:18 wrappers.ssh2.html
-rw-r--r--     15979 2016-12-08 06:19 class.tokyotyrantiterator.html
-rw-r--r--      4370 2016-12-08 06:19 function.sqlite-valid.html
-rw-r--r--      3309 2016-12-08 06:18 ref.dbase.html
-rw-r--r--      2979 2016-12-08 06:20 solrquery.setfacetdategap.html
-rw-r--r--      3380 2016-12-08 06:19 function.trader-cdlrisefall3methods.html
-rw-r--r--      2055 2016-12-08 06:19 swffont.getleading.html
-rw-r--r--      5348 2016-12-08 06:20 reflectionmethod.getdeclaringclass.html
-rw-r--r--      3044 2016-12-08 06:20 zmqsocket.bind.html
-rw-r--r--     21313 2016-12-08 06:19 function.json-decode.html
-rw-r--r--      2648 2016-12-08 06:19 harupage.closepath.html
-rw-r--r--      1847 2016-12-08 06:19 function.pdf-open-jpeg.html
-rw-r--r--      1582 2016-12-08 06:19 mysqlnd-qc.setup.html
-rw-r--r--      1600 2016-12-08 06:20 migration55.extensions-other.html
-rw-r--r--      5022 2016-12-08 06:20 sam.messages.html
-rw-r--r--      6824 2016-12-08 06:18 function.radius-get-tagged-attr-data.html
-rw-r--r--      7687 2016-12-08 06:19 mongo.tutorial.findone.html
-rw-r--r--      4954 2016-12-08 06:19 function.ingres-field-type.html
-rw-r--r--      3089 2016-12-08 06:19 imagick.setresourcelimit.html
-rw-r--r--      3838 2016-12-08 06:19 cairogradientpattern.getextend.html
-rw-r--r--      7556 2016-12-08 06:19 function.image-type-to-mime-type.html
-rw-r--r--      1358 2016-12-08 06:19 lua.configuration.html
-rw-r--r--      3960 2016-12-08 06:19 class.mongodb-bson-utcdatetime.html
-rw-r--r--      2962 2016-12-08 06:19 eventhttprequest.getinputbuffer.html
-rw-r--r--      4323 2016-12-08 06:18 openssl.certparams.html
-rw-r--r--      2925 2016-12-08 06:19 function.fann-run.html
-rw-r--r--      3204 2016-12-08 06:19 mysqli-driver.embedded-server-start.html
-rw-r--r--      3933 2016-12-08 06:19 function.ftok.html
-rw-r--r--      2209 2016-12-08 06:19 function.pdf-delete-table.html
-rw-r--r--      2586 2016-12-08 06:19 function.pdf-fit-textline.html
-rw-r--r--      8165 2016-12-08 06:19 function.mysql-drop-db.html
-rw-r--r--      6599 2016-12-08 06:20 ref.xmlwriter.html
-rw-r--r--      1667 2016-12-08 06:19 lapack.installation.html
-rw-r--r--     35170 2016-12-08 06:19 book.yaf.html
-rw-r--r--      2240 2016-12-08 06:19 ming.install.html
-rw-r--r--      7207 2016-12-08 06:19 function.pg-copy-from.html
-rw-r--r--      6391 2016-12-08 06:19 mongoclient.setreadpreference.html
-rw-r--r--      3613 2016-12-08 06:19 imagick.getimageartifact.html
-rw-r--r--      2753 2016-12-08 06:19 hwapi.move.html
-rw-r--r--      5124 2016-12-08 06:20 sdo.examples-basic.html
-rw-r--r--      1386 2016-12-08 06:20 varnish.configuration.html
-rw-r--r--      2363 2016-12-08 06:18 function.newt-cursor-off.html
-rw-r--r--      3856 2016-12-08 06:19 function.maxdb-more-results.html
-rw-r--r--      2617 2016-12-08 06:19 function.bson-decode.html
-rw-r--r--      2581 2016-12-08 06:20 solrdocument.offsetunset.html
-rw-r--r--     15410 2016-12-08 06:19 yaf-route-rewrite.construct.html
-rw-r--r--      5535 2016-12-08 06:19 class.mongogridfsfile.html
-rw-r--r--      3957 2016-12-08 06:19 function.expm1.html
-rw-r--r--      6562 2016-12-08 06:19 mongodb-driver-readconcern.getlevel.html
-rw-r--r--      2001 2016-12-08 06:19 intro.haru.html
-rw-r--r--      4750 2016-12-08 06:19 imagick.shaveimage.html
-rw-r--r--      1393 2016-12-08 06:19 vpopmail.configuration.html
-rw-r--r--      1621 2016-12-08 06:20 win32service.setup.html
-rw-r--r--      1432 2016-12-08 06:19 yaml.requirements.html
-rw-r--r--      9012 2016-12-08 06:18 function.wincache-fcache-fileinfo.html
-rw-r--r--      7328 2016-12-08 06:19 function.geoip-region-name-by-code.html
-rw-r--r--      3740 2016-12-08 06:19 cairoimagesurface.getstride.html
-rw-r--r--      8011 2016-12-08 06:19 intlcalendar.setfirstdayofweek.html
-rw-r--r--      3380 2016-12-08 06:19 function.ldap-escape.html
-rw-r--r--      3705 2016-12-08 06:20 function.variant-neg.html
-rw-r--r--      1590 2016-12-08 06:19 net-gopher.setup.html
-rw-r--r--      2872 2016-12-08 06:20 internals2.opcodes.bw-not.html
-rw-r--r--      2468 2016-12-08 06:19 function.imageinterlace.html
-rw-r--r--      3473 2016-12-08 06:19 function.acos.html
-rw-r--r--     10726 2016-12-08 06:18 function.db2-prepare.html
-rw-r--r--      6619 2016-12-08 06:19 function.pg-lo-read.html
-rw-r--r--      3563 2016-12-08 06:20 function.socket-recvmsg.html
-rw-r--r--      4738 2016-12-08 06:18 function.ncurses-color-content.html
-rw-r--r--      1367 2016-12-08 06:18 bcompiler.resources.html
-rw-r--r--     12790 2016-12-08 06:19 collator.setstrength.html
-rw-r--r--      4041 2016-12-08 06:19 class.emptyiterator.html
-rw-r--r--      3435 2016-12-08 06:19 gearmanjob.sendwarning.html
-rw-r--r--      4170 2016-12-08 06:19 function.ldap-modify.html
-rw-r--r--      4470 2016-12-08 06:19 function.fann-create-standard-array.html
-rw-r--r--      7366 2016-12-08 06:18 phar.addfromstring.html
-rw-r--r--     10915 2016-12-08 06:19 function.mssql-field-seek.html
-rw-r--r--      1593 2016-12-08 06:19 datetime.setup.html
-rw-r--r--      4028 2016-12-08 06:20 domnode.c14nfile.html
-rw-r--r--      3843 2016-12-08 06:20 internals2.opcodes.jmp.html
-rw-r--r--      5786 2016-12-08 06:20 regexp.reference.subpatterns.html
-rw-r--r--      5364 2016-12-08 06:18 function.gzuncompress.html
-rw-r--r--      2585 2016-12-08 06:20 com.examples.arrays.html
-rw-r--r--      2711 2016-12-08 06:20 solrdocument.get.html
-rw-r--r--      6312 2016-12-08 06:19 mongodb-driver-writeerror.getcode.html
-rw-r--r--      2715 2016-12-08 06:19 imagick.setimagescene.html
-rw-r--r--      9943 2016-12-08 06:19 tokyotyrantquery.valid.html
-rw-r--r--      5893 2016-12-08 06:19 function.recode-file.html
-rw-r--r--      2228 2016-12-08 06:18 function.odbc-rollback.html
-rw-r--r--      3255 2016-12-08 06:19 function.fann-get-rprop-delta-min.html
-rw-r--r--      8476 2016-12-08 06:19 ref.mysql.html
-rw-r--r--      9550 2016-12-08 06:19 function.pg-update.html
-rw-r--r--      1372 2016-12-08 06:19 cyrus.configuration.html
-rw-r--r--      2259 2016-12-08 06:19 function.ldap-dn2ufn.html
-rw-r--r--      1353 2016-12-08 06:18 openssl.resources.html
-rw-r--r--      6713 2016-12-08 06:20 class.ui-controls-button.html
-rw-r--r--      2414 2016-12-08 06:20 ui-controls-entry.isreadonly.html
-rw-r--r--      3900 2016-12-08 06:19 yaf-response-abstract.clearbody.html
-rw-r--r--      3136 2016-12-08 06:20 stomp.hasframe.html
-rw-r--r--      9515 2016-12-08 06:18 intro-whatcando.html
-rw-r--r--     11311 2016-12-08 06:19 function.eio-open.html
-rw-r--r--      9645 2016-12-08 06:20 function.rtrim.html
-rw-r--r--      6951 2016-12-08 06:20 migration56.changed-functions.html
-rw-r--r--      4372 2016-12-08 06:19 mysqli.init.html
-rw-r--r--      8527 2016-12-08 06:20 internals2.structure.lifecycle.html
-rw-r--r--      2610 2016-12-08 06:20 ref.ctype.html
-rw-r--r--      4516 2016-12-08 06:19 function.msg-set-queue.html
-rw-r--r--      3490 2016-12-08 06:18 function.ibase-affected-rows.html
-rw-r--r--     39832 2016-12-08 06:19 book.cairo.html
-rw-r--r--      2717 2016-12-08 06:19 memcached.installation.html
-rw-r--r--      8312 2016-12-08 06:19 mongodb.getcollectioninfo.html
-rw-r--r--      2765 2016-12-08 06:19 eventhttpconnection.getbase.html
-rw-r--r--      2846 2016-12-08 06:19 gmagick.setimagegamma.html
-rw-r--r--      4312 2016-12-08 06:19 intlcalendar.getminimum.html
-rw-r--r--      5249 2016-12-08 06:19 memcached.getdelayedbykey.html
-rw-r--r--      1515 2016-12-08 06:18 pdo.setup.html
-rw-r--r--      6821 2016-12-08 06:19 function.mysql-get-proto-info.html
-rw-r--r--      4562 2016-12-08 06:19 function.ceil.html
-rw-r--r--      8744 2016-12-08 06:18 phar.buildfromdirectory.html
-rw-r--r--      3805 2016-12-08 06:19 function.fdf-set-version.html
-rw-r--r--     35873 2016-12-08 06:19 function.mb-decode-numericentity.html
-rw-r--r--      8057 2016-12-08 06:19 function.fnmatch.html
-rw-r--r--      3135 2016-12-08 06:18 install.pecl.static.html
-rw-r--r--      8263 2016-12-08 06:20 regexp.reference.repetition.html
-rw-r--r--      5944 2016-12-08 06:19 ref.msql.html
-rw-r--r--      4351 2016-12-08 06:19 function.gupnp-context-new.html
-rw-r--r--      2625 2016-12-08 06:19 ref.mqseries.html
-rw-r--r--      6302 2016-12-08 06:18 function.mcrypt-get-iv-size.html
-rw-r--r--      3118 2016-12-08 06:19 gmagick.readimageblob.html
-rw-r--r--      2578 2016-12-08 06:20 internals2.opcodes.ext-stmt.html
-rw-r--r--      4583 2016-12-08 06:19 function.iptcparse.html
-rw-r--r--      7956 2016-12-08 06:20 function.wordwrap.html
-rw-r--r--      2672 2016-12-08 06:19 hwapi.user.html
-rw-r--r--      3348 2016-12-08 06:19 imagick.combineimages.html
-rw-r--r--      2187 2016-12-08 06:19 oci8.configure.html
-rw-r--r--      3104 2016-12-08 06:18 function.mcrypt-enc-is-block-algorithm-mode.html
-rw-r--r--      2810 2016-12-08 06:19 emptyiterator.key.html
-rw-r--r--      4953 2016-12-08 06:19 function.cairo-matrix-transform-point.html
-rw-r--r--      3317 2016-12-08 06:19 function.trader-cdlengulfing.html
-rw-r--r--      5038 2016-12-08 06:18 function.getenv.html
-rw-r--r--      5439 2016-12-08 06:18 security.variables.html
-rw-r--r--      3235 2016-12-08 06:19 imap.requirements.html
-rw-r--r--      4697 2016-12-08 06:19 class.mongowriteconcernexception.html
-rw-r--r--      2512 2016-12-08 06:19 imagickpixel.setindex.html
-rw-r--r--      2292 2016-12-08 06:19 imagick.getimagecompressionquality.html
-rw-r--r--      6535 2016-12-08 06:19 tokyotyrant.putnr.html
-rw-r--r--     21007 2016-12-08 06:19 fann.constants.html
-rw-r--r--      4598 2016-12-08 06:20 reflectionclass.getextensionname.html
-rw-r--r--      6552 2016-12-08 06:20 simplexmlelement.xpath.html
-rw-r--r--      2703 2016-12-08 06:19 yaf-response-abstract.setredirect.html
-rw-r--r--      7938 2016-12-08 06:19 mongodb-driver-cursor.settypemap.html
-rw-r--r--     18893 2016-12-08 06:19 function.ldap-modify-batch.html
-rw-r--r--      2201 2016-12-08 06:18 tag.gettitle.html
-rw-r--r--      8625 2016-12-08 06:20 function.is-scalar.html
-rw-r--r--      6202 2016-12-08 06:20 book.network.html
-rw-r--r--      5898 2016-12-08 06:19 function.log-write-batch.html
-rw-r--r--      4337 2016-12-08 06:18 wincache.installation.html
-rw-r--r--     27882 2016-12-08 06:18 function.ob-start.html
-rw-r--r--      3114 2016-12-08 06:20 ui-executor.setinterval.html
-rw-r--r--      2519 2016-12-08 06:19 curlfile.setpostfilename.html
-rw-r--r--      6391 2016-12-08 06:20 function.headers-list.html
-rw-r--r--      1333 2016-12-08 06:19 msql.requirements.html
-rw-r--r--     19686 2016-12-08 06:19 mongodb-driver-manager.executebulkwrite.html
-rw-r--r--      2421 2016-12-08 06:19 yaf-loader.construct.html
-rw-r--r--      8486 2016-12-08 06:18 function.cubrid-get-client-info.html
-rw-r--r--      3584 2016-12-08 06:19 callbackfilteriterator.accept.html
-rw-r--r--      4805 2016-12-08 06:19 mongodb-bson-regex.getflags.html
-rw-r--r--      2217 2016-12-08 06:18 tag.getartist.html
-rw-r--r--     20987 2016-12-08 06:20 class.ds-map.html
-rw-r--r--      2056 2016-12-08 06:19 pdf.installation.html
-rw-r--r--      3815 2016-12-08 06:19 mysqlnd.plugin.obtaining.html
-rw-r--r--      8479 2016-12-08 06:19 imagick.frameimage.html
-rw-r--r--      2958 2016-12-08 06:19 intlbreakiterator.getpartsiterator.html
-rw-r--r--      2065 2016-12-08 06:20 history.html
-rw-r--r--     11142 2016-12-08 06:18 function.version-compare.html
-rw-r--r--      2090 2016-12-08 06:19 mongodb.setup.html
-rw-r--r--      2030 2016-12-08 06:19 function.date-interval-format.html
-rw-r--r--     10754 2016-12-08 06:19 function.easter-date.html
-rw-r--r--      4109 2016-12-08 06:18 function.main.html
-rw-r--r--      3095 2016-12-08 06:18 function.ncurses-assume-default-colors.html
-rw-r--r--      3095 2016-12-08 06:19 intro.cairo.html
-rw-r--r--      2996 2016-12-08 06:18 function.m-verifysslcert.html
-rw-r--r--      2227 2016-12-08 06:20 ui-size.getheight.html
-rw-r--r--     11469 2016-12-08 06:19 function.mssql-bind.html
-rw-r--r--      4359 2016-12-08 06:20 class.domnamednodemap.html
-rw-r--r--      3266 2016-12-08 06:20 internals2.counter.function.counter-bump.html
-rw-r--r--      4619 2016-12-08 06:20 function.svn-delete.html
-rw-r--r--      6079 2016-12-08 06:19 function.gregoriantojd.html
-rw-r--r--      2961 2016-12-08 06:19 recursivetreeiterator.enditeration.html
-rw-r--r--      1482 2016-12-08 06:18 crack.resources.html
-rw-r--r--      7287 2016-12-08 06:20 function.var-dump.html
-rw-r--r--      3055 2016-12-08 06:19 multipleiterator.next.html
-rw-r--r--      2235 2016-12-08 06:20 ui-window.setmargin.html
-rw-r--r--      2798 2016-12-08 06:19 function.log10.html
-rw-r--r--      8950 2016-12-08 06:19 function.system.html
-rw-r--r--      5243 2016-12-08 06:18 function.bzcompress.html
-rw-r--r--     12886 2016-12-08 06:19 function.sqlsrv-connect.html
-rw-r--r--      3598 2016-12-08 06:18 function.openal-listener-set.html
-rw-r--r--      4345 2016-12-08 06:20 function.apache-child-terminate.html
-rw-r--r--      4730 2016-12-08 06:18 function.openssl-pkey-export.html
-rw-r--r--      6376 2016-12-08 06:19 arrayobject.ksort.html
-rw-r--r--      1926 2016-12-08 06:20 function.socket-getopt.html
-rw-r--r--      9531 2016-12-08 06:20 class.ui-controls-multilineentry.html
-rw-r--r--      1551 2016-12-08 06:18 oggvorbis.requirements.html
-rw-r--r--     10679 2016-12-08 06:20 function.array-intersect-key.html
-rw-r--r--      6639 2016-12-08 06:20 xsltprocessor.transformtoxml.html
-rw-r--r--      9370 2016-12-08 06:19 class.cairopdfsurface.html
-rw-r--r--     22768 2016-12-08 06:19 book.gmagick.html
-rw-r--r--      6507 2016-12-08 06:20 history.php.related.html
-rw-r--r--      3492 2016-12-08 06:20 reflectionfunctionabstract.getextension.html
-rw-r--r--      4149 2016-12-08 06:20 intro.sdo.html
-rw-r--r--     11281 2016-12-08 06:20 filter.examples.validation.html
-rw-r--r--      7652 2016-12-08 06:19 ref.stream.html
-rw-r--r--      9765 2016-12-08 06:19 function.stream-wrapper-register.html
-rw-r--r--      4256 2016-12-08 06:19 yaf-route-interface.route.html
-rw-r--r--      3164 2016-12-08 06:19 gmagick.separateimagechannel.html
-rw-r--r--      7282 2016-12-08 06:19 function.curl-unescape.html
-rw-r--r--      4123 2016-12-08 06:19 gearmanworker.setid.html
-rw-r--r--      4930 2016-12-08 06:19 splfixedarray.getsize.html
-rw-r--r--      7129 2016-12-08 06:19 mysqlnd.plugin.html
-rw-r--r--      3685 2016-12-08 06:20 internals2.opcodes.assign-dim.html
-rw-r--r--      8633 2016-12-08 06:18 function.db2-foreign-keys.html
-rw-r--r--      4525 2016-12-08 06:19 function.cairo-image-surface-get-format.html
-rw-r--r--      5394 2016-12-08 06:19 splfileobject.setmaxlinelen.html
-rw-r--r--      1293 2016-12-08 06:19 gender.examples.html
-rw-r--r--      2512 2016-12-08 06:19 harufont.getascent.html
-rw-r--r--      2812 2016-12-08 06:19 gmagickdraw.setstrokewidth.html
-rw-r--r--      2460 2016-12-08 06:19 gmagick.flipimage.html
-rw-r--r--      5252 2016-12-08 06:19 function.bccomp.html
-rw-r--r--      3046 2016-12-08 06:19 function.ldap-close.html
-rw-r--r--      4671 2016-12-08 06:19 function.cairo-scaled-font-get-font-matrix.html
-rw-r--r--      4096 2016-12-08 06:19 function.sqlite-prev.html
-rw-r--r--      9629 2016-12-08 06:20 solrclient.getbyids.html
-rw-r--r--      8844 2016-12-08 06:19 function.mysql-ping.html
-rw-r--r--      3244 2016-12-08 06:19 gearmanjob.senddata.html
-rw-r--r--      4996 2016-12-08 06:19 image.installation.html
-rw-r--r--     10569 2016-12-08 06:18 functions.user-defined.html
-rw-r--r--      6203 2016-12-08 06:19 mongocollection.createdbref.html
-rw-r--r--      7172 2016-12-08 06:19 intlchar.charname.html
-rw-r--r--      4189 2016-12-08 06:19 harupage.curveto.html
-rw-r--r--      4719 2016-12-08 06:19 cairoimagesurface.getheight.html
-rw-r--r--      4965 2016-12-08 06:19 cairocontext.showpage.html
-rw-r--r--      7751 2016-12-08 06:19 imagick.sigmoidalcontrastimage.html
-rw-r--r--      7216 2016-12-08 06:19 mysqlnduhconnection.txcommit.html
-rw-r--r--      2847 2016-12-08 06:19 gmagick.getimageredprimary.html
-rw-r--r--      2006 2016-12-08 06:18 intro.ifx.html
-rw-r--r--      3362 2016-12-08 06:19 infiniteiterator.next.html
-rw-r--r--      2342 2016-12-08 06:20 ui-draw-path.newfigure.html
-rw-r--r--      5348 2016-12-08 06:20 solrclient.ping.html
-rw-r--r--      2488 2016-12-08 06:19 gmagick.enhanceimage.html
-rw-r--r--      4213 2016-12-08 06:20 ds-deque.reversed.html
-rw-r--r--      1874 2016-12-08 06:19 function.msql-fieldtable.html
-rw-r--r--     14113 2016-12-08 06:19 mysqlnd-qc.constants.html
-rw-r--r--      8792 2016-12-08 06:19 gearmanclient.jobstatus.html
-rw-r--r--      2571 2016-12-08 06:20 varnishadmin.setident.html
-rw-r--r--      9042 2016-12-08 06:18 function.fbsql-query.html
-rw-r--r--      2422 2016-12-08 06:19 yaf-session.construct.html
-rw-r--r--      2027 2016-12-08 06:20 migration51.integer-parameters.html
-rw-r--r--      3092 2016-12-08 06:20 function.yp-all.html
-rw-r--r--      2164 2016-12-08 06:19 function.pdf-closepath-stroke.html
-rw-r--r--      1361 2016-12-08 06:20 classkit.requirements.html
-rw-r--r--      3616 2016-12-08 06:18 mcve.installation.html
-rw-r--r--      1353 2016-12-08 06:20 varnish.resources.html
-rw-r--r--      9609 2016-12-08 06:19 function.maxdb-num-fields.html
-rw-r--r--      5796 2016-12-08 06:20 oauthprovider.tokenhandler.html
-rw-r--r--      1641 2016-12-08 06:20 wddx.installation.html
-rw-r--r--      2349 2016-12-08 06:19 swfmovie.addfont.html
-rw-r--r--      8404 2016-12-08 06:19 mbstring.overload.html
-rw-r--r--      8142 2016-12-08 06:20 reflectionclass.hasmethod.html
-rw-r--r--      2415 2016-12-08 06:19 eventbase.reinit.html
-rw-r--r--      8893 2016-12-08 06:19 mongocursor.setflag.html
-rw-r--r--      4019 2016-12-08 06:19 splenum.getconstlist.html
-rw-r--r--      5309 2016-12-08 06:19 function.escapeshellarg.html
-rw-r--r--      6845 2016-12-08 06:18 function.db2-conn-error.html
-rw-r--r--      4272 2016-12-08 06:19 function.fdf-set-javascript-action.html
-rw-r--r--      4548 2016-12-08 06:19 function.cairo-font-options-get-antialias.html
-rw-r--r--      4256 2016-12-08 06:19 function.msql-list-tables.html
-rw-r--r--      2501 2016-12-08 06:19 function.trader-sinh.html
-rw-r--r--     16287 2016-12-08 06:20 migration55.new-features.html
-rw-r--r--      2106 2016-12-08 06:19 function.trader-errno.html
-rw-r--r--      4465 2016-12-08 06:19 function.imap-timeout.html
-rw-r--r--      3315 2016-12-08 06:20 solrobject.construct.html
-rw-r--r--      2981 2016-12-08 06:19 function.fann-length-train-data.html
-rw-r--r--      2194 2016-12-08 06:20 ui-controls-spin.getvalue.html
-rw-r--r--      1365 2016-12-08 06:19 judy.configuration.html
-rw-r--r--      4550 2016-12-08 06:19 intl.examples.basic.html
-rw-r--r--      3862 2016-12-08 06:19 mongo.context.html
-rw-r--r--      2692 2016-12-08 06:19 function.trader-tema.html
-rw-r--r--      7072 2016-12-08 06:18 function.wincache-rplist-meminfo.html
-rw-r--r--      4435 2016-12-08 06:19 function.cairo-pattern-get-rgba.html
-rw-r--r--      3379 2016-12-08 06:20 function.yaz-schema.html
-rw-r--r--      2772 2016-12-08 06:20 solrquery.getfacetdateend.html
-rw-r--r--      2259 2016-12-08 06:19 curlfile.getmimetype.html
-rw-r--r--      2561 2016-12-08 06:19 yaf-application.getappdirectory.html
-rw-r--r--      2934 2016-12-08 06:19 arrayiterator.getflags.html
-rw-r--r--      2649 2016-12-08 06:20 reference.pcre.pattern.syntax.html
-rw-r--r--      6797 2016-12-08 06:19 class.mongodb-driver-exception-runtimeexception.html
-rw-r--r--     10143 2016-12-08 06:19 mysqlnduhconnection.setserveroption.html
-rw-r--r--      1390 2016-12-08 06:20 funchand.installation.html
-rw-r--r--      1714 2016-12-08 06:19 mysqli.requirements.html
-rw-r--r--      7522 2016-12-08 06:18 control-structures.elseif.html
-rw-r--r--      8304 2016-12-08 06:19 function.gmdate.html
-rw-r--r--      9236 2016-12-08 06:20 domimplementation.createdocumenttype.html
-rw-r--r--      2864 2016-12-08 06:20 solrquery.getfacetmincount.html
-rw-r--r--      6437 2016-12-08 06:19 function.ftp-size.html
-rw-r--r--      6230 2016-12-08 06:20 class.ui-exception-invalidargumentexception.html
-rw-r--r--      3008 2016-12-08 06:20 function.filter-has-var.html
-rw-r--r--      6832 2016-12-08 06:19 gnupg.examples-clearsign.html
-rw-r--r--      2478 2016-12-08 06:19 gearmantask.isknown.html
-rw-r--r--      5723 2016-12-08 06:18 function.db2-close.html
-rw-r--r--      1785 2016-12-08 06:19 ref.parsekit.html
-rw-r--r--      1516 2016-12-08 06:19 eio.setup.html
-rw-r--r--      9377 2016-12-08 06:19 intldateformatter.geterrormessage.html
-rw-r--r--      5764 2016-12-08 06:19 function.mb-strpos.html
-rw-r--r--      6406 2016-12-08 06:19 tokyotyrant.putshl.html
-rw-r--r--      1319 2016-12-08 06:19 ldap.examples.html
-rw-r--r--      4000 2016-12-08 06:20 domelement.setattributenode.html
-rw-r--r--      2417 2016-12-08 06:18 function.ncurses-werase.html
-rw-r--r--      4018 2016-12-08 06:19 cairosvgsurface.versiontostring.html
-rw-r--r--      6934 2016-12-08 06:19 arrayobject.getiteratorclass.html
-rw-r--r--      2656 2016-12-08 06:18 ziparchive.getstatusstring.html
-rw-r--r--      1551 2016-12-08 06:20 xmlrpc.setup.html
-rw-r--r--      5934 2016-12-08 06:19 book.gmp.html
-rw-r--r--      5218 2016-12-08 06:20 samconnection.errno.html
-rw-r--r--      6763 2016-12-08 06:19 tidynode.isasp.html
-rw-r--r--      1313 2016-12-08 06:19 proctitle.requirements.html
-rw-r--r--      3403 2016-12-08 06:20 reflectionproperty.isprotected.html
-rw-r--r--      5003 2016-12-08 06:20 ds-set.merge.html
-rw-r--r--      2645 2016-12-08 06:19 filteriterator.valid.html
-rw-r--r--      5616 2016-12-08 06:19 arrayobject.count.html
-rw-r--r--      1374 2016-12-08 06:19 net-gopher.resources.html
-rw-r--r--      7270 2016-12-08 06:18 function.cubrid-num-rows.html
-rw-r--r--      2671 2016-12-08 06:19 evwatcher.start.html
-rw-r--r--     21028 2016-12-08 06:19 function.oci-close.html
-rw-r--r--     11078 2016-12-08 06:19 json.constants.html
-rw-r--r--      8074 2016-12-08 06:20 class.solrillegalargumentexception.html
-rw-r--r--      2833 2016-12-08 06:19 swfbitmap.getheight.html
-rw-r--r--      2938 2016-12-08 06:19 gearmantask.tasknumerator.html
-rw-r--r--      2741 2016-12-08 06:18 iterator.key.html
-rw-r--r--      7015 2016-12-08 06:19 tokyotyrantiterator.construct.html
-rw-r--r--      2723 2016-12-08 06:19 gearmanjob.workloadsize.html
-rw-r--r--      4282 2016-12-08 06:20 function.get-declared-interfaces.html
-rw-r--r--      3973 2016-12-08 06:19 function.dio-stat.html
-rw-r--r--     11234 2016-12-08 06:19 numberformatter.setsymbol.html
-rw-r--r--      2533 2016-12-08 06:19 function.vpopmail-del-domain-ex.html
-rw-r--r--     32757 2016-12-08 06:19 mongocollection.aggregate.html
-rw-r--r--      2962 2016-12-08 06:19 gmagick.queryformats.html
-rw-r--r--      1582 2016-12-08 06:20 xmlreader.setup.html
-rw-r--r--      2898 2016-12-08 06:20 book.session-pgsql.html
-rw-r--r--      2255 2016-12-08 06:19 function.pdf-create-fieldgroup.html
-rw-r--r--      9209 2016-12-08 06:19 book.mbstring.html
-rw-r--r--      6056 2016-12-08 06:19 function.gnupg-encrypt.html
-rw-r--r--      2158 2016-12-08 06:19 imagick.getcompression.html
-rw-r--r--      1727 2016-12-08 06:20 com.installation.html
-rw-r--r--      3407 2016-12-08 06:19 function.mailparse-msg-parse-file.html
-rw-r--r--      3187 2016-12-08 06:19 mongocommandcursor.next.html
-rw-r--r--      2772 2016-12-08 06:19 gmagickdraw.setfillopacity.html
-rw-r--r--      2109 2016-12-08 06:20 function.ui-draw-text-font-fontfamilies.html
-rw-r--r--      5644 2016-12-08 06:19 function.gmp-strval.html
-rw-r--r--      3517 2016-12-08 06:19 function.ps-stroke.html
-rw-r--r--      3748 2016-12-08 06:19 function.trader-stochrsi.html
-rw-r--r--      2321 2016-12-08 06:20 solrobject.destruct.html
-rw-r--r--      7537 2016-12-08 06:18 function.kadm5-init-with-password.html
-rw-r--r--      3146 2016-12-08 06:19 evstat.prev.html
-rw-r--r--     29019 2016-12-08 06:18 function.db2-exec.html
-rw-r--r--      1587 2016-12-08 06:19 memcached.setup.html
-rw-r--r--      3455 2016-12-08 06:18 features.dtrace.introduction.html
-rw-r--r--      3774 2016-12-08 06:20 domelement.hasattribute.html
-rw-r--r--      8316 2016-12-08 06:19 locale.filtermatches.html
-rw-r--r--      1455 2016-12-08 06:20 internals2.counter.resources.html
-rw-r--r--      9313 2016-12-08 06:20 domdocument.savexml.html
-rw-r--r--      1222 2016-12-08 06:18 lzf.constants.html
-rw-r--r--      1609 2016-12-08 06:18 language.basic-syntax.html
-rw-r--r--      2724 2016-12-08 06:19 gmagick.getimagefilename.html
-rw-r--r--      8447 2016-12-08 06:20 class.soapfault.html
-rw-r--r--      5811 2016-12-08 06:18 wrappers.data.html
-rw-r--r--      4989 2016-12-08 06:19 mongoregex.construct.html
-rw-r--r--      2363 2016-12-08 06:20 ui-controls-check.construct.html
-rw-r--r--     10165 2016-12-08 06:18 pharfileinfo.setcompressedgz.html
-rw-r--r--      3116 2016-12-08 06:20 solrdocument.haschilddocuments.html
-rw-r--r--      2746 2016-12-08 06:19 swfaction.construct.html
-rw-r--r--      7776 2016-12-08 06:18 pharfileinfo.delmetadata.html
-rw-r--r--      7980 2016-12-08 06:20 sdo-das-relational.executequery.html
-rw-r--r--      1707 2016-12-08 06:18 oggvorbis.installation.html
-rw-r--r--      2950 2016-12-08 06:20 intro.filter.html
-rw-r--r--      3534 2016-12-08 06:19 tokyotyrantiterator.next.html
-rw-r--r--      3894 2016-12-08 06:19 mysqlnd.install.html
-rw-r--r--      2820 2016-12-08 06:18 function.ncurses-slk-color.html
-rw-r--r--      8299 2016-12-08 06:19 imagick.queryformats.html
-rw-r--r--      3899 2016-12-08 06:20 sca.createdataobject.html
-rw-r--r--      3101 2016-12-08 06:19 function.ps-include-file.html
-rw-r--r--      1972 2016-12-08 06:19 function.pdf-set-horiz-scaling.html
-rw-r--r--      2314 2016-12-08 06:20 ui-controls-grid.setpadded.html
-rw-r--r--      8694 2016-12-08 06:19 function.msql-fetch-object.html
-rw-r--r--      2642 2016-12-08 06:19 yaf-request-abstract.isoptions.html
-rw-r--r--      2450 2016-12-08 06:20 svmmodel.getsvrprobability.html
-rw-r--r--      2750 2016-12-08 06:19 judy.next.html
-rw-r--r--      2971 2016-12-08 06:19 fannconnection.construct.html
-rw-r--r--      2843 2016-12-08 06:19 function.vpopmail-add-domain.html
-rw-r--r--      7684 2016-12-08 06:20 quickhashintstringhash.loadfromstring.html
-rw-r--r--      2706 2016-12-08 06:19 function.ming-setscale.html
-rw-r--r--      3105 2016-12-08 06:19 function.ps-setoverprintmode.html
-rw-r--r--      4040 2016-12-08 06:19 class.mongoint32.html
-rw-r--r--      2339 2016-12-08 06:19 function.pdf-add-thumbnail.html
-rw-r--r--      3866 2016-12-08 06:19 function.fann-scale-input.html
-rw-r--r--      2301 2016-12-08 06:19 function.pdf-create-action.html
-rw-r--r--     16799 2016-12-08 06:20 class.reflectionfunction.html
-rw-r--r--      5067 2016-12-08 06:19 splfileobject.getcsvcontrol.html
-rw-r--r--      5420 2016-12-08 06:18 language.operators.assignment.html
-rw-r--r--      3702 2016-12-08 06:19 haruencoder.getbytetype.html
-rw-r--r--      4856 2016-12-08 06:20 function.str-repeat.html
-rw-r--r--      5472 2016-12-08 06:19 function.pg-untrace.html
-rw-r--r--      1509 2016-12-08 06:18 rar.setup.html
-rw-r--r--      5626 2016-12-08 06:19 directoryiterator.rewind.html
-rw-r--r--      6212 2016-12-08 06:19 memcache.pconnect.html
-rw-r--r--      3254 2016-12-08 06:19 function.stats-cdf-cauchy.html
-rw-r--r--      4747 2016-12-08 06:19 cairocontext.construct.html
-rw-r--r--     12856 2016-12-08 06:18 function.cubrid-lob2-seek64.html
-rw-r--r--      2763 2016-12-08 06:20 zmqdevice.setidletimeout.html
-rw-r--r--      2364 2016-12-08 06:20 function.msession-get.html
-rw-r--r--      2740 2016-12-08 06:20 book.bbcode.html
-rw-r--r--      3218 2016-12-08 06:20 function.ssdeep-fuzzy-compare.html
-rw-r--r--      5825 2016-12-08 06:19 function.eio-poll.html
-rw-r--r--      2644 2016-12-08 06:19 yaf-session.offsetunset.html
-rw-r--r--      4773 2016-12-08 06:19 function.cairo-ps-surface-dsc-comment.html
-rw-r--r--      2717 2016-12-08 06:19 sqlite3.busytimeout.html
-rw-r--r--      2440 2016-12-08 06:20 varnishadmin.getpanic.html
-rw-r--r--      5649 2016-12-08 06:20 ds-vector.find.html
-rw-r--r--      1955 2016-12-08 06:19 function.pdf-set-leading.html
-rw-r--r--      2812 2016-12-08 06:20 oauth.setsslchecks.html
-rw-r--r--      1715 2016-12-08 06:20 migration53.new-stream-filters.html
-rw-r--r--      8732 2016-12-08 06:19 function.mysql-db-name.html
-rw-r--r--      4854 2016-12-08 06:19 gearmanclient.setwarningcallback.html
-rw-r--r--     10931 2016-12-08 06:19 function.sqlsrv-cancel.html
-rw-r--r--     22622 2016-12-08 06:19 ref.fann.html
-rw-r--r--      3701 2016-12-08 06:19 imagick.contraststretchimage.html
-rw-r--r--     10399 2016-12-08 06:18 function.cubrid-fetch.html
-rw-r--r--      6627 2016-12-08 06:19 function.pg-get-notify.html
-rw-r--r--      3287 2016-12-08 06:19 function.trader-cdlkicking.html
-rw-r--r--      5143 2016-12-08 06:19 function.gmp-sign.html
-rw-r--r--      3710 2016-12-08 06:19 msql.configuration.html
-rw-r--r--      8064 2016-12-08 06:20 function.svn-commit.html
-rw-r--r--      7690 2016-12-08 06:18 function.ingres-fetch-object.html
-rw-r--r--      3654 2016-12-08 06:19 cairosurface.getcontent.html
-rw-r--r--      7849 2016-12-08 06:20 class.ui-draw-color.html
-rw-r--r--      8757 2016-12-08 06:19 class.mongoid.html
-rw-r--r--      5066 2016-12-08 06:19 cairocontext.getfontmatrix.html
-rw-r--r--      3055 2016-12-08 06:18 function.ncurses-mvinch.html
-rw-r--r--      2543 2016-12-08 06:18 function.ibase-errcode.html
-rw-r--r--      8950 2016-12-08 06:19 network.constants.html
-rw-r--r--      3193 2016-12-08 06:19 mysqlnduhconnection.shutdownserver.html
-rw-r--r--      4141 2016-12-08 06:19 function.imap-undelete.html
-rw-r--r--      2431 2016-12-08 06:20 function.udm-clear-search-limits.html
-rw-r--r--      3248 2016-12-08 06:19 function.trader-cdlhangingman.html
-rw-r--r--      6684 2016-12-08 06:19 tokyotyrantquery.hint.html
-rw-r--r--      5344 2016-12-08 06:19 function.fdf-add-doc-javascript.html
-rw-r--r--      3130 2016-12-08 06:20 solrdocument.merge.html
-rw-r--r--      3875 2016-12-08 06:18 language.operators.type.html
-rw-r--r--      8008 2016-12-08 06:20 simplexmlelement.children.html
-rw-r--r--      2780 2016-12-08 06:20 xsltprocessor.getsecurityprefs.html
-rw-r--r--      1355 2016-12-08 06:19 ming.configuration.html
-rw-r--r--     16641 2016-12-08 06:18 function.ingres-connect.html
-rw-r--r--      2978 2016-12-08 06:19 gmagick.setfilename.html
-rw-r--r--     23306 2016-12-08 06:19 book.fann.html
-rw-r--r--      8496 2016-12-08 06:20 ds-map.sorted.html
-rw-r--r--     17510 2016-12-08 06:19 function.ingres-unbuffered-query.html
-rw-r--r--      3046 2016-12-08 06:20 zmqsocket.recvmulti.html
-rw-r--r--      5038 2016-12-08 06:19 function.mb-strlen.html
-rw-r--r--      2623 2016-12-08 06:19 yaf-request-abstract.ishead.html
-rw-r--r--      4968 2016-12-08 06:19 ref.gnupg.html
-rw-r--r--      5763 2016-12-08 06:20 book.simplexml.html
-rw-r--r--      8474 2016-12-08 06:19 locale.getdisplaylanguage.html
-rw-r--r--      5788 2016-12-08 06:19 function.gnupg-setarmor.html
-rw-r--r--      7946 2016-12-08 06:20 class.solrclientexception.html
-rw-r--r--      2405 2016-12-08 06:20 ui-controls-radio.setselected.html
-rw-r--r--      2408 2016-12-08 06:20 solrpingresponse.destruct.html
-rw-r--r--      2430 2016-12-08 06:19 function.pdf-show-xy.html
-rw-r--r--      9007 2016-12-08 06:19 ming.examples.swfsprite-basic.html
-rw-r--r--      1871 2016-12-08 06:19 book.mime-magic.html
-rw-r--r--      1593 2016-12-08 06:18 intro.mcrypt.html
-rw-r--r--      7899 2016-12-08 06:20 stomp.construct.html
-rw-r--r--      2877 2016-12-08 06:18 function.ibase-free-result.html
-rw-r--r--      3314 2016-12-08 06:18 phardata.setalias.html
-rw-r--r--      5252 2016-12-08 06:20 migration70.changed-functions.html
-rw-r--r--      2859 2016-12-08 06:20 intro.sockets.html
-rw-r--r--      1530 2016-12-08 06:20 session.examples.html
-rw-r--r--      4960 2016-12-08 06:20 quickhashstringinthash.construct.html
-rw-r--r--      4495 2016-12-08 06:19 function.geoip-domain-by-name.html
-rw-r--r--      2742 2016-12-08 06:19 gmagickdraw.setfont.html
-rw-r--r--      6097 2016-12-08 06:19 intro.image.html
-rw-r--r--      3492 2016-12-08 06:20 about.howtohelp.html
-rw-r--r--      2913 2016-12-08 06:19 yaf-request-abstract.setcontrollername.html
-rw-r--r--      6199 2016-12-08 06:19 class.globiterator.html
-rw-r--r--      2507 2016-12-08 06:19 function.trader-cosh.html
-rw-r--r--      3420 2016-12-08 06:20 reflectionparameter.isdefaultvalueavailable.html
-rw-r--r--      7879 2016-12-08 06:18 phardata.extractto.html
-rw-r--r--      1859 2016-12-08 06:18 function.user-error.html
-rw-r--r--     12631 2016-12-08 06:20 class.ui-window.html
-rw-r--r--      1427 2016-12-08 06:20 ref.solr.html
-rw-r--r--      3132 2016-12-08 06:20 function.snmp-set-oid-numeric-print.html
-rw-r--r--      6751 2016-12-08 06:19 tidynode.istext.html
-rw-r--r--      3013 2016-12-08 06:20 migration56.html
-rw-r--r--      3083 2016-12-08 06:20 solrquery.setfacetoffset.html
-rw-r--r--      2513 2016-12-08 06:20 varnishadmin.disconnect.html
-rw-r--r--      8425 2016-12-08 06:19 imagick.transformimagecolorspace.html
-rw-r--r--      3037 2016-12-08 06:19 imagick.setimageindex.html
-rw-r--r--     11357 2016-12-08 06:18 function.ifx-query.html
-rw-r--r--      5472 2016-12-08 06:19 tokyo-tyrant.installation.html
-rw-r--r--      9251 2016-12-08 06:19 imagick.setimageclipmask.html
-rw-r--r--      3177 2016-12-08 06:20 function.svn-mkdir.html
-rw-r--r--      3333 2016-12-08 06:19 function.stats-dens-pmf-hypergeometric.html
-rw-r--r--      3662 2016-12-08 06:19 function.fann-num-output-train-data.html
-rw-r--r--      7291 2016-12-08 06:19 function.sqlite-changes.html
-rw-r--r--      3764 2016-12-08 06:20 oauthprovider.calltimestampnoncehandler.html
-rw-r--r--      6902 2016-12-08 06:19 function.posix-access.html
-rw-r--r--      4173 2016-12-08 06:20 zookeeper.construct.html
-rw-r--r--      2144 2016-12-08 06:19 function.pdf-delete.html
-rw-r--r--      3333 2016-12-08 06:19 function.ps-get-buffer.html
-rw-r--r--      3127 2016-12-08 06:19 swfbutton.sethit.html
-rw-r--r--      2578 2016-12-08 06:19 datetimeimmutable.setdate.html
-rw-r--r--      3677 2016-12-08 06:19 function.getservbyport.html
-rw-r--r--      3759 2016-12-08 06:18 install.fpm.html
-rw-r--r--      5544 2016-12-08 06:20 function.inet-pton.html
-rw-r--r--      3727 2016-12-08 06:20 internals2.opcodes.do-fcall-by-name.html
-rw-r--r--      4707 2016-12-08 06:19 worker.unstack.html
-rw-r--r--      5257 2016-12-08 06:20 domnode.replacechild.html
-rw-r--r--      2891 2016-12-08 06:19 hwapi.object-remove.html
-rw-r--r--      3348 2016-12-08 06:20 reflectionfunctionabstract.getdoccomment.html
-rw-r--r--      4892 2016-12-08 06:19 function.fdf-open-string.html
-rw-r--r--      6233 2016-12-08 06:19 splfixedarray.fromarray.html
-rw-r--r--      3465 2016-12-08 06:20 internals2.opcodes.jmpnz-ex.html
-rw-r--r--      3476 2016-12-08 06:18 function.dbplus-sql.html
-rw-r--r--      4577 2016-12-08 06:19 function.posix-times.html
-rw-r--r--      6163 2016-12-08 06:19 function.rmdir.html
-rw-r--r--      1588 2016-12-08 06:18 oggvorbis.setup.html
-rw-r--r--      1975 2016-12-08 06:19 mysqlnd-mux.requirements.html
-rw-r--r--      7227 2016-12-08 06:19 mysqlnduhconnection.txrollback.html
-rw-r--r--      1415 2016-12-08 06:19 memcache.resources.html
-rw-r--r--      1605 2016-12-08 06:20 migration53.undeprecated.html
-rw-r--r--     29668 2016-12-08 06:19 eio.examples.html
-rw-r--r--      1452 2016-12-08 06:19 memcached.callbacks.html
-rw-r--r--      8073 2016-12-08 06:19 function.mb-detect-order.html
-rw-r--r--      4800 2016-12-08 06:19 function.cairo-ps-surface-restrict-to-level.html
-rw-r--r--      4093 2016-12-08 06:19 function.inotify-add-watch.html
-rw-r--r--      2700 2016-12-08 06:19 gmagick.getimagecolors.html
-rw-r--r--      3770 2016-12-08 06:19 function.ps-moveto.html
-rw-r--r--      2916 2016-12-08 06:19 harudoc.output.html
-rw-r--r--      4346 2016-12-08 06:18 function.fbsql-change-user.html
-rw-r--r--      8331 2016-12-08 06:18 ref.ibm-db2.html
-rw-r--r--      4039 2016-12-08 06:19 function.tidy-save-config.html
-rw-r--r--      1321 2016-12-08 06:19 spl-types.resources.html
-rw-r--r--      2750 2016-12-08 06:19 function.trader-maxindex.html
-rw-r--r--      3130 2016-12-08 06:20 solrdocument.getchilddocuments.html
-rw-r--r--      3349 2016-12-08 06:19 function.fann-get-sarprop-weight-decay-shift.html
-rw-r--r--      1325 2016-12-08 06:18 apc.resources.html
-rw-r--r--      2638 2016-12-08 06:19 v8jsexception.getjslinenumber.html
-rw-r--r--      2633 2016-12-08 06:19 yaf-config-ini.get.html
-rw-r--r--      2610 2016-12-08 06:19 imagick.getimageredprimary.html
-rw-r--r--      4092 2016-12-08 06:19 mongodb.setslaveokay.html
-rw-r--r--      4371 2016-12-08 06:20 internals2.buildsys.skeleton.html
-rw-r--r--      3680 2016-12-08 06:18 ibm-db2.installation.html
-rw-r--r--      3628 2016-12-08 06:19 mysqlnd-ms.rwsplit.html
-rw-r--r--      4188 2016-12-08 06:19 thread.join.html
-rw-r--r--      2680 2016-12-08 06:19 function.trader-dema.html
-rw-r--r--      6767 2016-12-08 06:19 function.ftp-pasv.html
-rw-r--r--     12705 2016-12-08 06:18 phar.compressfiles.html
-rw-r--r--      4131 2016-12-08 06:19 function.mailparse-msg-extract-whole-part-file.html
-rw-r--r--      4714 2016-12-08 06:19 imagick.edgeimage.html
-rw-r--r--      1804 2016-12-08 06:18 constants.newt.args-flags.html
-rw-r--r--      4990 2016-12-08 06:19 splfileinfo.getpath.html
-rw-r--r--      2908 2016-12-08 06:19 function.fam-open.html
-rw-r--r--      6252 2016-12-08 06:19 imagick.adaptivethresholdimage.html
-rw-r--r--      3306 2016-12-08 06:20 internals2.opcodes.add-char.html
-rw-r--r--      7428 2016-12-08 06:19 mongodb-driver-writeconcernerror.getinfo.html
-rw-r--r--      2479 2016-12-08 06:19 harupage.endtext.html
-rw-r--r--      3908 2016-12-08 06:20 function.xmlrpc-is-fault.html
-rw-r--r--      9819 2016-12-08 06:20 function.ctype-digit.html
-rw-r--r--      3550 2016-12-08 06:19 function.gupnp-context-get-subscription-timeout.html
-rw-r--r--      4353 2016-12-08 06:19 function.cairo-font-face-get-type.html
-rw-r--r--      4369 2016-12-08 06:19 function.curl-multi-remove-handle.html
-rw-r--r--      3078 2016-12-08 06:19 function.pg-connect-poll.html
-rw-r--r--      7611 2016-12-08 06:19 function.iconv-mime-decode.html
-rw-r--r--     17033 2016-12-08 06:19 function.imagegif.html
-rw-r--r--      1528 2016-12-08 06:20 bbcode.resources.html
-rw-r--r--     21931 2016-12-08 06:20 class.sphinxclient.html
-rw-r--r--      7712 2016-12-08 06:19 cairocontext.copypathflat.html
-rw-r--r--      4959 2016-12-08 06:18 book.runkit.html
-rw-r--r--      5805 2016-12-08 06:20 ds-sequence.map.html
-rw-r--r--      8407 2016-12-08 06:19 mysqlnd-uh.quickstart.query-monitoring.html
-rw-r--r--      3013 2016-12-08 06:19 yaf-route-regex.route.html
-rw-r--r--      4538 2016-12-08 06:19 imagick.identifyformat.html
-rw-r--r--      2355 2016-12-08 06:20 function.msession-create.html
-rw-r--r--      5715 2016-12-08 06:20 solrquery.setgrouplimit.html
-rw-r--r--    170563 2016-12-08 06:20 resource.html
-rw-r--r--      2255 2016-12-08 06:18 intro.radius.html
-rw-r--r--      2944 2016-12-08 06:20 zmqcontext.getopt.html
-rw-r--r--      6749 2016-12-08 06:20 internals2.opcodes.case.html
-rw-r--r--     25116 2016-12-08 06:19 mongo.writeconcerns.html
-rw-r--r--      2396 2016-12-08 06:20 solrqueryresponse.destruct.html
-rw-r--r--      3629 2016-12-08 06:19 function.trader-cdleveningdojistar.html
-rw-r--r--      5517 2016-12-08 06:20 zookeeper.exists.html
-rw-r--r--      7937 2016-12-08 06:18 function.ncurses-init-pair.html
-rw-r--r--      2552 2016-12-08 06:19 yaf-config-abstract.toarray.html
-rw-r--r--      9063 2016-12-08 06:20 internals2.counter.examples.extended.html
-rw-r--r--     10808 2016-12-08 06:19 numberformatter.getsymbol.html
-rw-r--r--      2998 2016-12-08 06:20 class.rrdupdater.html
-rw-r--r--      2614 2016-12-08 06:19 judy.last.html
-rw-r--r--      6587 2016-12-08 06:19 function.mysqlnd-ms-xa-gc.html
-rw-r--r--      5170 2016-12-08 06:20 function.apache-getenv.html
-rw-r--r--      2714 2016-12-08 06:19 recursivetreeiterator.next.html
-rw-r--r--      6195 2016-12-08 06:20 simplexmliterator.getchildren.html
-rw-r--r--      6073 2016-12-08 06:19 class.runtimeexception.html
-rw-r--r--      2625 2016-12-08 06:18 kadm5.installation.html
-rw-r--r--      3687 2016-12-08 06:18 language.operators.html
-rw-r--r--      7918 2016-12-08 06:18 function.cubrid-lob-export.html
-rw-r--r--      3160 2016-12-08 06:19 gmagick.charcoalimage.html
-rw-r--r--      8930 2016-12-08 06:20 function.yaz-connect.html
-rw-r--r--      1878 2016-12-08 06:18 ingres.resources.html
-rw-r--r--     12855 2016-12-08 06:19 class.cairopssurface.html
-rw-r--r--     10112 2016-12-08 06:19 mysqlnduhconnection.listfields.html
-rw-r--r--      4361 2016-12-08 06:20 ref.snmp.html
-rw-r--r--      1555 2016-12-08 06:18 memtrack.setup.html
-rw-r--r--      2407 2016-12-08 06:19 hwapi.error-count.html
-rw-r--r--      3224 2016-12-08 06:19 function.ps-show2.html
-rw-r--r--     18811 2016-12-08 06:19 class.mongocursorexception.html
-rw-r--r--      2703 2016-12-08 06:18 weakmap.offsetget.html
-rw-r--r--      3989 2016-12-08 06:19 swftextfield.setcolor.html
-rw-r--r--      8240 2016-12-08 06:18 odbc.configuration.html
-rw-r--r--      2477 2016-12-08 06:20 zmqsocket.getpersistentid.html
-rw-r--r--      3313 2016-12-08 06:18 function.dbplus-close.html
-rw-r--r--      4047 2016-12-08 06:19 streamwrapper.stream-eof.html
-rw-r--r--      2238 2016-12-08 06:19 mongodb.--tostring.html
-rw-r--r--      3276 2016-12-08 06:19 eventbufferevent.write.html
-rw-r--r--      2900 2016-12-08 06:18 function.ncurses-slk-attron.html
-rw-r--r--     20391 2016-12-08 06:20 function.preg-match.html
-rw-r--r--      4293 2016-12-08 06:19 function.mb-preferred-mime-name.html
-rw-r--r--     11111 2016-12-08 06:19 recursiveregexiterator.construct.html
-rw-r--r--      6779 2016-12-08 06:19 tidynode.iscomment.html
-rw-r--r--      6617 2016-12-08 06:19 function.xattr-list.html
-rw-r--r--      3085 2016-12-08 06:19 function.stats-dens-normal.html
-rw-r--r--      2947 2016-12-08 06:20 solrquery.addmltqueryfield.html
-rw-r--r--      3250 2016-12-08 06:19 function.trader-cdldojistar.html
-rw-r--r--      1347 2016-12-08 06:20 bbcode.requirements.html
-rw-r--r--      9432 2016-12-08 06:19 sybase.configuration.html
-rw-r--r--      2370 2016-12-08 06:20 solrquery.getquery.html
-rw-r--r--      6714 2016-12-08 06:19 function.mb-strimwidth.html
-rw-r--r--      1365 2016-12-08 06:20 solr.configuration.html
-rw-r--r--      8022 2016-12-08 06:19 mysqlnduhconnection.selectdb.html
-rw-r--r--      1361 2016-12-08 06:18 memtrack.requirements.html
-rw-r--r--      2861 2016-12-08 06:18 function.ncurses-has-key.html
-rw-r--r--      6523 2016-12-08 06:19 class.mongodb-driver-writeconcern.html
-rw-r--r--      2170 2016-12-08 06:18 tag.getyear.html
-rw-r--r--      3129 2016-12-08 06:19 yaf-application.app.html
-rw-r--r--      6403 2016-12-08 06:20 reflectionfunction.invoke.html
-rw-r--r--      5243 2016-12-08 06:18 ref.pdo-4d.sql4d.html
-rw-r--r--     15177 2016-12-08 06:19 function.fwrite.html
-rw-r--r--      1374 2016-12-08 06:18 outcontrol.resources.html
-rw-r--r--      6979 2016-12-08 06:19 function.copy.html
-rw-r--r--      3144 2016-12-08 06:19 function.trader-bop.html
-rw-r--r--      6815 2016-12-08 06:19 function.passthru.html
-rw-r--r--      2816 2016-12-08 06:19 intlbreakiterator.next.html
-rw-r--r--      3950 2016-12-08 06:19 spldoublylinkedlist.setiteratormode.html
-rw-r--r--     10533 2016-12-08 06:19 function.maxdb-info.html
-rw-r--r--      2636 2016-12-08 06:19 function.pdf-fit-table.html
-rw-r--r--      2217 2016-12-08 06:19 function.pdf-define-layer.html
-rw-r--r--      6492 2016-12-08 06:20 reflectionfunctionabstract.getreturntype.html
-rw-r--r--      5346 2016-12-08 06:18 mcrypt.constants.html
-rw-r--r--      8441 2016-12-08 06:19 appenditerator.key.html
-rw-r--r--      2940 2016-12-08 06:19 haruoutline.setopened.html
-rw-r--r--      3994 2016-12-08 06:19 function.jewishtojd.html
-rw-r--r--      2662 2016-12-08 06:19 intltimezone.getrawoffset.html
-rw-r--r--      1517 2016-12-08 06:18 hash.setup.html
-rw-r--r--      3313 2016-12-08 06:19 harudoc.resetstream.html
-rw-r--r--      5396 2016-12-08 06:19 event.addtimer.html
-rw-r--r--      8095 2016-12-08 06:18 features.gc.collecting-cycles.html
-rw-r--r--      6617 2016-12-08 06:18 class.apcuiterator.html
-rw-r--r--      3177 2016-12-08 06:20 oauth.getlastresponseinfo.html
-rw-r--r--      5252 2016-12-08 06:20 solrdismaxquery.setuserfields.html
-rw-r--r--      2686 2016-12-08 06:20 solrquery.gettermsincludeupperbound.html
-rw-r--r--     17358 2016-12-08 06:19 streamwrapper.dir-readdir.html
-rw-r--r--     18832 2016-12-08 06:19 function.oci-fetch-array.html
-rw-r--r--      7504 2016-12-08 06:19 intlchar.totitle.html
-rw-r--r--      4384 2016-12-08 06:19 function.fann-set-output-scaling-params.html
-rw-r--r--      2449 2016-12-08 06:20 ui-window.error.html
-rw-r--r--      8441 2016-12-08 06:19 locale.getdisplayregion.html
-rw-r--r--      2546 2016-12-08 06:20 ui-draw-stroke.setjoin.html
-rw-r--r--      3711 2016-12-08 06:19 function.fann-get-rprop-delta-zero.html
-rw-r--r--      2433 2016-12-08 06:19 function.imagepsextendfont.html
-rw-r--r--      1256 2016-12-08 06:19 shmop.constants.html
-rw-r--r--     17659 2016-12-08 06:19 function.imagefilledarc.html
-rw-r--r--      3302 2016-12-08 06:19 trader.configuration.html
-rw-r--r--      1262 2016-12-08 06:19 stats.constants.html
-rw-r--r--      2497 2016-12-08 06:19 gmagickdraw.getfontstyle.html
-rw-r--r--      4978 2016-12-08 06:19 function.shmop-write.html
-rw-r--r--      4273 2016-12-08 06:20 snmp.geterror.html
-rw-r--r--      2430 2016-12-08 06:18 function.ncurses-getch.html
-rw-r--r--      4221 2016-12-08 06:20 solrdismaxquery.setqueryalt.html
-rw-r--r--      4502 2016-12-08 06:19 cond.signal.html
-rw-r--r--      5433 2016-12-08 06:20 domdocumentfragment.appendxml.html
-rw-r--r--      1714 2016-12-08 06:20 intro.bbcode.html
-rw-r--r--     10100 2016-12-08 06:19 class.evprepare.html
-rw-r--r--      2846 2016-12-08 06:20 solrquery.getfacetoffset.html
-rw-r--r--      2906 2016-12-08 06:18 function.newt-textbox-set-height.html
-rw-r--r--      4790 2016-12-08 06:18 intro.wincache.html
-rw-r--r--      2828 2016-12-08 06:18 function.ibase-gen-id.html
-rw-r--r--      1562 2016-12-08 06:18 ncurses.setup.html
-rw-r--r--     13050 2016-12-08 06:19 function.yaml-emit.html
-rw-r--r--      6579 2016-12-08 06:19 evchild.construct.html
-rw-r--r--      9637 2016-12-08 06:19 mysql.configuration.html
-rw-r--r--     32659 2016-12-08 06:19 pgsql.constants.html
-rw-r--r--      3861 2016-12-08 06:18 function.ibase-close.html
-rw-r--r--      2980 2016-12-08 06:20 internals2.opcodes.mul.html
-rw-r--r--      6317 2016-12-08 06:19 function.imagecreatefromxpm.html
-rw-r--r--      4672 2016-12-08 06:19 globiterator.count.html
-rw-r--r--      3377 2016-12-08 06:20 internals2.counter.function.counter-create.html
-rw-r--r--      4552 2016-12-08 06:19 mongo.tutorial.multi.query.html
-rw-r--r--      2243 2016-12-08 06:19 mysqlnd-ms.changes.html
-rw-r--r--      2142 2016-12-08 06:19 imagick.nextimage.html
-rw-r--r--      3355 2016-12-08 06:18 function.dba-close.html
-rw-r--r--      1307 2016-12-08 06:19 event.resources.html
-rw-r--r--      4377 2016-12-08 06:19 function.cairo-create.html
-rw-r--r--      4958 2016-12-08 06:19 function.pclose.html
-rw-r--r--      2426 2016-12-08 06:19 imagickdraw.getfillopacity.html
-rw-r--r--      3178 2016-12-08 06:19 harupage.gettransmatrix.html
-rw-r--r--      2268 2016-12-08 06:18 function.newt-bell.html
-rw-r--r--      1367 2016-12-08 06:20 sdodasrel.resources.html
-rw-r--r--      2356 2016-12-08 06:19 judy.memoryusage.html
-rw-r--r--      5880 2016-12-08 06:18 function.ob-list-handlers.html
-rw-r--r--      4983 2016-12-08 06:19 function.iconv-set-encoding.html
-rw-r--r--      6079 2016-12-08 06:19 function.cal-info.html
-rw-r--r--      2679 2016-12-08 06:19 imagickdraw.getstrokeantialias.html
-rw-r--r--      9743 2016-12-08 06:20 intro.sca.html
-rw-r--r--      6230 2016-12-08 06:18 function.mcrypt-get-key-size.html
-rw-r--r--      8656 2016-12-08 06:19 intlcalendar.isweekend.html
-rw-r--r--      3554 2016-12-08 06:19 function.fann-set-cascade-max-out-epochs.html
-rw-r--r--      7784 2016-12-08 06:19 imagickpixel.setcolor.html
-rw-r--r--      3449 2016-12-08 06:19 gearmantask.recvdata.html
-rw-r--r--      1490 2016-12-08 06:19 url.setup.html
-rw-r--r--      5036 2016-12-08 06:20 ds-set.diff.html
-rw-r--r--      4020 2016-12-08 06:19 function.ps-show-xy.html
-rw-r--r--      5073 2016-12-08 06:20 ds-deque.merge.html
-rw-r--r--      2633 2016-12-08 06:19 imagick.drawimage.html
-rw-r--r--      1561 2016-12-08 06:19 enchant.setup.html
-rw-r--r--      2530 2016-12-08 06:20 solrinputdocument.toarray.html
-rw-r--r--      2098 2016-12-08 06:19 function.pdf-clip.html
-rw-r--r--      5874 2016-12-08 06:19 pthreads.modifiers.html
-rw-r--r--      2805 2016-12-08 06:19 yaf-view-simple.get.html
-rw-r--r--     10450 2016-12-08 06:19 function.mb-convert-case.html
-rw-r--r--      2065 2016-12-08 06:19 hrtime.installation.html
-rw-r--r--     27731 2016-12-08 06:19 class.evloop.html
-rw-r--r--      1631 2016-12-08 06:19 function.die.html
-rw-r--r--      3199 2016-12-08 06:19 splfixedarray.offsetget.html
-rw-r--r--      6488 2016-12-08 06:20 function.ctype-punct.html
-rw-r--r--      6790 2016-12-08 06:19 class.mongodb-driver-exception-unexpectedvalueexception.html
-rw-r--r--      5640 2016-12-08 06:19 function.pcntl-signal-dispatch.html
-rw-r--r--      5644 2016-12-08 06:19 function.ftp-delete.html
-rw-r--r--      2121 2016-12-08 06:19 function.date-create-immutable-from-format.html
-rw-r--r--      3064 2016-12-08 06:18 function.ncurses-define-key.html
-rw-r--r--      4099 2016-12-08 06:19 function.maxdb-stmt-close-long-data.html
-rw-r--r--      9745 2016-12-08 06:19 function.imagepalettetotruecolor.html
-rw-r--r--      5969 2016-12-08 06:20 function.ucfirst.html
-rw-r--r--      3830 2016-12-08 06:19 function.fann-set-cascade-output-stagnation-epochs.html
-rw-r--r--      5730 2016-12-08 06:19 splfileinfo.setfileclass.html
-rw-r--r--      1360 2016-12-08 06:19 vpopmail.resources.html
-rw-r--r--      1509 2016-12-08 06:18 ref.inclued.html
-rw-r--r--      3264 2016-12-08 06:19 harupage.setmiterlimit.html
-rw-r--r--      2796 2016-12-08 06:20 solrquery.getgroupfields.html
-rw-r--r--      6506 2016-12-08 06:19 gupnp.constants.html
-rw-r--r--      1504 2016-12-08 06:20 sdo.setup.html
-rw-r--r--      9025 2016-12-08 06:19 function.msql-fetch-array.html
-rw-r--r--      1605 2016-12-08 06:19 ldap.resources.html
-rw-r--r--      4374 2016-12-08 06:19 class.outeriterator.html
-rw-r--r--      4739 2016-12-08 06:20 regexp.reference.conditional.html
-rw-r--r--      2065 2016-12-08 06:19 ref.shmop.html
-rw-r--r--      2280 2016-12-08 06:18 weakmap.next.html
-rw-r--r--      2369 2016-12-08 06:18 weakmap.current.html
-rw-r--r--      7348 2016-12-08 06:18 function.ibase-pconnect.html
-rw-r--r--      5308 2016-12-08 06:19 imagick.thresholdimage.html
-rw-r--r--      7236 2016-12-08 06:20 function.snmp3-get.html
-rw-r--r--      5126 2016-12-08 06:20 ds-sequence.remove.html
-rw-r--r--      4800 2016-12-08 06:19 book.gnupg.html
-rw-r--r--      5668 2016-12-08 06:20 quickhashintstringhash.savetofile.html
-rw-r--r--      2662 2016-12-08 06:18 phar.creating.intro.html
-rw-r--r--     11999 2016-12-08 06:19 imagickdraw.composite.html
-rw-r--r--      6222 2016-12-08 06:19 class.cairofonttype.html
-rw-r--r--      6464 2016-12-08 06:19 function.imageaffinematrixconcat.html
-rw-r--r--      4464 2016-12-08 06:18 ref.runkit.html
-rw-r--r--      7633 2016-12-08 06:20 ds-set.sort.html
-rw-r--r--      2218 2016-12-08 06:20 function.iis-get-dir-security.html
-rw-r--r--      2656 2016-12-08 06:20 solrdocument.isset.html
-rw-r--r--      3690 2016-12-08 06:19 function.fann-set-cascade-num-candidate-groups.html
-rw-r--r--     15360 2016-12-08 06:20 reflectionmethod.construct.html
-rw-r--r--      7151 2016-12-08 06:19 calendar.constants.html
-rw-r--r--      4948 2016-12-08 06:19 function.linkinfo.html
-rw-r--r--     10444 2016-12-08 06:20 class.solrcollapsefunction.html
-rw-r--r--      4884 2016-12-08 06:19 function.closedir.html
-rw-r--r--      2949 2016-12-08 06:19 splfileobject.getchildren.html
-rw-r--r--      3790 2016-12-08 06:19 harudoc.setcompressionmode.html
-rw-r--r--      5065 2016-12-08 06:19 class.splint.html
-rw-r--r--      3262 2016-12-08 06:19 function.trader-cdlharami.html
-rw-r--r--      2371 2016-12-08 06:19 mongogridfsfile.getfilename.html
-rw-r--r--      5921 2016-12-08 06:20 function.ssh2-sftp-chmod.html
-rw-r--r--      8211 2016-12-08 06:20 class.variant.html
-rw-r--r--      9428 2016-12-08 06:18 function.php-uname.html
-rw-r--r--      4052 2016-12-08 06:20 oauth.setcapath.html
-rw-r--r--      7486 2016-12-08 06:20 function.ssh2-sftp-lstat.html
-rw-r--r--      9256 2016-12-08 06:20 example.xml-map-tags.html
-rw-r--r--      2092 2016-12-08 06:19 imagick.requirements.html
-rw-r--r--      6659 2016-12-08 06:18 fbsql.constants.html
-rw-r--r--      1571 2016-12-08 06:18 bcompiler.setup.html
-rw-r--r--     13752 2016-12-08 06:19 function.flock.html
-rw-r--r--      2113 2016-12-08 06:20 intro.swish.html
-rw-r--r--      6073 2016-12-08 06:20 function.ctype-xdigit.html
-rw-r--r--      2414 2016-12-08 06:18 function.putenv.html
-rw-r--r--     10520 2016-12-08 06:19 function.eio-symlink.html
-rw-r--r--      2947 2016-12-08 06:19 swfdisplayitem.setmatrix.html
-rw-r--r--      6210 2016-12-08 06:19 function.ps-shading.html
-rw-r--r--      2480 2016-12-08 06:19 ref.url.html
-rw-r--r--      1333 2016-12-08 06:19 misc.requirements.html
-rw-r--r--      1365 2016-12-08 06:20 ssh2.configuration.html
-rw-r--r--      2192 2016-12-08 06:19 function.ocisetprefetch.html
-rw-r--r--      1361 2016-12-08 06:20 classobj.requirements.html
-rw-r--r--     17662 2016-12-08 06:19 book.trader.html
-rw-r--r--      3681 2016-12-08 06:20 internals2.opcodes.is-identical.html
-rw-r--r--      2807 2016-12-08 06:18 function.ncurses-bkgdset.html
-rw-r--r--     17830 2016-12-08 06:19 mysqlnd.plugin.architecture.html
-rw-r--r--      4735 2016-12-08 06:19 filesystemiterator.next.html
-rw-r--r--      2626 2016-12-08 06:19 splheap.insert.html
-rw-r--r--      8609 2016-12-08 06:20 function.stripslashes.html
-rw-r--r--      9984 2016-12-08 06:19 function.idate.html
-rw-r--r--      1883 2016-12-08 06:20 regex.installation.html
-rw-r--r--      2532 2016-12-08 06:19 harupage.eofill.html
-rw-r--r--      1440 2016-12-08 06:20 intro.xsl.html
-rw-r--r--      2542 2016-12-08 06:19 swfsprite.startsound.html
-rw-r--r--      3259 2016-12-08 06:19 class.spltype.html
-rw-r--r--      9809 2016-12-08 06:18 runkit.constants.html
-rw-r--r--      1934 2016-12-08 06:20 zmq.requirements.html
-rw-r--r--     14530 2016-12-08 06:19 function.maxdb-stmt-result-metadata.html
-rw-r--r--      7202 2016-12-08 06:20 internals2.opcodes.catch.html
-rw-r--r--      5651 2016-12-08 06:18 function.odbc-specialcolumns.html
-rw-r--r--      1231 2016-12-08 06:19 haru.constants.html
-rw-r--r--     10221 2016-12-08 06:18 pharfileinfo.setuncompressed.html
-rw-r--r--      5394 2016-12-08 06:20 function.svn-cleanup.html
-rw-r--r--      3922 2016-12-08 06:20 function.xml-get-current-byte-index.html
-rw-r--r--      5411 2016-12-08 06:19 memcached.casbykey.html
-rw-r--r--      4680 2016-12-08 06:18 ref.radius.html
-rw-r--r--      9831 2016-12-08 06:19 class.v8jsexception.html
-rw-r--r--      6192 2016-12-08 06:19 function.ftell.html
-rw-r--r--      4982 2016-12-08 06:18 security.database.storage.html
-rw-r--r--      2458 2016-12-08 06:19 imagick.getimagevirtualpixelmethod.html
-rw-r--r--     14773 2016-12-08 06:19 class.spltempfileobject.html
-rw-r--r--     10029 2016-12-08 06:19 book.spl.html
-rw-r--r--      5224 2016-12-08 06:20 zookeeper.setdeterministicconnorder.html
-rw-r--r--      5637 2016-12-08 06:19 function.px-get-info.html
-rw-r--r--      6379 2016-12-08 06:19 limititerator.construct.html
-rw-r--r--      7811 2016-12-08 06:19 tidy.construct.html
-rw-r--r--      2623 2016-12-08 06:19 imagick.getimageindex.html
-rw-r--r--      8424 2016-12-08 06:20 function.array-uintersect-assoc.html
-rw-r--r--      9793 2016-12-08 06:18 function.db2-special-columns.html
-rw-r--r--      1874 2016-12-08 06:20 internals2.opcodes.fetch-unset.html
-rw-r--r--      2839 2016-12-08 06:19 eventlistener.enable.html
-rw-r--r--     11448 2016-12-08 06:19 mongodb-driver-bulkwrite.update.html
-rw-r--r--      6604 2016-12-08 06:19 imagick.orderedposterizeimage.html
-rw-r--r--      1693 2016-12-08 06:18 readline.installation.html
-rw-r--r--      2698 2016-12-08 06:20 migration5.cli-cgi.html
-rw-r--r--      1358 2016-12-08 06:19 spl.configuration.html
-rw-r--r--      3199 2016-12-08 06:19 function.enchant-broker-free.html
-rw-r--r--      4155 2016-12-08 06:19 function.ingres-num-fields.html
-rw-r--r--      4025 2016-12-08 06:18 function.readline-callback-handler-remove.html
-rw-r--r--      2743 2016-12-08 06:19 imagick.removeimageprofile.html
-rw-r--r--      3548 2016-12-08 06:18 function.openssl-pkcs12-read.html
-rw-r--r--      7812 2016-12-08 06:19 function.iconv.html
-rw-r--r--      4301 2016-12-08 06:20 refs.webservice.html
-rw-r--r--      5029 2016-12-08 06:20 function.snmp-set-enum-print.html
-rw-r--r--      5926 2016-12-08 06:19 splfileobject.getflags.html
-rw-r--r--      5765 2016-12-08 06:20 function.snmp2-getnext.html
-rw-r--r--      4949 2016-12-08 06:20 sphinxclient.query.html
-rw-r--r--      3046 2016-12-08 06:19 recursiveiteratoriterator.enditeration.html
-rw-r--r--     12339 2016-12-08 06:19 function.maxdb-fetch-row.html
-rw-r--r--      1546 2016-12-08 06:19 spl.installation.html
-rw-r--r--     39741 2016-12-08 06:18 function.db2-connect.html
-rw-r--r--      6566 2016-12-08 06:20 function.socket-create-listen.html
-rw-r--r--      3423 2016-12-08 06:20 internals2.counter.function.counter-get-meta.html
-rw-r--r--      2460 2016-12-08 06:18 security.cgi-bin.default.html
-rw-r--r--      3316 2016-12-08 06:20 function.yp-order.html
-rw-r--r--      6185 2016-12-08 06:20 quickhashintstringhash.delete.html
-rw-r--r--      3532 2016-12-08 06:19 function.enchant-dict-store-replacement.html
-rw-r--r--      2209 2016-12-08 06:19 taint.installation.html
-rw-r--r--     10832 2016-12-08 06:20 solrclient.adddocuments.html
-rw-r--r--      2898 2016-12-08 06:20 solrquery.settermssort.html
-rw-r--r--      2127 2016-12-08 06:18 function.ifx-create-char.html
-rw-r--r--     14716 2016-12-08 06:19 mysqli-stmt.data-seek.html
-rw-r--r--      3462 2016-12-08 06:18 function.ncurses-isendwin.html
-rw-r--r--      4778 2016-12-08 06:19 function.shmop-read.html
-rw-r--r--      2978 2016-12-08 06:20 sdo-das-changesummary.islogging.html
-rw-r--r--      2431 2016-12-08 06:18 weakmap.valid.html
-rw-r--r--      5343 2016-12-08 06:20 soapclient.getlastresponse.html
-rw-r--r--      2569 2016-12-08 06:19 mysqlnd-mux.sharing_connections.html
-rw-r--r--      2221 2016-12-08 06:20 ui-controls-grid.ispadded.html
-rw-r--r--      3451 2016-12-08 06:20 sdo-das-changesummary.getoldcontainer.html
-rw-r--r--      2575 2016-12-08 06:19 function.pdf-begin-pattern.html
-rw-r--r--      6962 2016-12-08 06:20 ds-sequence.get.html
-rw-r--r--      8449 2016-12-08 06:19 function.mysql-num-rows.html
-rw-r--r--      2827 2016-12-08 06:19 imagick.setimageinterlacescheme.html
-rw-r--r--      5238 2016-12-08 06:20 function.end.html
-rw-r--r--      6171 2016-12-08 06:19 class.outofrangeexception.html
-rw-r--r--      3316 2016-12-08 06:19 function.bind-textdomain-codeset.html
-rw-r--r--      3315 2016-12-08 06:18 security.database.html
-rw-r--r--      8471 2016-12-08 06:19 class.evfork.html
-rw-r--r--      5832 2016-12-08 06:20 class.ui-draw-brush-radialgradient.html
-rw-r--r--      7690 2016-12-08 06:19 mongodb-bson-unserializable.bsonunserialize.html
-rw-r--r--      4997 2016-12-08 06:20 reflectionfunction.tostring.html
-rw-r--r--      5839 2016-12-08 06:20 reference.pcre.pattern.posix.html
-rw-r--r--      2556 2016-12-08 06:19 yaf-loader.getlocalnamespace.html
-rw-r--r--      1709 2016-12-08 06:18 blenc.constants.html
-rw-r--r--      3831 2016-12-08 06:19 function.fann-descale-train.html
-rw-r--r--      3215 2016-12-08 06:19 function.trader-adx.html
-rw-r--r--      3678 2016-12-08 06:19 function.fann-num-input-train-data.html
-rw-r--r--     12035 2016-12-08 06:20 migration52.functions.html
-rw-r--r--      2998 2016-12-08 06:19 function.stats-dens-gamma.html
-rw-r--r--      3699 2016-12-08 06:20 function.yaz-element.html
-rw-r--r--      2189 2016-12-08 06:20 function.msession-destroy.html
-rw-r--r--     11519 2016-12-08 06:19 function.maxdb-fetch-lengths.html
-rw-r--r--     22385 2016-12-08 06:20 class.domnode.html
-rw-r--r--      2045 2016-12-08 06:19 hwapi.configuration.html
-rw-r--r--      7839 2016-12-08 06:20 ds-sequence.sort.html
-rw-r--r--      2771 2016-12-08 06:19 function.fann-destroy.html
-rw-r--r--      1339 2016-12-08 06:19 xdiff.resources.html
-rw-r--r--      2589 2016-12-08 06:19 imagickdraw.pushdefs.html
-rw-r--r--      6487 2016-12-08 06:20 varnish.example.admin.html
-rw-r--r--      1791 2016-12-08 06:19 json.installation.html
-rw-r--r--     16179 2016-12-08 06:19 function.exif-read-data.html
-rw-r--r--     24870 2016-12-08 06:19 function.mail.html
-rw-r--r--     13882 2016-12-08 06:19 dateperiod.construct.html
-rw-r--r--      4080 2016-12-08 06:19 function.fdf-set-flags.html
-rw-r--r--      7424 2016-12-08 06:20 simplexmlelement.getDocNamespaces.html
-rw-r--r--      3809 2016-12-08 06:19 gmp.constants.html
-rw-r--r--      3347 2016-12-08 06:19 gmagick.profileimage.html
-rw-r--r--      6262 2016-12-08 06:19 intro.mysqlnd-mux.html
-rw-r--r--      2645 2016-12-08 06:19 filteriterator.getinneriterator.html
-rw-r--r--      5893 2016-12-08 06:19 function.pspell-config-personal.html
-rw-r--r--     13094 2016-12-08 06:20 ref.array.html
-rw-r--r--      1332 2016-12-08 06:20 ssh2.resources.html
-rw-r--r--      3901 2016-12-08 06:19 function.fann-set-rprop-delta-zero.html
-rw-r--r--      3572 2016-12-08 06:19 function.stats-cdf-noncentral-chisquare.html
-rw-r--r--      3384 2016-12-08 06:19 gmagickdraw.line.html
-rw-r--r--      2313 2016-12-08 06:19 function.stream-bucket-append.html
-rw-r--r--      2204 2016-12-08 06:19 function.set-socket-blocking.html
-rw-r--r--      2897 2016-12-08 06:19 imagick.getresource.html
-rw-r--r--      3233 2016-12-08 06:19 harupage.getdash.html
-rw-r--r--      1325 2016-12-08 06:20 sam.resources.html
-rw-r--r--      4405 2016-12-08 06:19 function.mb-ereg-search-getregs.html
-rw-r--r--      2320 2016-12-08 06:20 solrpingresponse.construct.html
-rw-r--r--      4344 2016-12-08 06:19 function.fann-save.html
-rw-r--r--      2410 2016-12-08 06:19 swftextfield.setpadding.html
-rw-r--r--      8032 2016-12-08 06:18 rararchive.issolid.html
-rw-r--r--      9826 2016-12-08 06:20 reflectionclass.getmethods.html
-rw-r--r--      3614 2016-12-08 06:19 imagick.getimagechannelkurtosis.html
-rw-r--r--     13353 2016-12-08 06:19 refs.basic.other.html
-rw-r--r--     28755 2016-12-08 06:18 language.generators.syntax.html
-rw-r--r--      6789 2016-12-08 06:18 function.dbx-fetch-row.html
-rw-r--r--      4045 2016-12-08 06:19 splheap.compare.html
-rw-r--r--      3515 2016-12-08 06:19 harupage.setlinejoin.html
-rw-r--r--      5867 2016-12-08 06:19 directoryiterator.gettype.html
-rw-r--r--      6639 2016-12-08 06:19 arrayobject.exchangearray.html
-rw-r--r--      4110 2016-12-08 06:20 function.xmlwriter-end-comment.html
-rw-r--r--      2863 2016-12-08 06:19 ref.dir.html
-rw-r--r--      4948 2016-12-08 06:19 function.imap-rfc822-write-address.html
-rw-r--r--      9173 2016-12-08 06:19 fann.examples-1.html
-rw-r--r--      2433 2016-12-08 06:20 ui-controls-combo.setselected.html
-rw-r--r--     12423 2016-12-08 06:19 class.datetimeimmutable.html
-rw-r--r--      1597 2016-12-08 06:19 calendar.installation.html
-rw-r--r--      2773 2016-12-08 06:19 function.trader-add.html
-rw-r--r--      5369 2016-12-08 06:20 swish.query.html
-rw-r--r--      6445 2016-12-08 06:18 function.apcu-cache-info.html
-rw-r--r--      1500 2016-12-08 06:20 oauth.requirements.html
-rw-r--r--      4063 2016-12-08 06:19 event.settimer.html
-rw-r--r--      1527 2016-12-08 06:19 gupnp.requirements.html
-rw-r--r--      3307 2016-12-08 06:19 function.trader-cdlsticksandwich.html
-rw-r--r--      1699 2016-12-08 06:18 install.windows.tools.html
-rw-r--r--      9968 2016-12-08 06:19 mysqlnd.plugin.developing.html
-rw-r--r--      3705 2016-12-08 06:20 internals2.counter.counter-class.construct.html
-rw-r--r--      4715 2016-12-08 06:19 pthreads.constants.html
-rw-r--r--      6098 2016-12-08 06:19 arrayobject.setiteratorclass.html
-rw-r--r--      3434 2016-12-08 06:18 function.newt-checkbox.html
-rw-r--r--      2877 2016-12-08 06:18 function.ifx-update-char.html
-rw-r--r--      3448 2016-12-08 06:18 language.operators.string.html
-rw-r--r--      1557 2016-12-08 06:19 gearman.setup.html
-rw-r--r--      1359 2016-12-08 06:19 yaml.resources.html
-rw-r--r--      4473 2016-12-08 06:19 function.cairo-font-face-status.html
-rw-r--r--      4197 2016-12-08 06:19 function.xdiff-string-diff-binary.html
-rw-r--r--      4196 2016-12-08 06:20 sessionhandler.destroy.html
-rw-r--r--      3458 2016-12-08 06:19 function.sqlite-has-more.html
-rw-r--r--      5285 2016-12-08 06:19 function.ftp-get-option.html
-rw-r--r--      2781 2016-12-08 06:20 function.svn-fs-begin-txn2.html
-rw-r--r--      6021 2016-12-08 06:19 cairocontext.masksurface.html
-rw-r--r--      2298 2016-12-08 06:20 function.msession-set-array.html
-rw-r--r--      2581 2016-12-08 06:20 zmqcontext.ispersistent.html
-rw-r--r--      3976 2016-12-08 06:19 mysqli.set-local-infile-default.html
-rw-r--r--      8808 2016-12-08 06:19 function.pg-lo-create.html
-rw-r--r--      5373 2016-12-08 06:20 reflectionparameter.hastype.html
-rw-r--r--      3002 2016-12-08 06:19 gmagick.rollimage.html
-rw-r--r--      5764 2016-12-08 06:19 function.ftp-connect.html
-rw-r--r--      2676 2016-12-08 06:19 function.imagecolordeallocate.html
-rw-r--r--      1354 2016-12-08 06:20 iisfunc.requirements.html
-rw-r--r--      4110 2016-12-08 06:19 mongoinsertbatch.construct.html
-rw-r--r--      2912 2016-12-08 06:20 sphinxclient.getlastwarning.html
-rw-r--r--      1328 2016-12-08 06:20 svn.resources.html
-rw-r--r--      8030 2016-12-08 06:18 pdostatement.closecursor.html
-rw-r--r--      3843 2016-12-08 06:19 swfmovie.setbackground.html
-rw-r--r--      3926 2016-12-08 06:19 threaded.extend.html
-rw-r--r--      7401 2016-12-08 06:18 pharfileinfo.getcompressedsize.html
-rw-r--r--      2970 2016-12-08 06:19 function.imagepolygon.html
-rw-r--r--      2496 2016-12-08 06:19 function.stats-rand-gen-int.html
-rw-r--r--      3413 2016-12-08 06:19 gearmanworker.removeoptions.html
-rw-r--r--      5605 2016-12-08 06:20 solrdismaxquery.setbigramphrasefields.html
-rw-r--r--      2550 2016-12-08 06:19 swftext.getutf8width.html
-rw-r--r--      6071 2016-12-08 06:19 imagick.clutimage.html
-rw-r--r--      3820 2016-12-08 06:19 tokyotyranttable.add.html
-rw-r--r--      1320 2016-12-08 06:19 ftp.examples.html
-rw-r--r--      4687 2016-12-08 06:20 class.ui-draw-text-font.html
-rw-r--r--      7050 2016-12-08 06:19 function.pg-lo-close.html
-rw-r--r--     28597 2016-12-08 06:19 mongodb.command.html
-rw-r--r--     24845 2016-12-08 06:20 extensions.membership.html
-rw-r--r--      3460 2016-12-08 06:18 phar.fileformat.phar.html
-rw-r--r--      7375 2016-12-08 06:20 reflectionmethod.getmodifiers.html
-rw-r--r--      3282 2016-12-08 06:19 function.gupnp-control-point-new.html
-rw-r--r--      2476 2016-12-08 06:19 datetimeimmutable.settimestamp.html
-rw-r--r--      2824 2016-12-08 06:19 class.swffontchar.html
-rw-r--r--     27757 2016-12-08 06:19 mysqlnduhconnection.getstatistics.html
-rw-r--r--      7290 2016-12-08 06:20 quickhashintstringhash.update.html
-rw-r--r--      4433 2016-12-08 06:19 function.fann-get-cascade-activation-functions.html
-rw-r--r--      1397 2016-12-08 06:19 net-gopher.configuration.html
-rw-r--r--      7361 2016-12-08 06:20 ds-deque.slice.html
-rw-r--r--      2503 2016-12-08 06:19 mysqli-warning.next.html
-rw-r--r--      2659 2016-12-08 06:19 function.trader-ema.html
-rw-r--r--      8055 2016-12-08 06:20 quickhashstringinthash.loadfromstring.html
-rw-r--r--     14484 2016-12-08 06:19 function.mysql-real-escape-string.html
-rw-r--r--     11788 2016-12-08 06:19 mysqlnd-qc.pattern-based-caching.html
-rw-r--r--      2728 2016-12-08 06:19 gearmanworker.geterrno.html
-rw-r--r--      2550 2016-12-08 06:19 yaf-loader.clearlocalnamespace.html
-rw-r--r--      7774 2016-12-08 06:19 function.ignore-user-abort.html
-rw-r--r--      7921 2016-12-08 06:19 mongodb-driver-readconcern.bsonserialize.html
-rw-r--r--      1858 2016-12-08 06:19 intro.shmop.html
-rw-r--r--      7745 2016-12-08 06:20 snmp.constants.html
-rw-r--r--      4339 2016-12-08 06:19 function.px-update-record.html
-rw-r--r--      3937 2016-12-08 06:20 oauth.settoken.html
-rw-r--r--      8259 2016-12-08 06:19 function.sqlsrv-num-rows.html
-rw-r--r--      4111 2016-12-08 06:19 function.maxdb-real-query.html
-rw-r--r--      2629 2016-12-08 06:19 datetimeimmutable.settime.html
-rw-r--r--      4285 2016-12-08 06:19 swfbutton.addaction.html
-rw-r--r--      3057 2016-12-08 06:19 function.imap-qprint.html
-rw-r--r--      4364 2016-12-08 06:19 function.posix-ctermid.html
-rw-r--r--      3228 2016-12-08 06:19 evperiodic.set.html
-rw-r--r--      2413 2016-12-08 06:20 internals2.buildsys.html
-rw-r--r--      2426 2016-12-08 06:19 splfixedarray.rewind.html
-rw-r--r--      9634 2016-12-08 06:18 dba.installation.html
-rw-r--r--      1340 2016-12-08 06:20 array.requirements.html
-rw-r--r--      3657 2016-12-08 06:19 function.rad2deg.html
-rw-r--r--      8029 2016-12-08 06:19 book.eio.html
-rw-r--r--     12732 2016-12-08 06:19 eventhttpconnection.makerequest.html
-rw-r--r--      4873 2016-12-08 06:20 function.vsprintf.html
-rw-r--r--      2803 2016-12-08 06:18 language.references.unset.html
-rw-r--r--      2119 2016-12-08 06:20 intro.array.html
-rw-r--r--     12343 2016-12-08 06:20 session.upload-progress.html
-rw-r--r--      2817 2016-12-08 06:19 swftextfield.addchars.html
-rw-r--r--      5306 2016-12-08 06:20 soapclient.getfunctions.html
-rw-r--r--      1591 2016-12-08 06:20 simplexml.setup.html
-rw-r--r--      1543 2016-12-08 06:20 stomp.requirements.html
-rw-r--r--      4543 2016-12-08 06:20 sessionhandler.read.html
-rw-r--r--      4297 2016-12-08 06:20 internals2.opcodes.brk.html
-rw-r--r--      7891 2016-12-08 06:19 function.eio-statvfs.html
-rw-r--r--      2573 2016-12-08 06:20 ref.nis.html
-rw-r--r--      2366 2016-12-08 06:19 class.gmp.html
-rw-r--r--      4542 2016-12-08 06:19 datetimeimmutable.createfrommutable.html
-rw-r--r--      5165 2016-12-08 06:18 function.radius-create-request.html
-rw-r--r--     10958 2016-12-08 06:19 numberformatter.getattribute.html
-rw-r--r--      2922 2016-12-08 06:19 recursiveiteratoriterator.getinneriterator.html
-rw-r--r--     11513 2016-12-08 06:19 mongoresultexception.getdocument.html
-rw-r--r--      4878 2016-12-08 06:19 memcached.deletemulti.html
-rw-r--r--      5558 2016-12-08 06:20 class.ui-control.html
-rw-r--r--      2215 2016-12-08 06:20 function.ui-quit.html
-rw-r--r--      2422 2016-12-08 06:20 varnishadmin.getparams.html
-rw-r--r--      9573 2016-12-08 06:19 imagickdraw.polyline.html
-rw-r--r--     21194 2016-12-08 06:20 internals2.opcodes.html
-rw-r--r--      3397 2016-12-08 06:18 function.dbplus-restorepos.html
-rw-r--r--      2678 2016-12-08 06:20 reflector.export.html
-rw-r--r--      3508 2016-12-08 06:19 class.cairolinejoin.html
-rw-r--r--      2015 2016-12-08 06:19 function.mysqli-connect.html
-rw-r--r--      2660 2016-12-08 06:18 ref.kadm5.html
-rw-r--r--     12735 2016-12-08 06:20 quickhash.examples.html
-rw-r--r--      2425 2016-12-08 06:19 judy.offsetunset.html
-rw-r--r--      2595 2016-12-08 06:19 book.spl-types.html
-rw-r--r--      9958 2016-12-08 06:20 function.strspn.html
-rw-r--r--      7938 2016-12-08 06:20 sca.examples.proxies.html
-rw-r--r--      3110 2016-12-08 06:20 reflectionfunctionabstract.clone.html
-rw-r--r--      3361 2016-12-08 06:20 solrinputdocument.merge.html
-rw-r--r--      2291 2016-12-08 06:19 book.net-gopher.html
-rw-r--r--      3150 2016-12-08 06:19 gmagick.setsize.html
-rw-r--r--      5728 2016-12-08 06:19 mysqlinfo.terminology.html
-rw-r--r--      2488 2016-12-08 06:19 function.pdf-close-pdi.html
-rw-r--r--      9163 2016-12-08 06:19 yaf-controller-abstract.forward.html
-rw-r--r--      7411 2016-12-08 06:19 yaf-action-abstract.execute.html
-rw-r--r--     31032 2016-12-08 06:20 ref.sdo.html
-rw-r--r--      3361 2016-12-08 06:19 function.jdtojulian.html
-rw-r--r--      5000 2016-12-08 06:19 cairocontext.pushgroup.html
-rw-r--r--     11299 2016-12-08 06:19 mysqlinfo.concepts.charset.html
-rw-r--r--      2546 2016-12-08 06:18 function.newt-form-get-current.html
-rw-r--r--      1670 2016-12-08 06:19 intro.cyrus.html
-rw-r--r--      1366 2016-12-08 06:19 inotify.requirements.html
-rw-r--r--     10925 2016-12-08 06:19 imagickdraw.setviewbox.html
-rw-r--r--      2925 2016-12-08 06:20 sdo-das-setting.getpropertyindex.html
-rw-r--r--      1368 2016-12-08 06:19 tokenizer.requirements.html
-rw-r--r--      6264 2016-12-08 06:19 misc.configuration.html
-rw-r--r--      3519 2016-12-08 06:20 domelement.getattribute.html
-rw-r--r--      6657 2016-12-08 06:19 intlchar.isuuppercase.html
-rw-r--r--      6159 2016-12-08 06:19 class.outofboundsexception.html
-rw-r--r--      2244 2016-12-08 06:19 mysqlnd-qc.installation.html
-rw-r--r--      6570 2016-12-08 06:20 domdocument.createattributens.html
-rw-r--r--      3264 2016-12-08 06:19 function.trader-cdlpiercing.html
-rw-r--r--     11091 2016-12-08 06:19 function.mssql-result.html
-rw-r--r--      2559 2016-12-08 06:20 ui-menu.appendabout.html
-rw-r--r--      2633 2016-12-08 06:19 mysqlnd-ms.concepts.html
-rw-r--r--      5054 2016-12-08 06:20 domcomment.construct.html
-rw-r--r--      6421 2016-12-08 06:18 phar.getmetadata.html
-rw-r--r--      1680 2016-12-08 06:19 intro.mssql.html
-rw-r--r--      2505 2016-12-08 06:19 intliterator.current.html
-rw-r--r--     15578 2016-12-08 06:19 class.arrayobject.html
-rw-r--r--     16048 2016-12-08 06:20 function.call-user-func.html
-rw-r--r--      3002 2016-12-08 06:19 hwapi.link.html
-rw-r--r--      8677 2016-12-08 06:18 function.fbsql-fetch-array.html
-rw-r--r--      2454 2016-12-08 06:20 solrquery.getstatsfacets.html
-rw-r--r--      3237 2016-12-08 06:20 reflectionparameter.allowsnull.html
-rw-r--r--      2645 2016-12-08 06:20 ui-draw-color.construct.html
-rw-r--r--      3231 2016-12-08 06:19 hwapi.find.html
-rw-r--r--      2601 2016-12-08 06:19 harupage.getcurrentfontsize.html
-rw-r--r--      2485 2016-12-08 06:19 function.pdf-add-textflow.html
-rw-r--r--      1347 2016-12-08 06:18 openal.requirements.html
-rw-r--r--      2741 2016-12-08 06:19 yaf-view-simple.display.html
-rw-r--r--      8619 2016-12-08 06:19 intlcalendar.isequivalentto.html
-rw-r--r--      4262 2016-12-08 06:19 splfixedarray.toarray.html
-rw-r--r--      2641 2016-12-08 06:19 function.pdf-add-table-cell.html
-rw-r--r--      4278 2016-12-08 06:20 extensions.state.html
-rw-r--r--      3512 2016-12-08 06:18 function.zip-entry-compressionmethod.html
-rw-r--r--      4783 2016-12-08 06:19 eventbuffer.pullup.html
-rw-r--r--      3107 2016-12-08 06:20 solrquery.sethighlightusephrasehighlighter.html
-rw-r--r--      1841 2016-12-08 06:20 internals2.opcodes.user-opcode.html
-rw-r--r--      8314 2016-12-08 06:19 function.ftp-get.html
-rw-r--r--      1660 2016-12-08 06:20 rrd.installation.html
-rw-r--r--      5584 2016-12-08 06:19 function.fileowner.html
-rw-r--r--      9642 2016-12-08 06:20 function.yaz-scan.html
-rw-r--r--      1327 2016-12-08 06:19 msql.examples.html
-rw-r--r--     10471 2016-12-08 06:19 messageformatter.parsemessage.html
-rw-r--r--      2942 2016-12-08 06:18 function.mcrypt-enc-is-block-algorithm.html
-rw-r--r--      2417 2016-12-08 06:20 function.msession-uniq.html
-rw-r--r--      6347 2016-12-08 06:19 function.lchgrp.html
-rw-r--r--      3438 2016-12-08 06:19 filteriterator.construct.html
-rw-r--r--      8016 2016-12-08 06:19 imagickpixeliterator.setiteratorrow.html
-rw-r--r--      6671 2016-12-08 06:19 function.gmp-div-qr.html
-rw-r--r--      6646 2016-12-08 06:19 mongocursor.setreadpreference.html
-rw-r--r--      2660 2016-12-08 06:19 mongoid.getinc.html
-rw-r--r--      3437 2016-12-08 06:20 function.yaz-error.html
-rw-r--r--      2683 2016-12-08 06:20 ref.session-pgsql.html
-rw-r--r--      7250 2016-12-08 06:19 function.pg-field-type-oid.html
-rw-r--r--      9070 2016-12-08 06:20 book.sdo.html
-rw-r--r--      5386 2016-12-08 06:19 yaf-dispatcher.registerplugin.html
-rw-r--r--      3399 2016-12-08 06:20 oauth.disabledebug.html
-rw-r--r--      5411 2016-12-08 06:19 cairocontext.pushgroupwithcontent.html
-rw-r--r--      3397 2016-12-08 06:20 reflectionproperty.isprivate.html
-rw-r--r--     18218 2016-12-08 06:20 function.array-column.html
-rw-r--r--      3873 2016-12-08 06:20 function.variant-not.html
-rw-r--r--      4205 2016-12-08 06:18 errorexception.getseverity.html
-rw-r--r--      3857 2016-12-08 06:19 mysqli.reap-async-query.html
-rw-r--r--      4778 2016-12-08 06:20 stomp.configuration.html
-rw-r--r--     37264 2016-12-08 06:18 apc.configuration.html
-rw-r--r--      3029 2016-12-08 06:19 class.yaf-exception-loadfailed-action.html
-rw-r--r--      3992 2016-12-08 06:20 domelement.setattributenodens.html
-rw-r--r--      3473 2016-12-08 06:19 function.stats-stat-noncentral-t.html
-rw-r--r--      5702 2016-12-08 06:19 function.gmp-scan1.html
-rw-r--r--      2081 2016-12-08 06:19 function.pdf-end-pattern.html
-rw-r--r--      2931 2016-12-08 06:19 mongoclient.connect.html
-rw-r--r--      4396 2016-12-08 06:20 yar-client.call.html
-rw-r--r--      2786 2016-12-08 06:19 recursiveiteratoriterator.valid.html
-rw-r--r--      2707 2016-12-08 06:20 ref.pcre.html
-rw-r--r--      3421 2016-12-08 06:20 internals2.opcodes.new.html
-rw-r--r--      2422 2016-12-08 06:19 cachingiterator.key.html
-rw-r--r--      4880 2016-12-08 06:19 paradox.constants.html
-rw-r--r--      3707 2016-12-08 06:20 domnode.issupported.html
-rw-r--r--      9031 2016-12-08 06:19 intlcalendar.getminimaldaysinfirstweek.html
-rw-r--r--      5047 2016-12-08 06:18 function.readline.html
-rw-r--r--      4119 2016-12-08 06:19 mongo.tutorial.insert.multiple.html
-rw-r--r--      9931 2016-12-08 06:19 function.mysqlnd-ms-get-last-used-connection.html
-rw-r--r--      1707 2016-12-08 06:20 intro.xmlreader.html
-rw-r--r--      3358 2016-12-08 06:20 function.yp-get-default-domain.html
-rw-r--r--      2734 2016-12-08 06:19 function.vpopmail-set-user-quota.html
-rw-r--r--      1511 2016-12-08 06:18 zip.setup.html
-rw-r--r--      3090 2016-12-08 06:20 migration52.errorrep.html
-rw-r--r--     22965 2016-12-08 06:19 mysqlnduhconnection.simplecommand.html
-rw-r--r--      2898 2016-12-08 06:19 function.pcntl-wifstopped.html
-rw-r--r--      2452 2016-12-08 06:20 solrobject.getpropertynames.html
-rw-r--r--      2966 2016-12-08 06:19 function.ldap-mod-del.html
-rw-r--r--      1404 2016-12-08 06:19 gmagick.configuration.html
-rw-r--r--      2324 2016-12-08 06:20 ui-controls-group.settitle.html
-rw-r--r--      4636 2016-12-08 06:19 book.misc.html
-rw-r--r--      7176 2016-12-08 06:19 datetimezone.listidentifiers.html
-rw-r--r--      2441 2016-12-08 06:19 yaf-session.wakeup.html
-rw-r--r--      2404 2016-12-08 06:20 migration51.html
-rw-r--r--      3004 2016-12-08 06:20 function.rrd-graph.html
-rw-r--r--      7944 2016-12-08 06:19 function.oci-num-fields.html
-rw-r--r--      2546 2016-12-08 06:19 taint.detail.untaint.html
-rw-r--r--      4519 2016-12-08 06:18 function.dbplus-rcreate.html
-rw-r--r--      3112 2016-12-08 06:19 splobserver.update.html
-rw-r--r--      7246 2016-12-08 06:20 quickhashinthash.loadfromstring.html
-rw-r--r--      6691 2016-12-08 06:19 function.dir.html
-rw-r--r--      6454 2016-12-08 06:20 function.ctype-upper.html
-rw-r--r--      2677 2016-12-08 06:20 solrclientexception.getinternalinfo.html
-rw-r--r--      8433 2016-12-08 06:20 ds-map.ksort.html
-rw-r--r--      2706 2016-12-08 06:20 solrquery.removefilterquery.html
-rw-r--r--      3098 2016-12-08 06:20 solrillegaloperationexception.getinternalinfo.html
-rw-r--r--      2405 2016-12-08 06:19 swfdisplayitem.getyscale.html
-rw-r--r--      3286 2016-12-08 06:20 var.configuration.html
-rw-r--r--     10224 2016-12-08 06:20 class.varnishadmin.html
-rw-r--r--      3623 2016-12-08 06:19 function.sybase-num-fields.html
-rw-r--r--      7897 2016-12-08 06:18 function.debug-print-backtrace.html
-rw-r--r--      3142 2016-12-08 06:20 domxpath.registernamespace.html
-rw-r--r--      3553 2016-12-08 06:19 eventbufferevent.enable.html
-rw-r--r--      3314 2016-12-08 06:19 sqlite3.escapestring.html
-rw-r--r--      5792 2016-12-08 06:18 function.ifx-affected-rows.html
-rw-r--r--      2308 2016-12-08 06:19 function.imagefontwidth.html
-rw-r--r--      7663 2016-12-08 06:19 function.geoip-record-by-name.html
-rw-r--r--      6066 2016-12-08 06:20 domdocument.load.html
-rw-r--r--      4489 2016-12-08 06:20 function.xmlwriter-set-indent-string.html
-rw-r--r--      5593 2016-12-08 06:20 quickhashinthash.update.html
-rw-r--r--      7314 2016-12-08 06:19 mongodb-driver-server.executecommand.html
-rw-r--r--      6167 2016-12-08 06:20 function.call-user-method.html
-rw-r--r--      2210 2016-12-08 06:19 function.pdf-setdashpattern.html
-rw-r--r--      2871 2016-12-08 06:18 weakref.valid.html
-rw-r--r--     30777 2016-12-08 06:20 migration56.new-features.html
-rw-r--r--      4726 2016-12-08 06:19 event.construct.html
-rw-r--r--      2606 2016-12-08 06:19 imagick.setfilename.html
-rw-r--r--      1540 2016-12-08 06:20 filter.setup.html
-rw-r--r--      5165 2016-12-08 06:19 mongodb-bson-binary.construct.html
-rw-r--r--      2786 2016-12-08 06:19 spldoublylinkedlist.pop.html
-rw-r--r--      2776 2016-12-08 06:19 function.pdf-set-border-color.html
-rw-r--r--     10196 2016-12-08 06:19 function.mysql-result.html
-rw-r--r--      4178 2016-12-08 06:19 imagick.despeckleimage.html
-rw-r--r--      4573 2016-12-08 06:19 imagick.blueshiftimage.html
-rw-r--r--      3341 2016-12-08 06:19 function.is-finite.html
-rw-r--r--      7104 2016-12-08 06:20 function.count-chars.html
-rw-r--r--     16528 2016-12-08 06:20 class.oauth.html
-rw-r--r--      3066 2016-12-08 06:19 recursiveiteratoriterator.beginiteration.html
-rw-r--r--      3069 2016-12-08 06:19 eventbuffer.freeze.html
-rw-r--r--      3111 2016-12-08 06:20 function.snmp-get-quick-print.html
-rw-r--r--      2168 2016-12-08 06:18 function.dba-list.html
-rw-r--r--      3648 2016-12-08 06:18 function.ibase-blob-cancel.html
-rw-r--r--      6718 2016-12-08 06:19 function.eio-fallocate.html
-rw-r--r--      9177 2016-12-08 06:19 memcached.set.html
-rw-r--r--      2503 2016-12-08 06:20 solrresponse.getdigestedresponse.html
-rw-r--r--      2346 2016-12-08 06:18 function.radius-strerror.html
-rw-r--r--      2849 2016-12-08 06:19 function.vpopmail-passwd.html
-rw-r--r--      2525 2016-12-08 06:19 hwapi.object-count.html
-rw-r--r--      2884 2016-12-08 06:18 apcuiterator.rewind.html
-rw-r--r--      4608 2016-12-08 06:19 evembed.createstopped.html
-rw-r--r--      7263 2016-12-08 06:19 memcache.decrement.html
-rw-r--r--      4539 2016-12-08 06:20 xsltprocessor.construct.html
-rw-r--r--      2578 2016-12-08 06:20 sdo-das-xml-document.getrootelementname.html
-rw-r--r--      2027 2016-12-08 06:19 ref.fileinfo.html
-rw-r--r--      4836 2016-12-08 06:19 function.cairo-font-options-set-antialias.html
-rw-r--r--      2532 2016-12-08 06:19 expect.installation.html
-rw-r--r--      2458 2016-12-08 06:19 function.trader-ht-sine.html
-rw-r--r--      6580 2016-12-08 06:19 function.getservbyname.html
-rw-r--r--      6088 2016-12-08 06:20 ds-map.apply.html
-rw-r--r--      5077 2016-12-08 06:19 function.px-retrieve-record.html
-rw-r--r--      7771 2016-12-08 06:19 function.pg-escape-string.html
-rw-r--r--      4740 2016-12-08 06:19 function.cairo-pattern-set-matrix.html
-rw-r--r--      4041 2016-12-08 06:19 syncreaderwriter.readunlock.html
-rw-r--r--      5059 2016-12-08 06:19 cairocontext.glyphpath.html
-rw-r--r--      2341 2016-12-08 06:19 imagick.getimageheight.html
-rw-r--r--      3506 2016-12-08 06:19 arrayiterator.offsetget.html
-rw-r--r--      6759 2016-12-08 06:18 phar.setsignaturealgorithm.html
-rw-r--r--      5634 2016-12-08 06:20 function.snmpgetnext.html
-rw-r--r--      3689 2016-12-08 06:20 solrinputdocument.haschilddocuments.html
-rw-r--r--      2074 2016-12-08 06:20 tcpwrap.installation.html
-rw-r--r--      5291 2016-12-08 06:18 function.apd-set-session-trace-socket.html
-rw-r--r--      6501 2016-12-08 06:19 imagick.scaleimage.html
-rw-r--r--      3665 2016-12-08 06:20 reflectionextension.tostring.html
-rw-r--r--      2845 2016-12-08 06:18 function.newt-checkbox-tree-get-current.html
-rw-r--r--      3996 2016-12-08 06:18 pharfileinfo.hasmetadata.html
-rw-r--r--      3299 2016-12-08 06:18 apcuiterator.gettotalsize.html
-rw-r--r--      2624 2016-12-08 06:20 function.oauth-urlencode.html
-rw-r--r--      4955 2016-12-08 06:19 function.cairo-ps-surface-set-size.html
-rw-r--r--      3287 2016-12-08 06:20 reflectionparameter.ispassedbyreference.html
-rw-r--r--      3975 2016-12-08 06:19 harudoc.setpassword.html
-rw-r--r--      4492 2016-12-08 06:19 harufont.measuretext.html
-rw-r--r--      4677 2016-12-08 06:19 cairoimagesurface.getwidth.html
-rw-r--r--      2986 2016-12-08 06:18 function.ibase-commit.html
-rw-r--r--      5975 2016-12-08 06:20 ref.com.html
-rw-r--r--      1354 2016-12-08 06:18 filepro.requirements.html
-rw-r--r--      2822 2016-12-08 06:19 mongocursor.key.html
-rw-r--r--      1353 2016-12-08 06:20 session.resources.html
-rw-r--r--      2621 2016-12-08 06:19 yaf-response-abstract.construct.html
-rw-r--r--      7648 2016-12-08 06:19 cairosvgsurface.getversions.html
-rw-r--r--      1325 2016-12-08 06:20 sca.resources.html
-rw-r--r--      2008 2016-12-08 06:19 function.pdf-get-errmsg.html
-rw-r--r--      2184 2016-12-08 06:20 function.msession-unlock.html
-rw-r--r--      5524 2016-12-08 06:20 ds-deque.sum.html
-rw-r--r--      3376 2016-12-08 06:19 gmagick.embossimage.html
-rw-r--r--      1793 2016-12-08 06:20 function.is-integer.html
-rw-r--r--      1530 2016-12-08 06:19 curl.setup.html
-rw-r--r--     10828 2016-12-08 06:19 function.sqlsrv-errors.html
-rw-r--r--      3166 2016-12-08 06:19 function.unixtojd.html
-rw-r--r--      4932 2016-12-08 06:20 sca.examples.nonscascript.html
-rw-r--r--      6833 2016-12-08 06:19 imagick.adaptiveblurimage.html
-rw-r--r--      5764 2016-12-08 06:19 function.imap-getsubscribed.html
-rw-r--r--      2335 2016-12-08 06:19 mongo.trouble.html
-rw-r--r--      2993 2016-12-08 06:19 splfileobject.haschildren.html
-rw-r--r--      2471 2016-12-08 06:18 function.ncurses-standout.html
-rw-r--r--      7376 2016-12-08 06:19 function.touch.html
-rw-r--r--      3740 2016-12-08 06:19 function.msql-create-db.html
-rw-r--r--      2195 2016-12-08 06:19 directory.read.html
-rw-r--r--      5240 2016-12-08 06:19 splobjectstorage.addall.html
-rw-r--r--      3932 2016-12-08 06:18 function.mcrypt-ecb.html
-rw-r--r--      3734 2016-12-08 06:19 cairoscaledfont.getctm.html
-rw-r--r--      3160 2016-12-08 06:19 imagickdraw.settextencoding.html
-rw-r--r--     14854 2016-12-08 06:20 appendices.html
-rw-r--r--      1568 2016-12-08 06:19 expect.resources.html
-rw-r--r--      8995 2016-12-08 06:19 function.imagegrabwindow.html
-rw-r--r--      2419 2016-12-08 06:20 ui-controls-multilineentry.isreadonly.html
-rw-r--r--      1488 2016-12-08 06:19 fam.requirements.html
-rw-r--r--      1255 2016-12-08 06:20 apache.constants.html
-rw-r--r--      2870 2016-12-08 06:20 internals2.opcodes.assign-sub.html
-rw-r--r--      5666 2016-12-08 06:19 yaf-response-abstract.prependbody.html
-rw-r--r--      3886 2016-12-08 06:19 gmagick.shearimage.html
-rw-r--r--      5907 2016-12-08 06:20 win32service.examples.html
-rw-r--r--      9439 2016-12-08 06:19 mysqlnduhconnection.geterrornumber.html
-rw-r--r--      2267 2016-12-08 06:18 generator.current.html
-rw-r--r--      6915 2016-12-08 06:18 function.cubrid-save-to-glo.html
-rw-r--r--      8481 2016-12-08 06:19 locale.getdisplayvariant.html
-rw-r--r--      1748 2016-12-08 06:18 function.gzputs.html
-rw-r--r--      3327 2016-12-08 06:19 function.trader-cdlidentical3crows.html
-rw-r--r--      2207 2016-12-08 06:20 ui-draw-matrix.isinvertible.html
-rw-r--r--      3163 2016-12-08 06:19 hwapi.objectbyanchor.html
-rw-r--r--      1332 2016-12-08 06:19 tidy.resources.html
-rw-r--r--      8975 2016-12-08 06:20 domdocument.importnode.html
-rw-r--r--      2671 2016-12-08 06:19 mongocursorexception.gethost.html
-rw-r--r--      2519 2016-12-08 06:20 rrdgraph.save.html
-rw-r--r--      4509 2016-12-08 06:20 function.xmlwriter-write-cdata.html
-rw-r--r--      2374 2016-12-08 06:20 ui-window.setsize.html
-rw-r--r--      2188 2016-12-08 06:19 function.maxdb-disable-rpl-parse.html
-rw-r--r--      5654 2016-12-08 06:20 function.variant-imp.html
-rw-r--r--      4779 2016-12-08 06:19 mysqli-stmt.next-result.html
-rw-r--r--     15281 2016-12-08 06:20 solrinputdocument.addchilddocuments.html
-rw-r--r--      4827 2016-12-08 06:19 book.pcntl.html
-rw-r--r--     11254 2016-12-08 06:20 class.quickhashstringinthash.html
-rw-r--r--      4517 2016-12-08 06:19 function.gnupg-cleardecryptkeys.html
-rw-r--r--      2471 2016-12-08 06:18 id3v2tag.addframe.html
-rw-r--r--      2909 2016-12-08 06:19 mqseries.configure.html
-rw-r--r--      6236 2016-12-08 06:20 function.udm-cat-path.html
-rw-r--r--      8836 2016-12-08 06:19 imagickdraw.push.html
-rw-r--r--      3610 2016-12-08 06:18 function.apc-compile-file.html
-rw-r--r--      3108 2016-12-08 06:20 sphinxclient.setconnecttimeout.html
-rw-r--r--      2662 2016-12-08 06:19 hwapi.object-attreditable.html
-rw-r--r--      6393 2016-12-08 06:20 solrdismaxquery.removetrigramphrasefield.html
-rw-r--r--      6957 2016-12-08 06:20 class.snmpexception.html
-rw-r--r--     11903 2016-12-08 06:19 class.evio.html
-rw-r--r--      6793 2016-12-08 06:20 migration52.classes.html
-rw-r--r--      6530 2016-12-08 06:19 function.time-sleep-until.html
-rw-r--r--     12639 2016-12-08 06:19 mysqli-stmt.num-rows.html
-rw-r--r--      2564 2016-12-08 06:19 taint.detail.basic.html
-rw-r--r--      1390 2016-12-08 06:19 parsekit.configuration.html
-rw-r--r--      7015 2016-12-08 06:20 reflectionclass.innamespace.html
-rw-r--r--      5908 2016-12-08 06:18 function.fbsql-next-result.html
-rw-r--r--      4244 2016-12-08 06:20 ds-vector.reversed.html
-rw-r--r--      7158 2016-12-08 06:20 com.configuration.html
-rw-r--r--      3646 2016-12-08 06:19 splpriorityqueue.compare.html
-rw-r--r--      2965 2016-12-08 06:18 phar.getversion.html
-rw-r--r--      4994 2016-12-08 06:20 reflectionclass.getextension.html
-rw-r--r--      2283 2016-12-08 06:19 function.pdf-get-minorversion.html
-rw-r--r--      2642 2016-12-08 06:19 function.mysqli-master-query.html
-rw-r--r--      5671 2016-12-08 06:18 function.dbase-numrecords.html
-rw-r--r--      2730 2016-12-08 06:19 harupage.getcurrentpos.html
-rw-r--r--      4537 2016-12-08 06:19 function.inotify-read.html
-rw-r--r--      3676 2016-12-08 06:20 xmlreader.movetofirstattribute.html
-rw-r--r--      2541 2016-12-08 06:20 soapvar.construct.html
-rw-r--r--      4804 2016-12-08 06:19 splfileobject.getmaxlinelen.html
-rw-r--r--      9289 2016-12-08 06:19 class.evidle.html
-rw-r--r--     10107 2016-12-08 06:18 phardata.converttodata.html
-rw-r--r--      1293 2016-12-08 06:18 blenc.resources.html
-rw-r--r--      4839 2016-12-08 06:19 function.eio-unlink.html
-rw-r--r--      1339 2016-12-08 06:19 iconv.resources.html
-rw-r--r--      1557 2016-12-08 06:19 hwapi.setup.html
-rw-r--r--      5518 2016-12-08 06:20 domattr.construct.html
-rw-r--r--      5440 2016-12-08 06:20 ds-sequence.apply.html
-rw-r--r--      2426 2016-12-08 06:20 ui-control.gettoplevel.html
-rw-r--r--      2044 2016-12-08 06:19 function.date-create-immutable.html
-rw-r--r--      4052 2016-12-08 06:20 soapserver.setclass.html
-rw-r--r--      5932 2016-12-08 06:19 intro.mysqlnd-memcache.html
-rw-r--r--     48546 2016-12-08 06:19 parsekit.constants.html
-rw-r--r--     39790 2016-12-08 06:20 class.domdocument.html
-rw-r--r--      1288 2016-12-08 06:18 bcompiler.constants.html
-rw-r--r--     13278 2016-12-08 06:20 function.strpos.html
-rw-r--r--      6516 2016-12-08 06:19 memcache.delete.html
-rw-r--r--      3952 2016-12-08 06:18 security.hiding.html
-rw-r--r--     17838 2016-12-08 06:19 mysqli-stmt.get-result.html
-rw-r--r--      7182 2016-12-08 06:20 oauthprovider.construct.html
-rw-r--r--      2918 2016-12-08 06:19 mongogridfscursor.key.html
-rw-r--r--      2756 2016-12-08 06:19 function.trader-kama.html
-rw-r--r--      3444 2016-12-08 06:19 recursivetreeiterator.setprefixpart.html
-rw-r--r--      3551 2016-12-08 06:20 xmlreader.setparserproperty.html
-rw-r--r--      4036 2016-12-08 06:18 configuration.changes.modes.html
-rw-r--r--      7486 2016-12-08 06:19 function.imagecolorresolvealpha.html
-rw-r--r--      2958 2016-12-08 06:20 quickhashintstringhash.exists.html
-rw-r--r--     12900 2016-12-08 06:19 class.seekableiterator.html
-rw-r--r--      3895 2016-12-08 06:20 sca.examples.structure.html
-rw-r--r--      5280 2016-12-08 06:20 stomp.send.html
-rw-r--r--      6456 2016-12-08 06:19 imagick.adaptivesharpenimage.html
-rw-r--r--      2176 2016-12-08 06:18 function.newt-cursor-on.html
-rw-r--r--      5220 2016-12-08 06:19 function.intl-error-name.html
-rw-r--r--      3594 2016-12-08 06:19 ref.xdiff.html
-rw-r--r--      1386 2016-12-08 06:19 enchant.configuration.html
-rw-r--r--      1538 2016-12-08 06:18 uodbc.setup.html
-rw-r--r--      2750 2016-12-08 06:19 function.fann-get-network-type.html
-rw-r--r--      5524 2016-12-08 06:18 function.cubrid-error-msg.html
-rw-r--r--      3304 2016-12-08 06:20 ui-draw-path.bezierto.html
-rw-r--r--      5554 2016-12-08 06:19 function.mb-substr-count.html
-rw-r--r--      1521 2016-12-08 06:18 ncurses.requirements.html
-rw-r--r--      3340 2016-12-08 06:20 class.yar-server.html
-rw-r--r--      5644 2016-12-08 06:19 mongoclient.getwriteconcern.html
-rw-r--r--      8891 2016-12-08 06:18 language.oop5.cloning.html
-rw-r--r--      5947 2016-12-08 06:19 function.fann-set-activation-steepness.html
-rw-r--r--      5237 2016-12-08 06:20 soapclient.setlocation.html
-rw-r--r--      2501 2016-12-08 06:19 yaf-config-ini.rewind.html
-rw-r--r--      1576 2016-12-08 06:18 readline.setup.html
-rw-r--r--      8684 2016-12-08 06:19 recursivedirectoryiterator.construct.html
-rw-r--r--      2633 2016-12-08 06:19 mongocollection.validate.html
-rw-r--r--      1488 2016-12-08 06:20 svm.setup.html
-rw-r--r--      5253 2016-12-08 06:19 function.imap-listscan.html
-rw-r--r--      5406 2016-12-08 06:19 cairocontext.setscaledfont.html
-rw-r--r--      3046 2016-12-08 06:19 eventhttprequest.gethost.html
-rw-r--r--      2868 2016-12-08 06:18 rarentry.getcrc.html
-rw-r--r--      3047 2016-12-08 06:19 imagick.setimageblueprimary.html
-rw-r--r--      3332 2016-12-08 06:19 class.swfmorph.html
-rw-r--r--      3297 2016-12-08 06:20 sdo-model-type.getbasetype.html
-rw-r--r--      2579 2016-12-08 06:20 function.rrd-lastupdate.html
-rw-r--r--     16682 2016-12-08 06:19 function.proc-open.html
-rw-r--r--     11765 2016-12-08 06:19 yaf-router.addroute.html
-rw-r--r--      2148 2016-12-08 06:19 function.ocicollsize.html
-rw-r--r--      3561 2016-12-08 06:19 function.fann-set-rprop-decrease-factor.html
-rw-r--r--      5991 2016-12-08 06:19 class.harudestination.html
-rw-r--r--      8686 2016-12-08 06:19 function.imagettftext.html
-rw-r--r--      6256 2016-12-08 06:19 splobjectstorage.offsetunset.html
-rw-r--r--      2928 2016-12-08 06:19 harupage.getwordspace.html
-rw-r--r--      2492 2016-12-08 06:19 collectable.isgarbage.html
-rw-r--r--      8950 2016-12-08 06:20 book.quickhash.html
-rw-r--r--      1421 2016-12-08 06:20 win32service.configuration.html
-rw-r--r--      1708 2016-12-08 06:18 htscanner.installation.html
-rw-r--r--      1346 2016-12-08 06:20 libxml.resources.html
-rw-r--r--      3625 2016-12-08 06:18 reserved.variables.phperrormsg.html
-rw-r--r--      5598 2016-12-08 06:19 streamwrapper.stream-seek.html
-rw-r--r--      2690 2016-12-08 06:19 function.eio-npending.html
-rw-r--r--     15376 2016-12-08 06:18 function.cubrid-connect-with-url.html
-rw-r--r--      7546 2016-12-08 06:19 recursiveregexiterator.getchildren.html
-rw-r--r--      3025 2016-12-08 06:19 function.cyrus-connect.html
-rw-r--r--      1938 2016-12-08 06:18 function.require.html
-rw-r--r--      5080 2016-12-08 06:19 gupnp-service-proxy-send-action.html
-rw-r--r--      6040 2016-12-08 06:19 class.yaf-route-simple.html
-rw-r--r--     11148 2016-12-08 06:19 function.mysqlnd-memcache-set.html
-rw-r--r--      5584 2016-12-08 06:19 cairocontext.relmoveto.html
-rw-r--r--      5075 2016-12-08 06:19 function.gmp-mod.html
-rw-r--r--      2815 2016-12-08 06:19 function.stats-stat-powersum.html
-rw-r--r--      3663 2016-12-08 06:19 function.trader-mavp.html
-rw-r--r--     10688 2016-12-08 06:19 function.eio-mknod.html
-rw-r--r--      4950 2016-12-08 06:19 function.cairo-ps-surface-create.html
-rw-r--r--      2805 2016-12-08 06:19 swftextfield.setrightmargin.html
-rw-r--r--      2992 2016-12-08 06:18 function.m-setssl-cafile.html
-rw-r--r--      7539 2016-12-08 06:19 imagick.setimageartifact.html
-rw-r--r--      8691 2016-12-08 06:18 function.cubrid-col-get.html
-rw-r--r--      2399 2016-12-08 06:19 imagickdraw.resetvectorgraphics.html
-rw-r--r--     16779 2016-12-08 06:19 function.eio-readdir.html
-rw-r--r--      3269 2016-12-08 06:20 solrquery.sethighlightfragmenter.html
-rw-r--r--      8932 2016-12-08 06:19 intldateformatter.gettimezoneid.html
-rw-r--r--      2282 2016-12-08 06:20 function.msession-find.html
-rw-r--r--      7789 2016-12-08 06:19 gearmanworker.addfunction.html
-rw-r--r--      2634 2016-12-08 06:18 ref.pdo-dblib.html
-rw-r--r--      3499 2016-12-08 06:19 transliterator.construct.html
-rw-r--r--      5127 2016-12-08 06:19 memcached.callbacks.result.html
-rw-r--r--      2805 2016-12-08 06:19 spldoublylinkedlist.top.html
-rw-r--r--      2723 2016-12-08 06:19 imagick.setgravity.html
-rw-r--r--      2505 2016-12-08 06:19 imagickdraw.gettextinterlinespacing.html
-rw-r--r--      5150 2016-12-08 06:20 book.xmlreader.html
-rw-r--r--      7386 2016-12-08 06:19 function.mysql-close.html
-rw-r--r--      3637 2016-12-08 06:18 function.dbplus-flush.html
-rw-r--r--      2865 2016-12-08 06:19 mongogridfsfile.construct.html
-rw-r--r--      2820 2016-12-08 06:20 xmldiff-memory.diff.html
-rw-r--r--     10020 2016-12-08 06:18 pdo.query.html
-rw-r--r--      6309 2016-12-08 06:19 image.examples-watermark.html
-rw-r--r--     17877 2016-12-08 06:18 pdo.prepared-statements.html
-rw-r--r--      1456 2016-12-08 06:18 phar.creating.html
-rw-r--r--      1326 2016-12-08 06:18 pdo.requirements.html
-rw-r--r--      8667 2016-12-08 06:20 ds-hashable.hash.html
-rw-r--r--      2243 2016-12-08 06:18 bcompiler.installation.html
-rw-r--r--     16414 2016-12-08 06:19 datetime.construct.html
-rw-r--r--      6841 2016-12-08 06:18 function.ibase-num-fields.html
-rw-r--r--      2564 2016-12-08 06:19 function.pdf-fill-textblock.html
-rw-r--r--      3817 2016-12-08 06:19 mbstring.ja-basic.html
-rw-r--r--      3034 2016-12-08 06:19 function.fann-copy.html
-rw-r--r--      2340 2016-12-08 06:19 function.maxdb-thread-safe.html
-rw-r--r--      7737 2016-12-08 06:19 dateperiod.getenddate.html
-rw-r--r--      2937 2016-12-08 06:19 ev.stop.html
-rw-r--r--     10749 2016-12-08 06:20 function.strtok.html
-rw-r--r--      6400 2016-12-08 06:19 cairofontface.status.html
-rw-r--r--      7539 2016-12-08 06:18 function.cubrid-is-instance.html
-rw-r--r--      6990 2016-12-08 06:20 function.session-set-cookie-params.html
-rw-r--r--      6706 2016-12-08 06:19 function.proc-get-status.html
-rw-r--r--      3687 2016-12-08 06:18 function.id3-get-frame-short-name.html
-rw-r--r--      2515 2016-12-08 06:20 ui-draw-matrix.rotate.html
-rw-r--r--      4812 2016-12-08 06:19 mongodb-bson-binary.getdata.html
-rw-r--r--      2724 2016-12-08 06:18 function.m-transinqueue.html
-rw-r--r--      3036 2016-12-08 06:19 function.oci-free-descriptor.html
-rw-r--r--      1919 2016-12-08 06:19 function.date-date-set.html
-rw-r--r--      3693 2016-12-08 06:18 function.ncurses-getmaxyx.html
-rw-r--r--      2334 2016-12-08 06:19 imagick.clipimage.html
-rw-r--r--      2871 2016-12-08 06:20 internals2.opcodes.pre-dec.html
-rw-r--r--      3255 2016-12-08 06:18 function.mcrypt-module-get-algo-key-size.html
-rw-r--r--      7093 2016-12-08 06:19 mysqli-stmt.attr-set.html
-rw-r--r--     62698 2016-12-08 06:20 migration70.incompatible.html
-rw-r--r--      6811 2016-12-08 06:20 zookeeper.getacl.html
-rw-r--r--      3243 2016-12-08 06:18 cubrid.resources.html
-rw-r--r--      4834 2016-12-08 06:19 function.posix-getgid.html
-rw-r--r--      4125 2016-12-08 06:18 function.fbsql-stop-db.html
-rw-r--r--      2922 2016-12-08 06:19 harupage.getlinewidth.html
-rw-r--r--      5521 2016-12-08 06:20 function.yaz-sort.html
-rw-r--r--      7125 2016-12-08 06:20 swish.constants.html
-rw-r--r--      2208 2016-12-08 06:20 ui-draw-pen.clip.html
-rw-r--r--      5960 2016-12-08 06:19 function.date-sun-info.html
-rw-r--r--      7418 2016-12-08 06:20 zookeeper.setacl.html
-rw-r--r--      5415 2016-12-08 06:19 harupage.textrect.html
-rw-r--r--     42123 2016-12-08 06:19 sqlsrv.constants.html
-rw-r--r--      4219 2016-12-08 06:20 sdo-list.insert.html
-rw-r--r--      1551 2016-12-08 06:18 dbplus.constants.html
-rw-r--r--      7908 2016-12-08 06:20 function.crc32.html
-rw-r--r--      5173 2016-12-08 06:19 function.gnupg-export.html
-rw-r--r--      3258 2016-12-08 06:19 function.trader-cdlhammer.html
-rw-r--r--     11278 2016-12-08 06:19 function.eio-fstat.html
-rw-r--r--      1598 2016-12-08 06:19 mysqlnd-memcache.setup.html
-rw-r--r--      3311 2016-12-08 06:20 class.reflectiontype.html
-rw-r--r--      3308 2016-12-08 06:20 sdo-das-datafactory.getdatafactory.html
-rw-r--r--      3384 2016-12-08 06:18 function.ncurses-clrtoeol.html
-rw-r--r--      1537 2016-12-08 06:20 nsapi.setup.html
-rw-r--r--      6558 2016-12-08 06:20 function.rsort.html
-rw-r--r--      3445 2016-12-08 06:19 harudoc.getstreamsize.html
-rw-r--r--      2552 2016-12-08 06:19 yaf-application.run.html
-rw-r--r--      3963 2016-12-08 06:20 function.session-save-path.html
-rw-r--r--      2939 2016-12-08 06:19 harupage.getgraystroke.html
-rw-r--r--      1682 2016-12-08 06:18 xhprof.installation.html
-rw-r--r--      2814 2016-12-08 06:19 yaf-loader.setlibrarypath.html
-rw-r--r--      2127 2016-12-08 06:18 intro.mhash.html
-rw-r--r--      8862 2016-12-08 06:19 class.cairofontoptions.html
-rw-r--r--      2623 2016-12-08 06:19 function.pdf-begin-page.html
-rw-r--r--      2954 2016-12-08 06:20 function.svn-repos-create.html
-rw-r--r--     19953 2016-12-08 06:19 class.gmagickdraw.html
-rw-r--r--      9410 2016-12-08 06:19 mongodb-driver-writeconcern.construct.html
-rw-r--r--      2995 2016-12-08 06:19 datetime.wakeup.html
-rw-r--r--      3088 2016-12-08 06:20 solrutils.escapequerychars.html
-rw-r--r--      1367 2016-12-08 06:20 zookeeper.resources.html
-rw-r--r--      2676 2016-12-08 06:19 yaf-dispatcher.setdefaultaction.html
-rw-r--r--      1358 2016-12-08 06:20 nis.configuration.html
-rw-r--r--      1555 2016-12-08 06:19 exec.setup.html
-rw-r--r--      4461 2016-12-08 06:19 function.cairo-surface-show-page.html
-rw-r--r--      8075 2016-12-08 06:19 dateinterval.construct.html
-rw-r--r--      1450 2016-12-08 06:19 mqseries.ini.html
-rw-r--r--      5061 2016-12-08 06:19 mongoclient.listdbs.html
-rw-r--r--      3132 2016-12-08 06:19 function.px-get-field.html
-rw-r--r--      4641 2016-12-08 06:20 domelement.setidattribute.html
-rw-r--r--      3013 2016-12-08 06:19 swffill.moveto.html
-rw-r--r--      5626 2016-12-08 06:19 imagick.trimimage.html
-rw-r--r--      6658 2016-12-08 06:18 function.hash-equals.html
-rw-r--r--      1524 2016-12-08 06:18 intro.id3.html
-rw-r--r--      4723 2016-12-08 06:19 threaded.unlock.html
-rw-r--r--      1354 2016-12-08 06:20 sockets.requirements.html
-rw-r--r--      6947 2016-12-08 06:18 info.constants.html
-rw-r--r--      4330 2016-12-08 06:20 sphinxclient.setmatchmode.html
-rw-r--r--      4684 2016-12-08 06:19 function.recode-string.html
-rw-r--r--      6561 2016-12-08 06:19 imagick.normalizeimage.html
-rw-r--r--     12365 2016-12-08 06:19 mysqli-result.lengths.html
-rw-r--r--      4561 2016-12-08 06:19 evloop.defaultloop.html
-rw-r--r--      6086 2016-12-08 06:19 locale.getdefault.html
-rw-r--r--      1514 2016-12-08 06:20 xml.examples.html
-rw-r--r--      2453 2016-12-08 06:18 reserved.variables.httprawpostdata.html
-rw-r--r--     16245 2016-12-08 06:18 function.mcrypt-encrypt.html
-rw-r--r--      9687 2016-12-08 06:18 ref.pdo-odbc.html
-rw-r--r--      7307 2016-12-08 06:18 phar.copy.html
-rw-r--r--      4108 2016-12-08 06:20 function.xmlwriter-end-pi.html
-rw-r--r--      6616 2016-12-08 06:19 function.posix-getgrnam.html
-rw-r--r--      2125 2016-12-08 06:18 openssl.constants.html
-rw-r--r--     13042 2016-12-08 06:18 language.types.callable.html
-rw-r--r--      4975 2016-12-08 06:19 sqlite.installation.html
-rw-r--r--      2095 2016-12-08 06:18 ref.opcache.html
-rw-r--r--      5817 2016-12-08 06:20 reflectionclass.tostring.html
-rw-r--r--      4446 2016-12-08 06:19 function.gnupg-clearsignkeys.html
-rw-r--r--      1510 2016-12-08 06:19 pdf.setup.html
-rw-r--r--      4646 2016-12-08 06:19 function.cairo-matrix-rotate.html
-rw-r--r--      1413 2016-12-08 06:18 ref.rar.html
-rw-r--r--      3399 2016-12-08 06:19 swfdisplayitem.setdepth.html
-rw-r--r--      3798 2016-12-08 06:18 function.uopz-overload.html
-rw-r--r--      4208 2016-12-08 06:18 phardata.setstub.html
-rw-r--r--      4431 2016-12-08 06:20 function.convert-uuencode.html
-rw-r--r--      3127 2016-12-08 06:20 solrquery.sethighlightmaxanalyzedchars.html
-rw-r--r--      3124 2016-12-08 06:18 function.newt-listbox-set-entry.html
-rw-r--r--      6917 2016-12-08 06:19 memcache.add.html
-rw-r--r--      2866 2016-12-08 06:20 internals2.opcodes.pre-inc.html
-rw-r--r--      3092 2016-12-08 06:19 function.stats-dens-negative-binomial.html
-rw-r--r--      4594 2016-12-08 06:20 domcharacterdata.insertdata.html
-rw-r--r--      1789 2016-12-08 06:20 internals2.opcodes.ext-nop.html
-rw-r--r--      3312 2016-12-08 06:19 oci-collection.assign.html
-rw-r--r--      7095 2016-12-08 06:19 function.enchant-dict-quick-check.html
-rw-r--r--      5268 2016-12-08 06:19 class.haruencoder.html
-rw-r--r--      6342 2016-12-08 06:20 swishresults.seekresult.html
-rw-r--r--      7432 2016-12-08 06:19 function.ingres-fetch-row.html
-rw-r--r--      2667 2016-12-08 06:19 harupage.getcmykstroke.html
-rw-r--r--      3072 2016-12-08 06:18 function.openssl-dh-compute-key.html
-rw-r--r--      1945 2016-12-08 06:19 ref.cyrus.html
-rw-r--r--      2105 2016-12-08 06:19 function.ocierror.html
-rw-r--r--      3785 2016-12-08 06:19 function.fann-set-sarprop-step-error-threshold-factor.html
-rw-r--r--      8673 2016-12-08 06:19 class.mongodb-driver-exception-writeexception.html
-rw-r--r--      2989 2016-12-08 06:20 solrquery.setmltmintermfrequency.html
-rw-r--r--      1270 2016-12-08 06:20 zookeeper.constants.html
-rw-r--r--      6164 2016-12-08 06:19 function.trader-sarext.html
-rw-r--r--      2683 2016-12-08 06:18 function.readline-write-history.html
-rw-r--r--     18484 2016-12-08 06:18 zip.examples.html
-rw-r--r--      3095 2016-12-08 06:19 function.enchant-dict-check.html
-rw-r--r--      2784 2016-12-08 06:18 function.ncurses-attrset.html
-rw-r--r--      5891 2016-12-08 06:19 directoryiterator.getatime.html
-rw-r--r--      4664 2016-12-08 06:19 function.expect-popen.html
-rw-r--r--      7723 2016-12-08 06:20 function.socket-read.html
-rw-r--r--      4625 2016-12-08 06:19 splfileinfo.tostring.html
-rw-r--r--      5503 2016-12-08 06:19 function.mt-getrandmax.html
-rw-r--r--      2853 2016-12-08 06:19 swftextfield.setleftmargin.html
-rw-r--r--      9318 2016-12-08 06:18 configuration.changes.html
-rw-r--r--      5493 2016-12-08 06:19 cairocontext.infill.html
-rw-r--r--      5670 2016-12-08 06:20 function.ssh2-sftp-symlink.html
-rw-r--r--     11934 2016-12-08 06:20 function.array-walk.html
-rw-r--r--      4138 2016-12-08 06:20 reflectionextension.getversion.html
-rw-r--r--      2651 2016-12-08 06:19 function.ming-setswfcompression.html
-rw-r--r--      9393 2016-12-08 06:20 function.property-exists.html
-rw-r--r--      3657 2016-12-08 06:18 security.html
-rw-r--r--      3832 2016-12-08 06:18 function.zip-read.html
-rw-r--r--      4574 2016-12-08 06:19 imagick.transposeimage.html
-rw-r--r--      4946 2016-12-08 06:20 class.xmldiff-memory.html
-rw-r--r--      3102 2016-12-08 06:19 function.event-priority-set.html
-rw-r--r--      2720 2016-12-08 06:18 function.filepro-fieldcount.html
-rw-r--r--      2974 2016-12-08 06:19 gmagick.medianfilterimage.html
-rw-r--r--      4879 2016-12-08 06:19 gearmanclient.setcompletecallback.html
-rw-r--r--     13866 2016-12-08 06:19 function.oci-password-change.html
-rw-r--r--      2875 2016-12-08 06:19 yaf-session.offsetset.html
-rw-r--r--      6514 2016-12-08 06:20 function.array-rand.html
-rw-r--r--      7077 2016-12-08 06:20 function.inet-ntop.html
-rw-r--r--      4255 2016-12-08 06:19 function.ps-symbol-width.html
-rw-r--r--      2074 2016-12-08 06:20 history.php.publications.html
-rw-r--r--      3108 2016-12-08 06:19 book.fileinfo.html
-rw-r--r--      2416 2016-12-08 06:19 imagickpixel.clear.html
-rw-r--r--      4278 2016-12-08 06:19 imagick.painttransparentimage.html
-rw-r--r--      5528 2016-12-08 06:20 internals2.opcodes.fe-reset.html
-rw-r--r--      6836 2016-12-08 06:20 varnish.constants.html
-rw-r--r--      3000 2016-12-08 06:18 function.m-getcommadelimited.html
-rw-r--r--      7902 2016-12-08 06:19 function.get-browser.html
-rw-r--r--      3838 2016-12-08 06:18 function.cubrid-lob2-new.html
-rw-r--r--      7748 2016-12-08 06:19 mysqli-stmt.send-long-data.html
-rw-r--r--      2894 2016-12-08 06:19 cachingiterator.offsetexists.html
-rw-r--r--      2514 2016-12-08 06:19 swffont.getutf8width.html
-rw-r--r--    100432 2016-12-08 06:20 doc.changelog.html
-rw-r--r--      4687 2016-12-08 06:20 ds-sequence.allocate.html
-rw-r--r--      5657 2016-12-08 06:19 function.disk-free-space.html
-rw-r--r--      7768 2016-12-08 06:19 haru.builtin.encodings.html
-rw-r--r--      2425 2016-12-08 06:19 ev.verify.html
-rw-r--r--     21403 2016-12-08 06:19 function.strftime.html
-rw-r--r--      3821 2016-12-08 06:19 function.imap-bodystruct.html
-rw-r--r--      3933 2016-12-08 06:19 function.imageloadfont.html
-rw-r--r--      4640 2016-12-08 06:19 function.ps-curveto.html
-rw-r--r--      7016 2016-12-08 06:18 phardata.copy.html
-rw-r--r--      2890 2016-12-08 06:19 gmagick.setimagedispose.html
-rw-r--r--      3722 2016-12-08 06:19 gearmanjob.exception.html
-rw-r--r--      4796 2016-12-08 06:20 reflectionclass.getdoccomment.html
-rw-r--r--      4343 2016-12-08 06:19 function.fann-test-data.html
-rw-r--r--      3125 2016-12-08 06:19 multipleiterator.valid.html
-rw-r--r--      2640 2016-12-08 06:20 ui-menu.appendpreferences.html
-rw-r--r--     22183 2016-12-08 06:19 mongocollection.createindex.html
-rw-r--r--     12568 2016-12-08 06:18 function.db2-client-info.html
-rw-r--r--      1339 2016-12-08 06:19 hwapi.resources.html
-rw-r--r--      2881 2016-12-08 06:18 function.ifxus-create-slob.html
-rw-r--r--      1346 2016-12-08 06:20 debugger.html
-rw-r--r--      1354 2016-12-08 06:19 json.requirements.html
-rw-r--r--      2507 2016-12-08 06:19 ldap.using.html
-rw-r--r--      6740 2016-12-08 06:19 book.ingres.html
-rw-r--r--     21003 2016-12-08 06:18 wincache.configuration.html
-rw-r--r--      4469 2016-12-08 06:20 internals2.opcodes.fetch-dim-w.html
-rw-r--r--      2220 2016-12-08 06:20 ui-menuitem.setchecked.html
-rw-r--r--      3318 2016-12-08 06:19 function.trader-cdlhomingpigeon.html
-rw-r--r--      2987 2016-12-08 06:19 mongodb-driver-cursorid.construct.html
-rw-r--r--      2677 2016-12-08 06:19 eventdnsbase.addsearch.html
-rw-r--r--      1535 2016-12-08 06:19 intro.fileinfo.html
-rw-r--r--      3363 2016-12-08 06:18 security.database.design.html
-rw-r--r--      2268 2016-12-08 06:19 function.pdf-get-parameter.html
-rw-r--r--      2789 2016-12-08 06:19 eventbuffer.expand.html
-rw-r--r--      6774 2016-12-08 06:20 ds-set.get.html
-rw-r--r--      3768 2016-12-08 06:18 function.runkit-constant-redefine.html
-rw-r--r--      3203 2016-12-08 06:19 oci-lob.save.html
-rw-r--r--      1483 2016-12-08 06:18 hash.resources.html
-rw-r--r--      5185 2016-12-08 06:20 class.xmldiff-dom.html
-rw-r--r--      1629 2016-12-08 06:20 pcre.pattern.html
-rw-r--r--     12251 2016-12-08 06:19 imagickdraw.pathcurvetoquadraticbezierabsolute.html
-rw-r--r--      9562 2016-12-08 06:19 class.tidynode.html
-rw-r--r--    353052 2016-12-08 06:19 class.intlchar.html
-rw-r--r--      6214 2016-12-08 06:20 solrdismaxquery.removeuserfield.html
-rw-r--r--      2578 2016-12-08 06:19 yaf-request-simple.get.html
-rw-r--r--      6226 2016-12-08 06:20 function.md5.html
-rw-r--r--     10896 2016-12-08 06:18 function.runkit-method-redefine.html
-rw-r--r--      3426 2016-12-08 06:19 function.fann-get-cascade-max-out-epochs.html
-rw-r--r--      2714 2016-12-08 06:19 lua.include.html
-rw-r--r--      1740 2016-12-08 06:19 intro.pgsql.html
-rw-r--r--      7136 2016-12-08 06:19 ev.embeddablebackends.html
-rw-r--r--      3053 2016-12-08 06:18 function.ncurses-has-ic.html
-rw-r--r--      4263 2016-12-08 06:19 ref.sybase.html
-rw-r--r--      5152 2016-12-08 06:19 function.mqseries-put1.html
-rw-r--r--      7839 2016-12-08 06:18 function.db2-column-privileges.html
-rw-r--r--      2311 2016-12-08 06:19 curlfile.getpostfilename.html
-rw-r--r--      3421 2016-12-08 06:19 function.stats-rand-gen-ibinomial-negative.html
-rw-r--r--      8142 2016-12-08 06:19 cairocontext.getantialias.html
-rw-r--r--      3087 2016-12-08 06:18 function.newt-grid-v-stacked.html
-rw-r--r--      5561 2016-12-08 06:20 reflectiongenerator.getfunction.html
-rw-r--r--      2678 2016-12-08 06:18 rarentry.tostring.html
-rw-r--r--      2797 2016-12-08 06:19 gmagick.getimagewhitepoint.html
-rw-r--r--      2754 2016-12-08 06:20 internals2.opcodes.echo.html
-rw-r--r--      2478 2016-12-08 06:19 gearmantask.isrunning.html
-rw-r--r--      5023 2016-12-08 06:19 function.imap-check.html
-rw-r--r--      5285 2016-12-08 06:19 function.gnupg-adddecryptkey.html
-rw-r--r--     11076 2016-12-08 06:19 class.imagickpixel.html
-rw-r--r--      2490 2016-12-08 06:19 hwapi.object-title.html
-rw-r--r--      2318 2016-12-08 06:19 imagick.getfilename.html
-rw-r--r--     14121 2016-12-08 06:20 function.trim.html
-rw-r--r--     11589 2016-12-08 06:19 function.sqlsrv-rollback.html
-rw-r--r--      2222 2016-12-08 06:20 ui-menu.construct.html
-rw-r--r--      4779 2016-12-08 06:18 ingres.installation.html
-rw-r--r--      5366 2016-12-08 06:19 cairocontext.setantialias.html
-rw-r--r--      4950 2016-12-08 06:19 cairocontext.popgroup.html
-rw-r--r--      5069 2016-12-08 06:19 cairosurface.getfontoptions.html
-rw-r--r--      4310 2016-12-08 06:19 eventhttprequest.sendreplystart.html
-rw-r--r--      3186 2016-12-08 06:19 arrayiterator.unserialize.html
-rw-r--r--      2836 2016-12-08 06:19 function.px-numfields.html
-rw-r--r--     14425 2016-12-08 06:18 function.cubrid-fetch-field.html
-rw-r--r--      1537 2016-12-08 06:18 crack.setup.html
-rw-r--r--      1524 2016-12-08 06:19 dio.setup.html
-rw-r--r--      3188 2016-12-08 06:19 function.mysqlnd-qc-clear-cache.html
-rw-r--r--      7532 2016-12-08 06:20 ds-sequence.slice.html
-rw-r--r--     17019 2016-12-08 06:19 function.file-get-contents.html
-rw-r--r--      3667 2016-12-08 06:18 function.filepro-retrieve.html
-rw-r--r--      2653 2016-12-08 06:19 function.trader-sma.html
-rw-r--r--      4919 2016-12-08 06:18 cubridmysql.cubrid.html
-rw-r--r--      7360 2016-12-08 06:18 function.cubrid-lob-close.html
-rw-r--r--      3984 2016-12-08 06:20 sphinxclient.setfilter.html
-rw-r--r--      1917 2016-12-08 06:19 class.cairopath.html
-rw-r--r--      3120 2016-12-08 06:18 function.mcrypt-module-close.html
-rw-r--r--      2767 2016-12-08 06:20 reflectionzendextension.construct.html
-rw-r--r--      3551 2016-12-08 06:19 class.mongoexecutiontimeoutexception.html
-rw-r--r--      3856 2016-12-08 06:19 function.fann-scale-output.html
-rw-r--r--      7238 2016-12-08 06:19 syncsharedmemory.write.html
-rw-r--r--      6338 2016-12-08 06:19 function.curl-strerror.html
-rw-r--r--      4069 2016-12-08 06:20 yar-client.construct.html
-rw-r--r--      3295 2016-12-08 06:19 swfshape.drawline.html
-rw-r--r--      2767 2016-12-08 06:19 cachingiterator.offsetget.html
-rw-r--r--      2605 2016-12-08 06:19 imagickdraw.getstrokedasharray.html
-rw-r--r--      3378 2016-12-08 06:19 gmagick.setimagechanneldepth.html
-rw-r--r--      1950 2016-12-08 06:19 sqlsrv.resources.html
-rw-r--r--      4898 2016-12-08 06:19 mongodb-bson-utcdatetime.construct.html
-rw-r--r--      4856 2016-12-08 06:19 gearmanclient.setfailcallback.html
-rw-r--r--      4734 2016-12-08 06:20 ds-priorityqueue.copy.html
-rw-r--r--      2992 2016-12-08 06:19 evloop.now.html
-rw-r--r--     47301 2016-12-08 06:20 internals2.pdo.implementing.html
-rw-r--r--      4747 2016-12-08 06:20 varnishadmin.construct.html
-rw-r--r--      5467 2016-12-08 06:20 book.zmq.html
-rw-r--r--      3901 2016-12-08 06:20 domelement.getattributenodens.html
-rw-r--r--      2963 2016-12-08 06:19 recursiveiteratoriterator.callhaschildren.html
-rw-r--r--      2594 2016-12-08 06:19 cachingiterator.rewind.html
-rw-r--r--      7018 2016-12-08 06:19 memcached.setoptions.html
-rw-r--r--      7246 2016-12-08 06:20 reflectionmethod.invoke.html
-rw-r--r--      8196 2016-12-08 06:20 function.prev.html
-rw-r--r--      7185 2016-12-08 06:19 streamwrapper.stream-open.html
-rw-r--r--     15528 2016-12-08 06:19 function.maxdb-prepare.html
-rw-r--r--      9657 2016-12-08 06:19 function.imap-status.html
-rw-r--r--      9469 2016-12-08 06:19 function.ps-set-text-pos.html
-rw-r--r--      3862 2016-12-08 06:19 evloop.periodic.html
-rw-r--r--      6148 2016-12-08 06:18 control-structures.break.html
-rw-r--r--      5614 2016-12-08 06:19 mongodbref.get.html
-rw-r--r--      2022 2016-12-08 06:19 function.mysqli-set-opt.html
-rw-r--r--      6066 2016-12-08 06:19 function.gmp-div-r.html
-rw-r--r--      4042 2016-12-08 06:18 security.general.html
-rw-r--r--      2223 2016-12-08 06:19 intro.fam.html
-rw-r--r--      3108 2016-12-08 06:19 harudoc.save.html
-rw-r--r--      2346 2016-12-08 06:19 memcache.constants.html
-rw-r--r--      4063 2016-12-08 06:20 ds-set.capacity.html
-rw-r--r--      7913 2016-12-08 06:19 function.ftp-put.html
-rw-r--r--      2521 2016-12-08 06:20 ui-controls-colorbutton.getcolor.html
-rw-r--r--      2504 2016-12-08 06:19 function.pdf-setgray-fill.html
-rw-r--r--      4950 2016-12-08 06:19 cairosurface.showpage.html
-rw-r--r--      2563 2016-12-08 06:19 function.pdf-setfont.html
-rw-r--r--      1553 2016-12-08 06:19 intro.exif.html
-rw-r--r--      2221 2016-12-08 06:18 copyright.html
-rw-r--r--      2544 2016-12-08 06:18 intro.pdo.html
-rw-r--r--      4085 2016-12-08 06:20 zmqdevice.settimercallback.html
-rw-r--r--      9246 2016-12-08 06:19 imagickdraw.circle.html
-rw-r--r--      4819 2016-12-08 06:19 cairo.versionstring.html
-rw-r--r--      2738 2016-12-08 06:20 sdo-das-changesummary.beginlogging.html
-rw-r--r--      1327 2016-12-08 06:18 opcache.resources.html
-rw-r--r--      4080 2016-12-08 06:19 function.sqlite-fetch-object.html
-rw-r--r--      2322 2016-12-08 06:19 function.pdf-info-matchbox.html
-rw-r--r--      3527 2016-12-08 06:20 class.domnodelist.html
-rw-r--r--      3848 2016-12-08 06:19 evcheck.construct.html
-rw-r--r--      2679 2016-12-08 06:19 intlbreakiterator.construct.html
-rw-r--r--      3498 2016-12-08 06:19 limititerator.next.html
-rw-r--r--      3997 2016-12-08 06:19 mongocursor.immortal.html
-rw-r--r--      3039 2016-12-08 06:20 ui-draw-brush-radialgradient.construct.html
-rw-r--r--      3731 2016-12-08 06:19 recursivefilteriterator.getchildren.html
-rw-r--r--      3389 2016-12-08 06:18 serializable.unserialize.html
-rw-r--r--      2859 2016-12-08 06:18 function.ncurses-timeout.html
-rw-r--r--      4702 2016-12-08 06:19 lua.assign.html
-rw-r--r--      1489 2016-12-08 06:19 intro.yaml.html
-rw-r--r--      8163 2016-12-08 06:18 rararchive.isbroken.html
-rw-r--r--      3127 2016-12-08 06:19 gmagick.reducenoiseimage.html
-rw-r--r--      2743 2016-12-08 06:20 function.yp-cat.html
-rw-r--r--      3677 2016-12-08 06:19 streamwrapper.stream-cast.html
-rw-r--r--      7242 2016-12-08 06:19 intlcalendar.gettimezone.html
-rw-r--r--      2940 2016-12-08 06:20 internals2.opcodes.assign-concat.html
-rw-r--r--      2297 2016-12-08 06:18 function.openssl-x509-free.html
-rw-r--r--      2009 2016-12-08 06:20 intro.xmlrpc.html
-rw-r--r--      7907 2016-12-08 06:20 domxpath.evaluate.html
-rw-r--r--      3526 2016-12-08 06:20 migration70.classes.html
-rw-r--r--      2965 2016-12-08 06:19 function.trader-plus-dm.html
-rw-r--r--      3121 2016-12-08 06:18 function.dbplus-undo.html
-rw-r--r--      3351 2016-12-08 06:19 eventutil.getsocketfd.html
-rw-r--r--      2549 2016-12-08 06:19 imagickdraw.pathclose.html
-rw-r--r--      7253 2016-12-08 06:19 function.stream-copy-to-stream.html
-rw-r--r--      2880 2016-12-08 06:19 yaf-dispatcher.flushinstantly.html
-rw-r--r--      4426 2016-12-08 06:19 arrayobject.offsetunset.html
-rw-r--r--      1530 2016-12-08 06:18 kadm5.setup.html
-rw-r--r--      5522 2016-12-08 06:19 cairocontext.scale.html
-rw-r--r--      5442 2016-12-08 06:20 function.ssh2-sftp-readlink.html
-rw-r--r--      8721 2016-12-08 06:19 lapack.solvelinearequation.html
-rw-r--r--      2359 2016-12-08 06:19 imagickdraw.getfont.html
-rw-r--r--      5705 2016-12-08 06:20 function.ssh2-sftp-realpath.html
-rw-r--r--      9446 2016-12-08 06:19 mysqlnd-ms.changes-one-six.html
-rw-r--r--      4124 2016-12-08 06:19 mongo.tutorial.cursor.html
-rw-r--r--      4018 2016-12-08 06:19 cairosurfacepattern.setextend.html
-rw-r--r--      4446 2016-12-08 06:19 function.cairo-surface-get-type.html
-rw-r--r--      3015 2016-12-08 06:19 mongoint32.construct.html
-rw-r--r--      6040 2016-12-08 06:18 function.kadm5-get-principal.html
-rw-r--r--      2435 2016-12-08 06:19 imagick.getimagefilename.html
-rw-r--r--     15114 2016-12-08 06:19 function.maxdb-fetch-field-direct.html
-rw-r--r--      5265 2016-12-08 06:19 yaml.callbacks.parse.html
-rw-r--r--      3488 2016-12-08 06:19 recursivedirectoryiterator.getsubpath.html
-rw-r--r--      3607 2016-12-08 06:19 function.fann-get-train-stop-function.html
-rw-r--r--      4104 2016-12-08 06:19 function.sqlite-libencoding.html
-rw-r--r--      5179 2016-12-08 06:20 reflectionclass.isfinal.html
-rw-r--r--      2720 2016-12-08 06:19 gmagickdraw.polyline.html
-rw-r--r--     10978 2016-12-08 06:19 appenditerator.construct.html
-rw-r--r--      3039 2016-12-08 06:19 swffill.scaleto.html
-rw-r--r--      2727 2016-12-08 06:19 swfsprite.setframes.html
-rw-r--r--      3964 2016-12-08 06:18 exception.tostring.html
-rw-r--r--      2849 2016-12-08 06:20 function.xmlrpc-server-register-introspection-callback.html
-rw-r--r--      4240 2016-12-08 06:20 ds-pair.isempty.html
-rw-r--r--      2007 2016-12-08 06:18 reserved.interfaces.html
-rw-r--r--      4514 2016-12-08 06:20 ds-map.pairs.html
-rw-r--r--      3178 2016-12-08 06:18 function.dbplus-xunlockrel.html
-rw-r--r--      3478 2016-12-08 06:19 evloop.child.html
-rw-r--r--      4114 2016-12-08 06:19 ev.watcher-callbacks.html
-rw-r--r--      5811 2016-12-08 06:19 function.gupnp-context-host-path.html
-rw-r--r--      3384 2016-12-08 06:19 ev.depth.html
-rw-r--r--      3072 2016-12-08 06:20 migration52.other.html
-rw-r--r--      3272 2016-12-08 06:19 swfsprite.add.html
-rw-r--r--      3554 2016-12-08 06:20 reflectionfunctionabstract.getnumberofrequiredparameters.html
-rw-r--r--      2720 2016-12-08 06:19 gearmanworker.error.html
-rw-r--r--      1442 2016-12-08 06:18 ncurses.errconsts.html
-rw-r--r--      3721 2016-12-08 06:19 harupage.curveto2.html
-rw-r--r--      2766 2016-12-08 06:19 sqlite3stmt.readonly.html
-rw-r--r--      1358 2016-12-08 06:20 sdo.configuration.html
-rw-r--r--      2205 2016-12-08 06:19 intro.paradox.html
-rw-r--r--     21387 2016-12-08 06:19 mongo.queries.html
-rw-r--r--      2076 2016-12-08 06:18 intro.readline.html
-rw-r--r--      2477 2016-12-08 06:18 function.ncurses-hide-panel.html
-rw-r--r--      2415 2016-12-08 06:20 ui-controls-box.construct.html
-rw-r--r--      2340 2016-12-08 06:19 datetime.installation.html
-rw-r--r--      8104 2016-12-08 06:19 function.stream-filter-prepend.html
-rw-r--r--      3791 2016-12-08 06:19 function.fann-set-cascade-candidate-change-fraction.html
-rw-r--r--     22450 2016-12-08 06:18 info.configuration.html
-rw-r--r--      6632 2016-12-08 06:19 function.pcntl-wait.html
-rw-r--r--      3825 2016-12-08 06:19 function.pdf-begin-page-ext.html
-rw-r--r--      3051 2016-12-08 06:19 hwapi.copy.html
-rw-r--r--      4186 2016-12-08 06:20 sphinxclient.setlimits.html
-rw-r--r--      3141 2016-12-08 06:19 function.trader-ad.html
-rw-r--r--      4356 2016-12-08 06:20 solrquery.setexpandrows.html
-rw-r--r--      7358 2016-12-08 06:19 mysqli.connect-errno.html
-rw-r--r--      7014 2016-12-08 06:18 ref.pdo-sqlsrv.connection.html
-rw-r--r--      3186 2016-12-08 06:19 haruencoder.gettype.html
-rw-r--r--      1542 2016-12-08 06:20 sdo-das-xml.installation.html
-rw-r--r--      1713 2016-12-08 06:20 quickhash.installation.html
-rw-r--r--      4650 2016-12-08 06:18 function.dbx-close.html
-rw-r--r--      2291 2016-12-08 06:20 pcre.examples.html
-rw-r--r--      3106 2016-12-08 06:20 function.svn-fs-copy.html
-rw-r--r--      3042 2016-12-08 06:20 sdo-das-dataobject.getchangesummary.html
-rw-r--r--      7825 2016-12-08 06:19 class.splheap.html
-rw-r--r--      3574 2016-12-08 06:19 mongo.getslaveokay.html
-rw-r--r--      3712 2016-12-08 06:19 haruannotation.sethighlightmode.html
-rw-r--r--      6452 2016-12-08 06:18 ref.mcrypt.html
-rw-r--r--      4473 2016-12-08 06:20 oauthprovider.is2leggedendpoint.html
-rw-r--r--      5411 2016-12-08 06:19 directoryiterator.getpathname.html
-rw-r--r--      3275 2016-12-08 06:20 zmqsocket.send.html
-rw-r--r--      2885 2016-12-08 06:20 reflector.tostring.html
-rw-r--r--     21204 2016-12-08 06:20 cc.license.html
-rw-r--r--      3499 2016-12-08 06:19 function.imap-msgno.html
-rw-r--r--      1401 2016-12-08 06:18 zip.requirements.html
-rw-r--r--      5432 2016-12-08 06:20 ds-sequence.rotate.html
-rw-r--r--      3592 2016-12-08 06:19 harupage.rectangle.html
-rw-r--r--      1397 2016-12-08 06:18 introduction.html
-rw-r--r--      4613 2016-12-08 06:19 function.cairo-pattern-create-for-surface.html
-rw-r--r--     11649 2016-12-08 06:20 libxml.constants.html
-rw-r--r--      1996 2016-12-08 06:19 intro.mysqlnd.html
-rw-r--r--      4455 2016-12-08 06:19 mongocommandcursor.batchsize.html
-rw-r--r--      2191 2016-12-08 06:20 yar.installation.html
-rw-r--r--      1440 2016-12-08 06:19 ref.judy.html
-rw-r--r--      4780 2016-12-08 06:19 recursivetreeiterator.construct.html
-rw-r--r--      2811 2016-12-08 06:19 function.stats-rand-gen-ipoisson.html
-rw-r--r--      4802 2016-12-08 06:18 function.mcrypt-enc-get-supported-key-sizes.html
-rw-r--r--      2350 2016-12-08 06:19 intro.chdb.html
-rw-r--r--      3284 2016-12-08 06:19 eventhttprequest.sendreplyend.html
-rw-r--r--      6814 2016-12-08 06:20 soapserver.addfunction.html
-rw-r--r--     18051 2016-12-08 06:19 function.parse-ini-file.html
-rw-r--r--      3716 2016-12-08 06:20 sdo-datafactory.create.html
-rw-r--r--      3324 2016-12-08 06:18 function.newt-form-destroy.html
-rw-r--r--      4367 2016-12-08 06:20 solrquery.addexpandfilterquery.html
-rw-r--r--      4973 2016-12-08 06:19 imagickpixel.getcolorcount.html
-rw-r--r--      6450 2016-12-08 06:18 function.output-reset-rewrite-vars.html
-rw-r--r--     10365 2016-12-08 06:20 function.snmp-set-valueretrieval.html
-rw-r--r--      1411 2016-12-08 06:18 ibm-db2.resources.html
-rw-r--r--      3372 2016-12-08 06:19 gmagick.scaleimage.html
-rw-r--r--      2856 2016-12-08 06:19 evloop.backend.html
-rw-r--r--      9950 2016-12-08 06:19 function.oci-set-edition.html
-rw-r--r--      4804 2016-12-08 06:18 ziparchive.deletename.html
-rw-r--r--      5103 2016-12-08 06:18 function.cubrid-get-charset.html
-rw-r--r--      3314 2016-12-08 06:19 eventbase.dispatch.html
-rw-r--r--      2728 2016-12-08 06:18 function.readline-read-history.html
-rw-r--r--      7654 2016-12-08 06:19 class.mongoexception.html
-rw-r--r--      2639 2016-12-08 06:18 rarentry.isencrypted.html
-rw-r--r--      4110 2016-12-08 06:18 function.memory-get-peak-usage.html
-rw-r--r--      4909 2016-12-08 06:19 cairocontext.getlinecap.html
-rw-r--r--      5702 2016-12-08 06:19 mongoclient.gethosts.html
-rw-r--r--      7183 2016-12-08 06:20 ds-map.remove.html
-rw-r--r--      2419 2016-12-08 06:19 judy.gettype.html
-rw-r--r--      5579 2016-12-08 06:20 function.variant-idiv.html
-rw-r--r--      1351 2016-12-08 06:19 rpmreader.examples.html
-rw-r--r--      3748 2016-12-08 06:20 oauthprovider.isrequesttokenendpoint.html
-rw-r--r--     12373 2016-12-08 06:20 faq.com.html
-rw-r--r--      3783 2016-12-08 06:20 function.xmlwriter-text.html
-rw-r--r--      2437 2016-12-08 06:18 function.radius-demangle.html
-rw-r--r--      2006 2016-12-08 06:19 function.timezone-transitions-get.html
-rw-r--r--      3750 2016-12-08 06:19 function.ps-close.html
-rw-r--r--      2771 2016-12-08 06:19 evloop.verify.html
-rw-r--r--      5638 2016-12-08 06:19 class.splbool.html
-rw-r--r--      7190 2016-12-08 06:19 timezones.america.html
-rw-r--r--      4334 2016-12-08 06:19 function.msql-data-seek.html
-rw-r--r--      1822 2016-12-08 06:19 function.imap-listmailbox.html
-rw-r--r--      3214 2016-12-08 06:19 oci-collection.getelem.html
-rw-r--r--      2576 2016-12-08 06:20 solrinputdocument.clear.html
-rw-r--r--      8113 2016-12-08 06:19 tidy.repairfile.html
-rw-r--r--      2684 2016-12-08 06:20 solrinputdocument.getfieldnames.html
-rw-r--r--      4805 2016-12-08 06:19 function.fann-create-sparse-array.html
-rw-r--r--     10525 2016-12-08 06:19 tokyotyrantquery.addcond.html
-rw-r--r--      1379 2016-12-08 06:20 xmlrpc.configuration.html
-rw-r--r--      3330 2016-12-08 06:19 harupage.sethorizontalscaling.html
-rw-r--r--      3242 2016-12-08 06:18 function.newt-checkbox-tree.html
-rw-r--r--      5537 2016-12-08 06:18 rarentry.getunpackedsize.html
-rw-r--r--      2788 2016-12-08 06:20 ui-area.onkey.html
-rw-r--r--      6714 2016-12-08 06:20 sdo-das-relational.applychanges.html
-rw-r--r--      1743 2016-12-08 06:20 solr.requirements.html
-rw-r--r--      6695 2016-12-08 06:19 class.swfbutton.html
-rw-r--r--      6658 2016-12-08 06:19 class.lua.html
-rw-r--r--     22710 2016-12-08 06:20 sdodasrel.examples.two-table.html
-rw-r--r--      2689 2016-12-08 06:19 arrayiterator.seek.html
-rw-r--r--      9927 2016-12-08 06:19 class.limititerator.html
-rw-r--r--      1373 2016-12-08 06:20 ds.setup.html
-rw-r--r--      7451 2016-12-08 06:20 function.session-destroy.html
-rw-r--r--      6361 2016-12-08 06:19 datetime.gettimestamp.html
-rw-r--r--      6765 2016-12-08 06:18 book.dbplus.html
-rw-r--r--      6389 2016-12-08 06:19 function.bcpowmod.html
-rw-r--r--      2292 2016-12-08 06:19 mongocursor.getnext.html
-rw-r--r--     28116 2016-12-08 06:20 book.ui.html
-rw-r--r--      6635 2016-12-08 06:19 book.sqlite3.html
-rw-r--r--      2769 2016-12-08 06:19 splfixedarray.current.html
-rw-r--r--      2966 2016-12-08 06:19 harupage.getmiterlimit.html
-rw-r--r--      4708 2016-12-08 06:19 function.pcntl-sigtimedwait.html
-rw-r--r--      3477 2016-12-08 06:19 harupage.setdash.html
-rw-r--r--      4830 2016-12-08 06:20 reflectionclass.getinterfacenames.html
-rw-r--r--      2630 2016-12-08 06:19 gmagick.getversion.html
-rw-r--r--      8711 2016-12-08 06:19 function.imagesetbrush.html
-rw-r--r--      2334 2016-12-08 06:19 imagickdraw.getfillrule.html
-rw-r--r--      2727 2016-12-08 06:19 recursivetreeiterator.key.html
-rw-r--r--      7637 2016-12-08 06:19 imagick.exportimagepixels.html
-rw-r--r--      4450 2016-12-08 06:18 function.cubrid-lob2-tell.html
-rw-r--r--      4529 2016-12-08 06:19 function.cairo-image-surface-get-stride.html
-rw-r--r--      4558 2016-12-08 06:20 solrparams.setparam.html
-rw-r--r--      2722 2016-12-08 06:19 recursivedirectoryiterator.next.html
-rw-r--r--      5804 2016-12-08 06:20 ds-map.diff.html
-rw-r--r--      4106 2016-12-08 06:19 function.sqlite-last-error.html
-rw-r--r--      2786 2016-12-08 06:20 sdo-das-xml-document.setencoding.html
-rw-r--r--     10512 2016-12-08 06:18 phar.converttodata.html
-rw-r--r--      3025 2016-12-08 06:18 function.m-parsecommadelimited.html
-rw-r--r--      2620 2016-12-08 06:18 mpegfile.getid3v2tag.html
-rw-r--r--      4092 2016-12-08 06:19 harudoc.setinfoattr.html
-rw-r--r--      3050 2016-12-08 06:19 harupage.fillstroke.html
-rw-r--r--      1360 2016-12-08 06:20 funchand.resources.html
-rw-r--r--      2623 2016-12-08 06:19 yaf-request-abstract.ispost.html
-rw-r--r--      1528 2016-12-08 06:19 stream.setup.html
-rw-r--r--      4953 2016-12-08 06:20 xmlreader.open.html
-rw-r--r--     12088 2016-12-08 06:19 intldateformatter.parse.html
-rw-r--r--      3042 2016-12-08 06:18 function.newt-form-watch-fd.html
-rw-r--r--      2725 2016-12-08 06:19 function.trader-get-unstable-period.html
-rw-r--r--      2946 2016-12-08 06:19 haruimage.getcolorspace.html
-rw-r--r--      6700 2016-12-08 06:20 class.ui-controls-combo.html
-rw-r--r--      2920 2016-12-08 06:20 domdocument.normalizedocument.html
-rw-r--r--      4682 2016-12-08 06:19 class.mongodb-bson-persistable.html
-rw-r--r--      2501 2016-12-08 06:19 imagickdraw.getstrokewidth.html
-rw-r--r--      1330 2016-12-08 06:19 hrtime.setup.html
-rw-r--r--     10313 2016-12-08 06:19 function.eio-custom.html
-rw-r--r--      7179 2016-12-08 06:19 imagickdraw.point.html
-rw-r--r--      2713 2016-12-08 06:19 intltimezone.getdstsavings.html
-rw-r--r--     10175 2016-12-08 06:20 array.constants.html
-rw-r--r--      5322 2016-12-08 06:19 function.xdiff-string-bdiff-size.html
-rw-r--r--      9455 2016-12-08 06:20 function.fprintf.html
-rw-r--r--      6056 2016-12-08 06:19 cairocontext.fillpreserve.html
-rw-r--r--      2700 2016-12-08 06:19 mongo.tutorial.counting.html
-rw-r--r--      3084 2016-12-08 06:19 function.connection-aborted.html
-rw-r--r--      1509 2016-12-08 06:20 migration54.new-extensions.html
-rw-r--r--      7289 2016-12-08 06:20 function.import-request-variables.html
-rw-r--r--      1355 2016-12-08 06:18 rar.configuration.html
-rw-r--r--      1712 2016-12-08 06:18 ref.xhprof.html
-rw-r--r--      2391 2016-12-08 06:19 intro.ev.html
-rw-r--r--      3392 2016-12-08 06:19 imagick.setimagepage.html
-rw-r--r--      1340 2016-12-08 06:19 cyrus.requirements.html
-rw-r--r--      1925 2016-12-08 06:19 function.date-offset-get.html
-rw-r--r--      2832 2016-12-08 06:18 function.newt-grid-free.html
-rw-r--r--      2747 2016-12-08 06:19 function.enchant-broker-get-error.html
-rw-r--r--      9645 2016-12-08 06:19 function.dirname.html
-rw-r--r--      3031 2016-12-08 06:18 function.ncurses-instr.html
-rw-r--r--      8687 2016-12-08 06:19 numberformatter.format.html
-rw-r--r--      1526 2016-12-08 06:20 stomp.setup.html
-rw-r--r--      6025 2016-12-08 06:20 quickhashintstringhash.construct.html
-rw-r--r--      5631 2016-12-08 06:19 intlchar.isualphabetic.html
-rw-r--r--      3995 2016-12-08 06:19 intlcalendar.before.html
-rw-r--r--      4983 2016-12-08 06:19 function.php-strip-whitespace.html
-rw-r--r--      9139 2016-12-08 06:20 migration55.incompatible.html
-rw-r--r--      2680 2016-12-08 06:19 yaf-dispatcher.setdefaultmodule.html
-rw-r--r--      2787 2016-12-08 06:19 function.trader-mult.html
-rw-r--r--     87080 2016-12-08 06:18 language.types.array.html
-rw-r--r--      1699 2016-12-08 06:18 configuration.html
-rw-r--r--      2326 2016-12-08 06:19 function.stream-bucket-new.html
-rw-r--r--      1916 2016-12-08 06:20 internals2.opcodes.init-ns-fcall-by-name.html
-rw-r--r--      1347 2016-12-08 06:19 stream.requirements.html
-rw-r--r--      3712 2016-12-08 06:19 gmagick.motionblurimage.html
-rw-r--r--      2879 2016-12-08 06:19 function.pdf-place-pdi-page.html
-rw-r--r--      4850 2016-12-08 06:18 pharfileinfo.getpharflags.html
-rw-r--r--      2517 2016-12-08 06:19 imagickpixel.destroy.html
-rw-r--r--     15348 2016-12-08 06:20 class.reflectionfunctionabstract.html
-rw-r--r--      2708 2016-12-08 06:20 function.svn-repos-recover.html
-rw-r--r--      4337 2016-12-08 06:19 book.calendar.html
-rw-r--r--      1945 2016-12-08 06:18 ref.password.html
-rw-r--r--     10254 2016-12-08 06:20 migration53.deprecated.html
-rw-r--r--      8012 2016-12-08 06:19 function.shmop-open.html
-rw-r--r--      3219 2016-12-08 06:18 phar.getsupportedsignatures.html
-rw-r--r--      6011 2016-12-08 06:19 function.hexdec.html
-rw-r--r--      4243 2016-12-08 06:19 mongodb.getgridfs.html
-rw-r--r--     10637 2016-12-08 06:19 mysqlnduhconnection.changeuser.html
-rw-r--r--      2472 2016-12-08 06:20 solrresponse.success.html
-rw-r--r--      9990 2016-12-08 06:18 function.ibase-connect.html
-rw-r--r--      2081 2016-12-08 06:19 function.ocilogoff.html
-rw-r--r--      2352 2016-12-08 06:20 ui-controls-label.construct.html
-rw-r--r--      2216 2016-12-08 06:19 function.pdf-create-textflow.html
-rw-r--r--     16250 2016-12-08 06:20 function.call-user-func-array.html
-rw-r--r--      1913 2016-12-08 06:19 function.pdf-setpolydash.html
-rw-r--r--      8177 2016-12-08 06:18 radius.constants.packets.html
-rw-r--r--      6255 2016-12-08 06:19 function.gupnp-service-proxy-action-set.html
-rw-r--r--     11417 2016-12-08 06:19 imagickdraw.setgravity.html
-rw-r--r--      2083 2016-12-08 06:19 imagick.gethomeurl.html
-rw-r--r--      3443 2016-12-08 06:20 function.socket-cmsg-space.html
-rw-r--r--      2982 2016-12-08 06:18 ncurses.colorconsts.html
-rw-r--r--     11280 2016-12-08 06:19 mysqlnd-ms.quickstart.mysql_fabric.html
-rw-r--r--      2603 2016-12-08 06:19 function.pspell-config-dict-dir.html
-rw-r--r--      5979 2016-12-08 06:19 imagick.smushimages.html
-rw-r--r--      2749 2016-12-08 06:20 class.ui-draw-text-font-italic.html
-rw-r--r--      4796 2016-12-08 06:19 memcached.getserverlist.html
-rw-r--r--     11319 2016-12-08 06:19 function.stream-filter-append.html
-rw-r--r--      5325 2016-12-08 06:20 soapclient.getlastrequest.html
-rw-r--r--      1552 2016-12-08 06:20 strings.setup.html
-rw-r--r--      2717 2016-12-08 06:18 function.m-connect.html
-rw-r--r--      4679 2016-12-08 06:20 sdo.installation.html
-rw-r--r--      4630 2016-12-08 06:19 mongodb.drop.html
-rw-r--r--      1903 2016-12-08 06:18 function.require-once.html
-rw-r--r--      4429 2016-12-08 06:20 function.xmlwriter-set-indent.html
-rw-r--r--      2707 2016-12-08 06:20 solrquery.settermsupperbound.html
-rw-r--r--     48185 2016-12-08 06:18 functions.arguments.html
-rw-r--r--      6734 2016-12-08 06:19 function.msg-send.html
-rw-r--r--      4899 2016-12-08 06:19 function.cairo-font-options-set-hint-metrics.html
-rw-r--r--      3077 2016-12-08 06:18 function.newt-entry-set-flags.html
-rw-r--r--      1509 2016-12-08 06:19 gmp.resources.html
-rw-r--r--      1750 2016-12-08 06:18 intro.password.html
-rw-r--r--      7905 2016-12-08 06:19 function.iterator-to-array.html
-rw-r--r--      1337 2016-12-08 06:19 rpmreader.requirements.html
-rw-r--r--      5186 2016-12-08 06:19 function.mysql-field-seek.html
-rw-r--r--      1289 2016-12-08 06:18 weakref.resources.html
-rw-r--r--      7912 2016-12-08 06:19 function.imagecreatefromgd2part.html
-rw-r--r--      2765 2016-12-08 06:20 solrquery.getfacetmethod.html
-rw-r--r--     10471 2016-12-08 06:19 class.messageformatter.html
-rw-r--r--     10694 2016-12-08 06:19 function.pg-field-prtlen.html
-rw-r--r--      2874 2016-12-08 06:19 function.eio-sync.html
-rw-r--r--      5875 2016-12-08 06:18 features.file-upload.put-method.html
-rw-r--r--     10515 2016-12-08 06:19 imagickdraw.setfontstretch.html
-rw-r--r--     12258 2016-12-08 06:18 phar.decompressfiles.html
-rw-r--r--      2161 2016-12-08 06:19 function.maxdb-bind-param.html
-rw-r--r--      6954 2016-12-08 06:20 snmp.setsecurity.html
-rw-r--r--      3639 2016-12-08 06:19 class.cairofontslant.html
-rw-r--r--      2527 2016-12-08 06:18 ref.apcu.html
-rw-r--r--      7055 2016-12-08 06:18 function.random-int.html
-rw-r--r--      3258 2016-12-08 06:19 hwapi.dstofsrcanchor.html
-rw-r--r--      6012 2016-12-08 06:20 function.apache-request-headers.html
-rw-r--r--     13611 2016-12-08 06:20 book.strings.html
-rw-r--r--      4408 2016-12-08 06:19 function.mqseries-set.html
-rw-r--r--      9175 2016-12-08 06:19 locale.composelocale.html
-rw-r--r--      9764 2016-12-08 06:19 messageformatter.format.html
-rw-r--r--      2571 2016-12-08 06:19 cyrus.constants.html
-rw-r--r--      2581 2016-12-08 06:19 intro.enchant.html
-rw-r--r--      1524 2016-12-08 06:19 imap.setup.html
-rw-r--r--      4691 2016-12-08 06:19 function.ps-rect.html
-rw-r--r--      4393 2016-12-08 06:19 splfileinfo.isfile.html
-rw-r--r--      6003 2016-12-08 06:20 migration70.deprecated.html
-rw-r--r--      6449 2016-12-08 06:19 class.cairosurfacepattern.html
-rw-r--r--      4334 2016-12-08 06:18 function.apcu-sma-info.html
-rw-r--r--      2844 2016-12-08 06:20 function.rrd-first.html
-rw-r--r--     16062 2016-12-08 06:19 mysqli.overview.html
-rw-r--r--     20877 2016-12-08 06:19 function.dns-get-record.html
-rw-r--r--      1383 2016-12-08 06:19 gearman.resources.html
-rw-r--r--      3334 2016-12-08 06:19 mongo.tutorial.collection.html
-rw-r--r--      1540 2016-12-08 06:18 ifx.installation.html
-rw-r--r--      8626 2016-12-08 06:18 pdo.sqlitecreatecollation.html
-rw-r--r--      3440 2016-12-08 06:19 imagick.remapimage.html
-rw-r--r--      1309 2016-12-08 06:20 swish.requirements.html
-rw-r--r--      2660 2016-12-08 06:18 context.params.html
-rw-r--r--      7130 2016-12-08 06:19 splfileinfo.openfile.html
-rw-r--r--      2355 2016-12-08 06:20 ui-controls-group.setmargin.html
-rw-r--r--      7149 2016-12-08 06:19 mysqlnd-ms.failover.html
-rw-r--r--      2773 2016-12-08 06:20 sdo-model-property.getname.html
-rw-r--r--      5691 2016-12-08 06:19 function.intl-is-failure.html
-rw-r--r--     10493 2016-12-08 06:19 function.stream-socket-recvfrom.html
-rw-r--r--      2993 2016-12-08 06:19 splfileinfo.getsize.html
-rw-r--r--     28987 2016-12-08 06:18 language.exceptions.extending.html
-rw-r--r--      6889 2016-12-08 06:19 class.yaf-exception.html
-rw-r--r--      5160 2016-12-08 06:18 function.ob-get-clean.html
-rw-r--r--      2381 2016-12-08 06:20 zmqpoll.getlasterrors.html
-rw-r--r--      3962 2016-12-08 06:19 function.mb-language.html
-rw-r--r--     13232 2016-12-08 06:19 mysqli.commit.html
-rw-r--r--      4833 2016-12-08 06:19 arrayiterator.valid.html
-rw-r--r--      8687 2016-12-08 06:19 function.eval.html
-rw-r--r--      1740 2016-12-08 06:19 posix.constants.html
-rw-r--r--     16812 2016-12-08 06:19 mysqli.examples-basic.html
-rw-r--r--      6965 2016-12-08 06:19 mysqlnd-qc.quickstart.concepts.html
-rw-r--r--      1926 2016-12-08 06:19 function.date-isodate-set.html
-rw-r--r--      3327 2016-12-08 06:18 function.dbplus-ropen.html
-rw-r--r--      1523 2016-12-08 06:18 mcve.setup.html
-rw-r--r--      4468 2016-12-08 06:20 function.get-declared-classes.html
-rw-r--r--     16420 2016-12-08 06:19 book.image.html
-rw-r--r--      2964 2016-12-08 06:19 function.closelog.html
-rw-r--r--     16601 2016-12-08 06:20 class.ds-set.html
-rw-r--r--      2352 2016-12-08 06:19 mongodb.requirements.html
-rw-r--r--      3080 2016-12-08 06:20 xmlreader.read.html
-rw-r--r--      3261 2016-12-08 06:19 gmagick.setimageblueprimary.html
-rw-r--r--      9621 2016-12-08 06:19 imagickdraw.setfontweight.html
-rw-r--r--     18002 2016-12-08 06:20 function.htmlentities.html
-rw-r--r--      6295 2016-12-08 06:20 function.variant-or.html
-rw-r--r--      4660 2016-12-08 06:19 cairolineargradient.construct.html
-rw-r--r--      8682 2016-12-08 06:20 function.is-soap-fault.html
-rw-r--r--      2717 2016-12-08 06:19 evwatcher.feed.html
-rw-r--r--      7358 2016-12-08 06:19 imagick.transparentpaintimage.html
-rw-r--r--      5217 2016-12-08 06:19 function.imap-fetchmime.html
-rw-r--r--      1678 2016-12-08 06:20 swish.installation.html
-rw-r--r--      1533 2016-12-08 06:20 regex.setup.html
-rw-r--r--      5898 2016-12-08 06:18 function.dbase-pack.html
-rw-r--r--      6337 2016-12-08 06:19 tokyotyrant.putcat.html
-rw-r--r--      2960 2016-12-08 06:19 function.getrandmax.html
-rw-r--r--      4935 2016-12-08 06:19 cairocontext.getmiterlimit.html
-rw-r--r--      6240 2016-12-08 06:18 function.ncurses-color-set.html
-rw-r--r--      8895 2016-12-08 06:19 function.imagerotate.html
-rw-r--r--      5669 2016-12-08 06:19 function.mssql-get-last-message.html
-rw-r--r--     13709 2016-12-08 06:19 evtimer.construct.html
-rw-r--r--      1389 2016-12-08 06:20 com.examples.html
-rw-r--r--      4693 2016-12-08 06:20 book.sam.html
-rw-r--r--      1513 2016-12-08 06:19 chdb.setup.html
-rw-r--r--     11179 2016-12-08 06:20 soapserver.setpersistence.html
-rw-r--r--     17947 2016-12-08 06:20 function.money-format.html
-rw-r--r--      3882 2016-12-08 06:19 function.enchant-broker-set-ordering.html
-rw-r--r--      4042 2016-12-08 06:19 mongocursor.partial.html
-rw-r--r--      2371 2016-12-08 06:19 imagick.getimageunits.html
-rw-r--r--     23221 2016-12-08 06:19 mongocollection.find.html
-rw-r--r--      5987 2016-12-08 06:19 function.gupnp-service-notify.html
-rw-r--r--      4286 2016-12-08 06:20 function.yp-first.html
-rw-r--r--      2432 2016-12-08 06:19 function.pdf-open-pdi-page.html
-rw-r--r--      4780 2016-12-08 06:19 book.sync.html
-rw-r--r--      6905 2016-12-08 06:20 function.strcspn.html
-rw-r--r--     25618 2016-12-08 06:19 function.oci-define-by-name.html
-rw-r--r--      2371 2016-12-08 06:19 swfbutton.addasound.html
-rw-r--r--      5106 2016-12-08 06:20 ds-vector.merge.html
-rw-r--r--      5962 2016-12-08 06:20 class.ui-controls-progress.html
-rw-r--r--      1258 2016-12-08 06:20 win32ps.constants.html
-rw-r--r--      2076 2016-12-08 06:20 migration51.changes.html
-rw-r--r--      2614 2016-12-08 06:18 function.ncurses-flushinp.html
-rw-r--r--      3427 2016-12-08 06:20 win32service.constants.controlsaccepted.html
-rw-r--r--      8236 2016-12-08 06:19 memcached.increment.html
-rw-r--r--      5192 2016-12-08 06:18 function.id3-get-version.html
-rw-r--r--      7278 2016-12-08 06:19 function.rand.html
-rw-r--r--      1530 2016-12-08 06:19 exif.setup.html
-rw-r--r--      3611 2016-12-08 06:19 harupage.setrgbstroke.html
-rw-r--r--      3977 2016-12-08 06:19 function.log-killcursor.html
-rw-r--r--      7098 2016-12-08 06:19 function.ldap-add.html
-rw-r--r--      3669 2016-12-08 06:20 xsltprocessor.hasexsltsupport.html
-rw-r--r--      6140 2016-12-08 06:19 cairomatrix.initrotate.html
-rw-r--r--      2833 2016-12-08 06:20 solrquery.getfacetdateother.html
-rw-r--r--      2835 2016-12-08 06:20 refs.utilspec.windows.html
-rw-r--r--      3195 2016-12-08 06:18 function.newt-grid-add-components-to-form.html
-rw-r--r--      2206 2016-12-08 06:19 function.ocistatementtype.html
-rw-r--r--      3218 2016-12-08 06:19 function.stream-supports-lock.html
-rw-r--r--      1949 2016-12-08 06:19 function.timezone-offset-get.html
-rw-r--r--      2604 2016-12-08 06:19 imagickpixeliterator.destroy.html
-rw-r--r--     19065 2016-12-08 06:20 function.list.html
-rw-r--r--      6409 2016-12-08 06:19 mongopool.getsize.html
-rw-r--r--      3124 2016-12-08 06:19 imagickdraw.pathmovetorelative.html
-rw-r--r--      2940 2016-12-08 06:19 yaf-config-ini.set.html
-rw-r--r--      2147 2016-12-08 06:19 hwapi.content-mimetype.html
-rw-r--r--      2517 2016-12-08 06:19 book.inotify.html
-rw-r--r--      3444 2016-12-08 06:18 function.zip-entry-compressedsize.html
-rw-r--r--      2365 2016-12-08 06:20 ui-window.add.html
-rw-r--r--      3579 2016-12-08 06:20 function.variant-set-type.html
-rw-r--r--      5891 2016-12-08 06:19 eventsslcontext.construct.html
-rw-r--r--      4759 2016-12-08 06:19 class.cairosubpixelorder.html
-rw-r--r--     13237 2016-12-08 06:19 function.maxdb-use-result.html
-rw-r--r--      5941 2016-12-08 06:19 directoryiterator.valid.html
-rw-r--r--      3726 2016-12-08 06:20 class.ui-menuitem.html
-rw-r--r--      2507 2016-12-08 06:19 imagick.clampimage.html
-rw-r--r--      2555 2016-12-08 06:19 imagickdraw.getstrokedashoffset.html
-rw-r--r--      6043 2016-12-08 06:19 function.geoip-id-by-name.html
-rw-r--r--      1318 2016-12-08 06:19 bc.resources.html
-rw-r--r--      6427 2016-12-08 06:19 yaf-application.clearlasterror.html
-rw-r--r--      2744 2016-12-08 06:19 sqlsrv.installation.html
-rw-r--r--     13707 2016-12-08 06:20 samconnection.send.html
-rw-r--r--      3896 2016-12-08 06:19 function.finfo-set-flags.html
-rw-r--r--      2393 2016-12-08 06:20 solrgenericresponse.destruct.html
-rw-r--r--     16663 2016-12-08 06:20 function.array-splice.html
-rw-r--r--      7684 2016-12-08 06:19 mongocursor.timeout.html
-rw-r--r--      2848 2016-12-08 06:19 iteratoriterator.key.html
-rw-r--r--      2351 2016-12-08 06:20 soapfault.tostring.html
-rw-r--r--      2776 2016-12-08 06:20 reflectionparameter.isvariadic.html
-rw-r--r--     23384 2016-12-08 06:20 class.zookeeper.html
-rw-r--r--      9883 2016-12-08 06:18 function.openssl-pkcs7-encrypt.html
-rw-r--r--      2855 2016-12-08 06:20 solrquery.setmltmaxwordlength.html
-rw-r--r--      2705 2016-12-08 06:19 yaf-controller-abstract.getinvokearg.html
-rw-r--r--      2668 2016-12-08 06:18 phar.fileformat.signature.html
-rw-r--r--      3082 2016-12-08 06:19 class.cairosvgversion.html
-rw-r--r--      6478 2016-12-08 06:19 directoryiterator.getextension.html
-rw-r--r--      4327 2016-12-08 06:18 language.namespaces.definition.html
-rw-r--r--      4075 2016-12-08 06:19 function.mb-ereg-search-getpos.html
-rw-r--r--      8615 2016-12-08 06:18 language.oop5.serialization.html
-rw-r--r--      1360 2016-12-08 06:20 classkit.resources.html
-rw-r--r--      4223 2016-12-08 06:19 function.sqlite-has-prev.html
-rw-r--r--      5753 2016-12-08 06:19 function.eio-sendfile.html
-rw-r--r--      2701 2016-12-08 06:20 function.svn-fs-txn-root.html
-rw-r--r--      5486 2016-12-08 06:19 function.eio-chmod.html
-rw-r--r--      7381 2016-12-08 06:19 imagickpixeliterator.clear.html
-rw-r--r--      7173 2016-12-08 06:18 language.namespaces.fallback.html
-rw-r--r--      2888 2016-12-08 06:18 apcuiterator.key.html
-rw-r--r--      3595 2016-12-08 06:18 function.ncurses-mvvline.html
-rw-r--r--     18649 2016-12-08 06:19 function.mysqlnd-qc-get-core-stats.html
-rw-r--r--      5330 2016-12-08 06:19 function.fann-set-scaling-params.html
-rw-r--r--      3014 2016-12-08 06:19 ref.mysqlnd-qc.html
-rw-r--r--      2804 2016-12-08 06:20 solrquery.removehighlightfield.html
-rw-r--r--      8890 2016-12-08 06:19 mongocommandcursor.info.html
-rw-r--r--      6271 2016-12-08 06:20 sdo-das-relational.construct.html
-rw-r--r--      5484 2016-12-08 06:18 phar.count.html
-rw-r--r--      1400 2016-12-08 06:20 xmlreader.configuration.html
-rw-r--r--      2552 2016-12-08 06:20 solrdocument.valid.html
-rw-r--r--      4287 2016-12-08 06:19 splfileinfo.isdir.html
-rw-r--r--      5297 2016-12-08 06:19 intlchar.getnumericvalue.html
-rw-r--r--      1891 2016-12-08 06:19 mongodb.installation.html
-rw-r--r--      4045 2016-12-08 06:19 function.fdf-set-ap.html
-rw-r--r--      3303 2016-12-08 06:20 sdo-model-type.isopentype.html
-rw-r--r--      3125 2016-12-08 06:18 ref.errorfunc.html
-rw-r--r--      3234 2016-12-08 06:19 function.imagestring.html
-rw-r--r--      2763 2016-12-08 06:18 function.newt-scale-set.html
-rw-r--r--      4588 2016-12-08 06:20 reflectionclass.isinterface.html
-rw-r--r--      9226 2016-12-08 06:19 book.ps.html
-rw-r--r--      3053 2016-12-08 06:18 function.newt-checkbox-tree-get-multi-selection.html
-rw-r--r--      3375 2016-12-08 06:18 function.dbplus-open.html
-rw-r--r--      2067 2016-12-08 06:18 runkit.installation.html
-rw-r--r--     21885 2016-12-08 06:19 mysqlnd-ms.quickstart.xa_transactions.html
-rw-r--r--      7233 2016-12-08 06:18 function.radius-put-vendor-attr.html
-rw-r--r--      1353 2016-12-08 06:19 shmop.examples.html
-rw-r--r--      3108 2016-12-08 06:20 soapserver.setobject.html
-rw-r--r--      4591 2016-12-08 06:20 internals2.opcodes.fetch-obj-r.html
-rw-r--r--      4534 2016-12-08 06:18 ref.wincache.html
-rw-r--r--      2561 2016-12-08 06:19 haruimage.getsize.html
-rw-r--r--      3209 2016-12-08 06:20 ref.xmlrpc.html
-rw-r--r--      7661 2016-12-08 06:20 quickhashstringinthash.update.html
-rw-r--r--      5049 2016-12-08 06:20 function.svn-blame.html
-rw-r--r--      1951 2016-12-08 06:19 function.date-timezone-get.html
-rw-r--r--      1365 2016-12-08 06:19 net-gopher.requirements.html
-rw-r--r--     25810 2016-12-08 06:18 language.oop5.magic.html
-rw-r--r--      2256 2016-12-08 06:19 function.fdf-remove-item.html
-rw-r--r--      9012 2016-12-08 06:20 class.ui-draw-path.html
-rw-r--r--     11731 2016-12-08 06:18 function.debug-backtrace.html
-rw-r--r--      6250 2016-12-08 06:19 function.ftp-exec.html
-rw-r--r--      3571 2016-12-08 06:18 function.odbc-result.html
-rw-r--r--      4689 2016-12-08 06:19 memcached.callbacks.read-through.html
-rw-r--r--     15105 2016-12-08 06:19 mongocollection.remove.html
-rw-r--r--      1847 2016-12-08 06:18 intro.inclued.html
-rw-r--r--      6361 2016-12-08 06:18 language.variables.predefined.html
-rw-r--r--      9980 2016-12-08 06:19 mongodb.authenticate.html
-rw-r--r--      4050 2016-12-08 06:18 pdo.pgsqlcopytofile.html
-rw-r--r--      5322 2016-12-08 06:19 imagick.radialblurimage.html
-rw-r--r--      2616 2016-12-08 06:18 function.ifx-textasvarchar.html
-rw-r--r--     11610 2016-12-08 06:20 reflectionfunction.construct.html
-rw-r--r--     19724 2016-12-08 06:19 imagickdraw.bezier.html
-rw-r--r--      7430 2016-12-08 06:19 function.uniqid.html
-rw-r--r--      3717 2016-12-08 06:20 solrinputdocument.getchilddocumentscount.html
-rw-r--r--      2904 2016-12-08 06:18 function.openssl-x509-read.html
-rw-r--r--      4910 2016-12-08 06:19 imagick.medianfilterimage.html
-rw-r--r--      9998 2016-12-08 06:19 function.exit.html
-rw-r--r--      5070 2016-12-08 06:18 phar.getsupportedcompression.html
-rw-r--r--      4439 2016-12-08 06:18 function.cli-get-process-title.html
-rw-r--r--      5507 2016-12-08 06:19 function.imagecreatefromgd2.html
-rw-r--r--      3971 2016-12-08 06:18 function.fbsql-drop-db.html
-rw-r--r--      2147 2016-12-08 06:19 function.maxdb-execute.html
-rw-r--r--      5387 2016-12-08 06:19 cairocontext.setmatrix.html
-rw-r--r--     10290 2016-12-08 06:20 class.simplexmliterator.html
-rw-r--r--      9417 2016-12-08 06:18 install.unix.nginx.html
-rw-r--r--      6606 2016-12-08 06:19 function.gmp-hamdist.html
-rw-r--r--      3002 2016-12-08 06:20 migration5.configuration.html
-rw-r--r--      5244 2016-12-08 06:19 cairocontext.mask.html
-rw-r--r--      9444 2016-12-08 06:19 yaml.examples.html
-rw-r--r--      6545 2016-12-08 06:20 function.snmp2-walk.html
-rw-r--r--     38087 2016-12-08 06:19 class.ev.html
-rw-r--r--      7617 2016-12-08 06:18 function.fbsql-create-blob.html
-rw-r--r--      8194 2016-12-08 06:19 function.mysqlnd-uh-convert-to-mysqlnd.html
-rw-r--r--      8139 2016-12-08 06:19 mongocursor.awaitdata.html
-rw-r--r--      3442 2016-12-08 06:20 ui-draw-path.arcto.html
-rw-r--r--      2211 2016-12-08 06:18 phar.fileformat.tar.html
-rw-r--r--      3536 2016-12-08 06:20 domelement.getattributenode.html
-rw-r--r--      3277 2016-12-08 06:20 reflectionproperty.getmodifiers.html
-rw-r--r--      3114 2016-12-08 06:18 function.newt-checkbox-set-flags.html
-rw-r--r--      8968 2016-12-08 06:18 closure.bindto.html
-rw-r--r--      3403 2016-12-08 06:20 zookeeper.getstate.html
-rw-r--r--      3405 2016-12-08 06:18 function.openal-context-create.html
-rw-r--r--      9145 2016-12-08 06:20 sdo-das-datafactory.addpropertytotype.html
-rw-r--r--      5412 2016-12-08 06:18 function.ncurses-wborder.html
-rw-r--r--      3051 2016-12-08 06:19 yaf-request-abstract.getparam.html
-rw-r--r--      6810 2016-12-08 06:19 class.mongodb-driver-exception-connectionexception.html
-rw-r--r--      5605 2016-12-08 06:19 function.eio-readahead.html
-rw-r--r--      2646 2016-12-08 06:19 function.mysqli-bind-param.html
-rw-r--r--      2972 2016-12-08 06:18 function.ncurses-flash.html
-rw-r--r--     19200 2016-12-08 06:19 function.mysqlnd-ms-set-user-pick-server.html
-rw-r--r--      3635 2016-12-08 06:18 function.apd-continue.html
-rw-r--r--      3018 2016-12-08 06:19 intltimezone.geterrormessage.html
-rw-r--r--      3578 2016-12-08 06:18 mhash.examples.html
-rw-r--r--      4108 2016-12-08 06:18 install.cloud.azure.html
-rw-r--r--      3360 2016-12-08 06:20 migration54.classes.html
-rw-r--r--      4491 2016-12-08 06:20 ds-set.copy.html
-rw-r--r--      3477 2016-12-08 06:19 hwapi.lock.html
-rw-r--r--      2750 2016-12-08 06:20 zmqdevice.settimertimeout.html
-rw-r--r--      2499 2016-12-08 06:19 function.trader-cos.html
-rw-r--r--      5497 2016-12-08 06:19 function.mailparse-rfc822-parse-addresses.html
-rw-r--r--      3985 2016-12-08 06:18 exception.gettraceasstring.html
-rw-r--r--      3785 2016-12-08 06:20 sdo-sequence.move.html
-rw-r--r--      4070 2016-12-08 06:20 sphinx.examples.html
-rw-r--r--      9714 2016-12-08 06:19 yaf-route-map.construct.html
-rw-r--r--      9769 2016-12-08 06:19 imagickdraw.setfont.html
-rw-r--r--      7186 2016-12-08 06:19 syncsharedmemory.read.html
-rw-r--r--      7281 2016-12-08 06:20 reflectionclass.getdefaultproperties.html
-rw-r--r--      4183 2016-12-08 06:19 function.mailparse-msg-extract-part.html
-rw-r--r--      5399 2016-12-08 06:19 function.eio-utime.html
-rw-r--r--      6186 2016-12-08 06:19 function.lchown.html
-rw-r--r--     11610 2016-12-08 06:20 sca.examples.understanding-wsdl.html
-rw-r--r--      5032 2016-12-08 06:19 cairocontext.getfontface.html
-rw-r--r--      1881 2016-12-08 06:19 stream.filters.html
-rw-r--r--      5312 2016-12-08 06:19 imagick.setpointsize.html
-rw-r--r--      4904 2016-12-08 06:19 function.cairo-pdf-surface-create.html
-rw-r--r--      4117 2016-12-08 06:20 book.stomp.html
-rw-r--r--      2179 2016-12-08 06:19 dio.installation.html
-rw-r--r--      7110 2016-12-08 06:19 function.mysqlnd-ms-match-wild.html
-rw-r--r--      5511 2016-12-08 06:18 reserved.variables.post.html
-rw-r--r--      3271 2016-12-08 06:19 function.trader-cdl3blackcrows.html
-rw-r--r--      3101 2016-12-08 06:19 swfsoundinstance.loopinpoint.html
-rw-r--r--      2835 2016-12-08 06:19 mongodb.selectcollection.html
-rw-r--r--      9865 2016-12-08 06:20 solrclient.query.html
-rw-r--r--      1610 2016-12-08 06:18 mcrypt.installation.html
-rw-r--r--      2503 2016-12-08 06:19 imagickdraw.gettextinterwordspacing.html
-rw-r--r--     29620 2016-12-08 06:18 pdostatement.fetch.html
-rw-r--r--      2458 2016-12-08 06:19 evwatcher.getloop.html
-rw-r--r--      2827 2016-12-08 06:18 function.ncurses-putp.html
-rw-r--r--      4111 2016-12-08 06:19 eventhttprequest.sendreply.html
-rw-r--r--      9675 2016-12-08 06:20 reflectionproperty.setvalue.html
-rw-r--r--      3591 2016-12-08 06:18 function.ncurses-mvhline.html
-rw-r--r--      2778 2016-12-08 06:19 book.mysqlnd-memcache.html
-rw-r--r--      1862 2016-12-08 06:19 enchant.requirements.html
-rw-r--r--      3586 2016-12-08 06:19 cairopattern.construct.html
-rw-r--r--      2735 2016-12-08 06:19 function.px-delete.html
-rw-r--r--      3510 2016-12-08 06:19 multipleiterator.containsiterator.html
-rw-r--r--      3574 2016-12-08 06:18 function.dbplus-getunique.html
-rw-r--r--      4129 2016-12-08 06:20 ref.mnogosearch.html
-rw-r--r--      4962 2016-12-08 06:20 function.apache-response-headers.html
-rw-r--r--      2478 2016-12-08 06:19 oci-collection.size.html
-rw-r--r--      2476 2016-12-08 06:19 function.event-base-free.html
-rw-r--r--      3107 2016-12-08 06:19 swfsoundinstance.loopoutpoint.html
-rw-r--r--      2311 2016-12-08 06:18 book.inclued.html
-rw-r--r--      1600 2016-12-08 06:20 sdodasrel.setup.html
-rw-r--r--      5492 2016-12-08 06:19 tokyotyrant.setmaster.html
-rw-r--r--      1374 2016-12-08 06:19 mime-magic.resources.html
-rw-r--r--      2940 2016-12-08 06:19 class.yaf-exception-dispatchfailed.html
-rw-r--r--      4394 2016-12-08 06:20 migration54.ini.html
-rw-r--r--      3014 2016-12-08 06:19 eventbuffer.add.html
-rw-r--r--      1333 2016-12-08 06:19 exec.requirements.html
-rw-r--r--      4022 2016-12-08 06:20 sdodasrel.requirements.html
-rw-r--r--      2544 2016-12-08 06:19 function.ldap-parse-reference.html
-rw-r--r--      2401 2016-12-08 06:18 function.ncurses-slk-refresh.html
-rw-r--r--      3444 2016-12-08 06:19 harupage.showtext.html
-rw-r--r--      3089 2016-12-08 06:18 function.newt-grid-v-close-stacked.html
-rw-r--r--      2329 2016-12-08 06:19 function.ldap-unbind.html
-rw-r--r--     11380 2016-12-08 06:20 faq.mailinglist.html
-rw-r--r--      2838 2016-12-08 06:19 eventhttprequest.getcommand.html
-rw-r--r--      3878 2016-12-08 06:20 reflectionparameter.export.html
-rw-r--r--      1888 2016-12-08 06:18 language.errors.html
-rw-r--r--      3677 2016-12-08 06:19 intlchar.foldcase.html
-rw-r--r--      2518 2016-12-08 06:19 function.trader-asin.html
-rw-r--r--      2809 2016-12-08 06:19 swfvideostream.setdimension.html
-rw-r--r--      3019 2016-12-08 06:20 svmmodel.construct.html
-rw-r--r--      1416 2016-12-08 06:19 mysql.examples.html
-rw-r--r--      7698 2016-12-08 06:19 imagick.levelimage.html
-rw-r--r--      5429 2016-12-08 06:19 function.rpm-get-tag.html
-rw-r--r--      1655 2016-12-08 06:19 intro.tokenizer.html
-rw-r--r--      7268 2016-12-08 06:19 mysqlnduhconnection.endpsession.html
-rw-r--r--      2724 2016-12-08 06:19 recode.installation.html
-rw-r--r--      3728 2016-12-08 06:19 function.sybase-min-client-severity.html
drwxr-xr-x         0 2016-12-08 06:20 images/
-rw-r--r--       712 2016-12-08 06:19 images/21009b70229598c6a80eef8b45bf282b-imagefilledarc.png
-rw-r--r--     26214 2016-12-08 06:18 images/0baa1b9fae6aec55bbb73037f3016001-xkcd-goto.png
-rw-r--r--      1266 2016-12-08 06:19 images/21009b70229598c6a80eef8b45bf282b-imageconvolution_gaussian.png
-rw-r--r--     17535 2016-12-08 06:20 images/befd863081615f539082d9ff76bf7b39-zend.04-cross-converter.png
-rw-r--r--      5968 2016-12-08 06:18 images/12f37b1c6963c1c5c18f30495416a197-loop-array.png
-rw-r--r--    189105 2016-12-08 06:19 images/21009b70229598c6a80eef8b45bf282b-watermarks.png
-rw-r--r--       521 2016-12-08 06:19 images/c0d23d2d6769e53e24a1b3136c064577-floodfillpaint_result.png
-rw-r--r--     22096 2016-12-08 06:19 images/21009b70229598c6a80eef8b45bf282b-imagesettile.png
-rw-r--r--      9586 2016-12-08 06:19 images/c0d23d2d6769e53e24a1b3136c064577-hello_world_reflection.png
-rw-r--r--     31908 2016-12-08 06:18 images/cecce51a7b8d511715c8589036b98463-xkcd-bobby-tables.png
-rw-r--r--      8398 2016-12-08 06:18 images/b4cf2bb34e3c20eebcf8f9e8e7949efd-iis6defaultdoc.png
-rw-r--r--       107 2016-12-08 06:19 images/21009b70229598c6a80eef8b45bf282b-imagechar.png
-rw-r--r--      9414 2016-12-08 06:19 images/55c7816ef6df6821f05678a68b4e4e63-mymemflow.png
-rw-r--r--     25905 2016-12-08 06:18 images/b4cf2bb34e3c20eebcf8f9e8e7949efd-iis6anonauth.png
-rw-r--r--      7025 2016-12-08 06:20 images/befd863081615f539082d9ff76bf7b39-zend.07-warning-messages.png
-rw-r--r--       287 2016-12-08 06:19 images/21009b70229598c6a80eef8b45bf282b-imagecreatetruecolor.png
-rw-r--r--       917 2016-12-08 06:19 images/21009b70229598c6a80eef8b45bf282b-imagelayereffect.png
-rw-r--r--      1874 2016-12-08 06:19 images/21009b70229598c6a80eef8b45bf282b-imagesetbrush.png
-rw-r--r--      5978 2016-12-08 06:19 images/c0d23d2d6769e53e24a1b3136c064577-adaptiveBlurImage.gif
-rw-r--r--     10201 2016-12-08 06:18 images/12f37b1c6963c1c5c18f30495416a197-simple-array2.png
-rw-r--r--      2629 2016-12-08 06:19 images/21009b70229598c6a80eef8b45bf282b-imagesetstyle.jpg
-rw-r--r--       221 2016-12-08 06:19 images/21009b70229598c6a80eef8b45bf282b-imagecreatefromgif.gif
-rw-r--r--      1474 2016-12-08 06:19 images/21009b70229598c6a80eef8b45bf282b-imageellipse.png
-rw-r--r--     30544 2016-12-08 06:18 images/b4cf2bb34e3c20eebcf8f9e8e7949efd-iis7handlermap.png
-rw-r--r--     62231 2016-12-08 06:18 images/12f37b1c6963c1c5c18f30495416a197-gc-benchmark.png
-rw-r--r--      5018 2016-12-08 06:19 images/21009b70229598c6a80eef8b45bf282b-imagefilterpixelate.png
-rw-r--r--       497 2016-12-08 06:19 images/c0d23d2d6769e53e24a1b3136c064577-floodfillpaint_intermediate.png
-rw-r--r--     17127 2016-12-08 06:19 images/21009b70229598c6a80eef8b45bf282b-imagecopyresampled_2.jpg
-rw-r--r--       377 2016-12-08 06:19 images/21009b70229598c6a80eef8b45bf282b-imagesetthickness.png
-rw-r--r--      1443 2016-12-08 06:19 images/21009b70229598c6a80eef8b45bf282b-imageantialias.png
-rw-r--r--     18502 2016-12-08 06:20 images/befd863081615f539082d9ff76bf7b39-zend.01-internal-structure.png
-rw-r--r--     73387 2016-12-08 06:20 images/4fd86c7f1b197d1d954ad0f4b033dc93-yar.png
-rw-r--r--      9665 2016-12-08 06:20 images/befd863081615f539082d9ff76bf7b39-zend.09-execution-info.png
-rw-r--r--      3403 2016-12-08 06:19 images/c0d23d2d6769e53e24a1b3136c064577-distortImage.png
-rw-r--r--     50382 2016-12-08 06:19 images/f3bc48edf40d5e3e09a166c7fadc7efb-driver_arch.png
-rw-r--r--     19547 2016-12-08 06:20 images/befd863081615f539082d9ff76bf7b39-zend.06-variable-creation.png
-rw-r--r--      2350 2016-12-08 06:19 images/c0d23d2d6769e53e24a1b3136c064577-functionImage_polynomial.png
-rw-r--r--    103817 2016-12-08 06:20 images/2a34c7f2e658f6ae74f3869f2aa5886f-crypt-text-rendered.svg
-rw-r--r--      5630 2016-12-08 06:19 images/c0d23d2d6769e53e24a1b3136c064577-hello_world.png
-rw-r--r--     37752 2016-12-08 06:19 images/e88cefb5c3fca5060e2490b9763c4433-readfile.png
-rw-r--r--     54553 2016-12-08 06:18 images/b4cf2bb34e3c20eebcf8f9e8e7949efd-iis7w2k8cgi.png
-rw-r--r--      1301 2016-12-08 06:19 images/21009b70229598c6a80eef8b45bf282b-imagejpeg.jpg
-rw-r--r--     19682 2016-12-08 06:20 images/befd863081615f539082d9ff76bf7b39-zend.05-reference-test.png
-rw-r--r--      2859 2016-12-08 06:19 images/21009b70229598c6a80eef8b45bf282b-imagecolorallocatealpha.png
-rw-r--r--      1301 2016-12-08 06:19 images/21009b70229598c6a80eef8b45bf282b-imagecopyresized.jpg
-rw-r--r--     55381 2016-12-08 06:18 images/b4cf2bb34e3c20eebcf8f9e8e7949efd-iis7handlericon.png
-rw-r--r--      2373 2016-12-08 06:19 images/c0d23d2d6769e53e24a1b3136c064577-functionImage_sinusoidal.png
-rw-r--r--     48022 2016-12-08 06:18 images/b4cf2bb34e3c20eebcf8f9e8e7949efd-iis7vistacgi.png
-rw-r--r--     22197 2016-12-08 06:20 images/befd863081615f539082d9ff76bf7b39-zend.08-phpinfo-output.png
-rw-r--r--      2453 2016-12-08 06:19 images/c0d23d2d6769e53e24a1b3136c064577-functionImage_multiplied.png
-rw-r--r--      1696 2016-12-08 06:19 images/21009b70229598c6a80eef8b45bf282b-imagearc.png
-rw-r--r--       138 2016-12-08 06:19 images/21009b70229598c6a80eef8b45bf282b-imagecreatefromstring.png
-rw-r--r--    193967 2016-12-08 06:19 images/21009b70229598c6a80eef8b45bf282b-watermark-merged.png
-rw-r--r--      1214 2016-12-08 06:19 images/21009b70229598c6a80eef8b45bf282b-imagecopyresampled.jpg
-rw-r--r--     30936 2016-12-08 06:18 images/12f37b1c6963c1c5c18f30495416a197-gc-algorithm.png
-rw-r--r--      5348 2016-12-08 06:18 images/12f37b1c6963c1c5c18f30495416a197-leak-array.png
-rw-r--r--      6804 2016-12-08 06:19 images/21009b70229598c6a80eef8b45bf282b-imagerotate.jpg
-rw-r--r--      9359 2016-12-08 06:18 images/12f37b1c6963c1c5c18f30495416a197-simple-array.png
-rw-r--r--      3004 2016-12-08 06:19 images/21009b70229598c6a80eef8b45bf282b-imageconvolution_emboss.png
-rw-r--r--      1724 2016-12-08 06:19 images/21009b70229598c6a80eef8b45bf282b-imagefilledellipse.png
-rw-r--r--     21269 2016-12-08 06:19 images/c0d23d2d6769e53e24a1b3136c064577-php_logo.png
-rw-r--r--       979 2016-12-08 06:19 images/21009b70229598c6a80eef8b45bf282b-imageopenpolygon.png
-rw-r--r--      2237 2016-12-08 06:19 images/21009b70229598c6a80eef8b45bf282b-imagefliphorizontal.png
-rw-r--r--      2223 2016-12-08 06:19 images/21009b70229598c6a80eef8b45bf282b-imageflipvertical.png
-rw-r--r--       346 2016-12-08 06:19 images/c0d23d2d6769e53e24a1b3136c064577-importimagepixels.jpg
-rw-r--r--      6045 2016-12-08 06:18 function.hash.html
-rw-r--r--      5627 2016-12-08 06:19 splobjectstorage.detach.html
-rw-r--r--      6524 2016-12-08 06:20 class.zmqdevice.html
-rw-r--r--      3570 2016-12-08 06:19 eventbuffer.write.html
-rw-r--r--      7959 2016-12-08 06:19 function.pg-fetch-result.html
-rw-r--r--      2390 2016-12-08 06:19 gmagick.getimageunits.html
-rw-r--r--     13409 2016-12-08 06:19 function.define-syslog-variables.html
-rw-r--r--      7878 2016-12-08 06:19 intlchar.enumcharnames.html
-rw-r--r--      2894 2016-12-08 06:19 intltimezone.hassamerules.html
-rw-r--r--      5358 2016-12-08 06:20 class.yar-client.html
-rw-r--r--      3477 2016-12-08 06:19 function.fann-get-cascade-min-cand-epochs.html
-rw-r--r--      4741 2016-12-08 06:19 mysqli.more-results.html
-rw-r--r--      5347 2016-12-08 06:19 function.date-parse-from-format.html
-rw-r--r--      1905 2016-12-08 06:19 function.pdf-set-word-spacing.html
-rw-r--r--      2481 2016-12-08 06:20 solrparams.getpreparedparams.html
-rw-r--r--      2732 2016-12-08 06:19 class.luaclosure.html
-rw-r--r--      2248 2016-12-08 06:19 intro.dio.html
-rw-r--r--      3269 2016-12-08 06:20 xsltprocessor.setsecurityprefs.html
-rw-r--r--     12698 2016-12-08 06:18 pdo.prepare.html
-rw-r--r--      9365 2016-12-08 06:20 xml.constants.html
-rw-r--r--      3465 2016-12-08 06:19 function.imap-utf7-encode.html
-rw-r--r--      6709 2016-12-08 06:18 function.hash-update-stream.html
-rw-r--r--      3942 2016-12-08 06:18 function.ob-clean.html
-rw-r--r--      1777 2016-12-08 06:20 internals2.opcodes.send-var-no-ref.html
-rw-r--r--      6069 2016-12-08 06:18 function.cubrid-num-cols.html
-rw-r--r--      2643 2016-12-08 06:19 function.trader-mom.html
-rw-r--r--      4375 2016-12-08 06:19 function.posix-setrlimit.html
-rw-r--r--      3597 2016-12-08 06:19 arrayiterator.natsort.html
-rw-r--r--      2420 2016-12-08 06:19 function.mysqli-rpl-probe.html
-rw-r--r--     24813 2016-12-08 06:19 mysqli.real-connect.html
-rw-r--r--     25194 2016-12-08 06:19 class.collator.html
-rw-r--r--      1730 2016-12-08 06:20 xmlwriter.installation.html
-rw-r--r--      2923 2016-12-08 06:18 iteratoraggregate.getiterator.html
-rw-r--r--      5813 2016-12-08 06:20 solrquery.setgrouptruncate.html
-rw-r--r--     12396 2016-12-08 06:20 class.quickhashinthash.html
-rw-r--r--      2904 2016-12-08 06:19 cachingiterator.construct.html
-rw-r--r--      8612 2016-12-08 06:18 function.fbsql-read-clob.html
-rw-r--r--      7431 2016-12-08 06:18 function.cubrid-field-table.html
-rw-r--r--      6651 2016-12-08 06:19 splobjectstorage.offsetexists.html
-rw-r--r--      5313 2016-12-08 06:19 tokyotyranttable.out.html
-rw-r--r--      2538 2016-12-08 06:19 hrtime-performancecounter.stop.html
-rw-r--r--      3797 2016-12-08 06:20 domnode.c14n.html
-rw-r--r--      6162 2016-12-08 06:19 function.mb-substitute-character.html
-rw-r--r--      8666 2016-12-08 06:20 regexp.reference.character-classes.html
-rw-r--r--     10266 2016-12-08 06:19 mysqlinfo.concepts.buffering.html
-rw-r--r--      4317 2016-12-08 06:20 domdocument.construct.html
-rw-r--r--      4135 2016-12-08 06:19 mongotimestamp.construct.html
-rw-r--r--      4644 2016-12-08 06:19 mysqli-stmt.construct.html
-rw-r--r--      3693 2016-12-08 06:20 function.win32-pause-service.html
-rw-r--r--      2845 2016-12-08 06:18 function.ifx-update-blob.html
-rw-r--r--      4943 2016-12-08 06:18 ref.pdo-odbc.connection.html
-rw-r--r--      3272 2016-12-08 06:19 spldoublylinkedlist.offsetget.html
-rw-r--r--     12645 2016-12-08 06:19 function.sqlite-fetch-all.html
-rw-r--r--      8147 2016-12-08 06:20 function.ssh2-publickey-add.html
-rw-r--r--      5454 2016-12-08 06:19 function.parsekit-func-arginfo.html
-rw-r--r--     31041 2016-12-08 06:19 ref.maxdb.html
-rw-r--r--      4279 2016-12-08 06:18 function.runkit-function-rename.html
-rw-r--r--     13247 2016-12-08 06:20 svn.constants.html
-rw-r--r--     10873 2016-12-08 06:19 filesystem.constants.html
-rw-r--r--      2811 2016-12-08 06:18 intro.zlib.html
-rw-r--r--      2685 2016-12-08 06:19 yaf-response-abstract.setheader.html
-rw-r--r--      3156 2016-12-08 06:18 function.newt-scale.html
-rw-r--r--      5559 2016-12-08 06:19 function.grapheme-strlen.html
-rw-r--r--      2476 2016-12-08 06:19 datetime.formats.html
-rw-r--r--      3291 2016-12-08 06:20 function.udm-free-ispell-data.html
-rw-r--r--      2691 2016-12-08 06:19 function.trader-roc.html
-rw-r--r--      1848 2016-12-08 06:18 ref.mhash.html
-rw-r--r--      3818 2016-12-08 06:19 function.ps-close-image.html
-rw-r--r--      2361 2016-12-08 06:18 ref.bzip2.html
-rw-r--r--      2171 2016-12-08 06:19 function.event-new.html
-rw-r--r--      2467 2016-12-08 06:19 event.setpriority.html
-rw-r--r--      5698 2016-12-08 06:18 control-structures.do.while.html
-rw-r--r--      6971 2016-12-08 06:20 migration53.methods.html
-rw-r--r--     15519 2016-12-08 06:19 function.mysqlnd-qc-get-normalized-query-trace-log.html
-rw-r--r--     30862 2016-12-08 06:20 faq.installation.html
-rw-r--r--      4889 2016-12-08 06:19 memcached.getresultmessage.html
-rw-r--r--      1850 2016-12-08 06:20 internals2.memory.html
-rw-r--r--      7701 2016-12-08 06:20 function.array-flip.html
-rw-r--r--     15738 2016-12-08 06:18 language.types.type-juggling.html
-rw-r--r--      2836 2016-12-08 06:20 reflectionproperty.tostring.html
-rw-r--r--      2461 2016-12-08 06:18 audioproperties.getsamplebitrate.html
-rw-r--r--      2250 2016-12-08 06:19 mqseries.constants.html
-rw-r--r--      3008 2016-12-08 06:19 recursiveiteratoriterator.callgetchildren.html
-rw-r--r--      3923 2016-12-08 06:20 internals2.opcodes.include-or-eval.html
-rw-r--r--      3743 2016-12-08 06:18 function.openssl-pkey-new.html
-rw-r--r--      3148 2016-12-08 06:18 function.openal-source-destroy.html
-rw-r--r--      7631 2016-12-08 06:19 splfileobject.key.html
-rw-r--r--      3612 2016-12-08 06:19 class.mongodb-bson-timestamp.html
-rw-r--r--      1255 2016-12-08 06:18 csprng.constants.html
-rw-r--r--     15927 2016-12-08 06:18 language.oop5.interfaces.html
-rw-r--r--      1825 2016-12-08 06:18 book.htscanner.html
-rw-r--r--      5125 2016-12-08 06:19 directoryiterator.getsize.html
-rw-r--r--      1823 2016-12-08 06:20 function.is-double.html
-rw-r--r--      2085 2016-12-08 06:18 refs.remote.auth.html
-rw-r--r--      1567 2016-12-08 06:20 classobj.setup.html
-rw-r--r--      5738 2016-12-08 06:18 function.password-verify.html
-rw-r--r--      1490 2016-12-08 06:18 bzip2.requirements.html
-rw-r--r--     16671 2016-12-08 06:18 features.file-upload.post-method.html
-rw-r--r--      2013 2016-12-08 06:19 mssql.installation.html
-rw-r--r--      4032 2016-12-08 06:20 ds-stack.clear.html
-rw-r--r--      4261 2016-12-08 06:20 samconnection.setdebug.html
-rw-r--r--      1386 2016-12-08 06:19 paradox.configuration.html
-rw-r--r--      5640 2016-12-08 06:18 reserved.variables.get.html
-rw-r--r--      1599 2016-12-08 06:19 chdb.requirements.html
-rw-r--r--      5374 2016-12-08 06:20 ds-priorityqueue.toarray.html
-rw-r--r--      3915 2016-12-08 06:19 cairoscaledfont.glyphextents.html
-rw-r--r--      2778 2016-12-08 06:19 mongocommandcursor.key.html
-rw-r--r--      2430 2016-12-08 06:20 solrquery.getstatsfields.html
-rw-r--r--      1207 2016-12-08 06:18 manual.html
-rw-r--r--     20730 2016-12-08 06:19 mysqli.query.html
-rw-r--r--      2687 2016-12-08 06:20 solrparams.get.html
-rw-r--r--      2140 2016-12-08 06:18 language.types.html
-rw-r--r--      5578 2016-12-08 06:18 function.inflate-init.html
-rw-r--r--      2707 2016-12-08 06:19 yaf-config-ini.offsetget.html
-rw-r--r--      3135 2016-12-08 06:19 intlbreakiterator.createcharacterinstance.html
-rw-r--r--      4099 2016-12-08 06:19 swfshape.drawcurve.html
-rw-r--r--      3260 2016-12-08 06:19 class.mongodb-bson-objectid.html
-rw-r--r--      8869 2016-12-08 06:19 function.fann-create-train-from-callback.html
-rw-r--r--      5604 2016-12-08 06:19 imagick.modulateimage.html
-rw-r--r--     13672 2016-12-08 06:19 mysqli-stmt.error-list.html
-rw-r--r--      2955 2016-12-08 06:18 apciterator.valid.html
-rw-r--r--      3152 2016-12-08 06:19 book.mqseries.html
-rw-r--r--     13391 2016-12-08 06:18 phar.uncompressallfiles.html
-rw-r--r--      1921 2016-12-08 06:19 intro.math.html
-rw-r--r--      3167 2016-12-08 06:19 imagick.setimageprofile.html
-rw-r--r--      8662 2016-12-08 06:19 function.date-default-timezone-get.html
-rw-r--r--      2720 2016-12-08 06:19 gmagick.getimagehistogram.html
-rw-r--r--     11181 2016-12-08 06:18 pdostatement.debugdumpparams.html
-rw-r--r--      4521 2016-12-08 06:19 mongocode.tostring.html
-rw-r--r--      9744 2016-12-08 06:20 function.print-r.html
-rw-r--r--      5729 2016-12-08 06:19 directoryiterator.next.html
-rw-r--r--      3570 2016-12-08 06:19 mongoid.gethostname.html
-rw-r--r--      3380 2016-12-08 06:20 oauth.getcapath.html
-rw-r--r--      1680 2016-12-08 06:18 hash.installation.html
-rw-r--r--      6100 2016-12-08 06:19 imagick.getiteratorindex.html
-rw-r--r--      5237 2016-12-08 06:20 ds-set.xor.html
-rw-r--r--     13982 2016-12-08 06:18 book.cubrid.html
-rw-r--r--     21388 2016-12-08 06:19 function.oci-new-descriptor.html
-rw-r--r--      2819 2016-12-08 06:19 function.imagecolorexact.html
-rw-r--r--      5516 2016-12-08 06:19 function.pspell-save-wordlist.html
-rw-r--r--      9372 2016-12-08 06:19 numberformatter.getpattern.html
-rw-r--r--      2490 2016-12-08 06:20 internals2.opcodes.jmpz-ex.html
-rw-r--r--      2072 2016-12-08 06:19 intro.mime-magic.html
-rw-r--r--      5467 2016-12-08 06:19 class.datetimeinterface.html
-rw-r--r--      7497 2016-12-08 06:20 function.socket-getpeername.html
-rw-r--r--     16426 2016-12-08 06:20 function.array-filter.html
-rw-r--r--      3567 2016-12-08 06:19 gmagick.thumbnailimage.html
-rw-r--r--      3898 2016-12-08 06:19 mongocursor.hint.html
-rw-r--r--      7569 2016-12-08 06:19 mysqlnduhconnection.serverdumpdebuginformation.html
-rw-r--r--      8232 2016-12-08 06:18 pdo.exec.html
-rw-r--r--      4015 2016-12-08 06:18 function.newt-textbox-reflowed.html
-rw-r--r--      2364 2016-12-08 06:20 varnishadmin.auth.html
-rw-r--r--      4656 2016-12-08 06:18 function.openssl-csr-export-to-file.html
-rw-r--r--      3002 2016-12-08 06:19 fannconnection.setweight.html
-rw-r--r--      8865 2016-12-08 06:19 ldap.constants.html
-rw-r--r--      2518 2016-12-08 06:20 rrdcreator.save.html
-rw-r--r--      5447 2016-12-08 06:19 function.pg-host.html
-rw-r--r--      6452 2016-12-08 06:19 function.getmxrr.html
-rw-r--r--      8302 2016-12-08 06:19 class.dateinterval.html
-rw-r--r--      4212 2016-12-08 06:18 function.dbplus-rcrtexact.html
-rw-r--r--      4229 2016-12-08 06:19 streamwrapper.stream-write.html
-rw-r--r--      4366 2016-12-08 06:18 function.fbsql-set-transaction.html
-rw-r--r--      7225 2016-12-08 06:19 mongodb-driver-writeconcernerror.getmessage.html
-rw-r--r--      5525 2016-12-08 06:20 swish.construct.html
-rw-r--r--      4765 2016-12-08 06:19 imagick.setimageorientation.html
-rw-r--r--      2920 2016-12-08 06:19 splsubject.detach.html
-rw-r--r--      3637 2016-12-08 06:19 function.sybase-field-seek.html
-rw-r--r--      6869 2016-12-08 06:18 function.uopz-function.html
-rw-r--r--      1360 2016-12-08 06:19 parsekit.resources.html
-rw-r--r--      3085 2016-12-08 06:20 internals2.opcodes.assign-obj.html
-rw-r--r--      1782 2016-12-08 06:20 ref.simplexml.html
-rw-r--r--      2986 2016-12-08 06:20 solrcollapsefunction.getsize.html
-rw-r--r--      3007 2016-12-08 06:19 harupage.movetonextline.html
-rw-r--r--     14804 2016-12-08 06:19 imagickdraw.setfillrule.html
-rw-r--r--      7334 2016-12-08 06:18 rarexception.setusingexceptions.html
-rw-r--r--      9359 2016-12-08 06:19 mongodb-driver-writeresult.getupsertedids.html
-rw-r--r--      3805 2016-12-08 06:19 function.event-add.html
-rw-r--r--      1339 2016-12-08 06:19 haru.examples.html
-rw-r--r--      8463 2016-12-08 06:18 function.runkit-function-add.html
-rw-r--r--      2598 2016-12-08 06:18 function.odbc-num-rows.html
-rw-r--r--      3938 2016-12-08 06:19 swfdisplayitem.skewyto.html
-rw-r--r--      7878 2016-12-08 06:20 function.get-parent-class.html
-rw-r--r--      2577 2016-12-08 06:19 harufont.getdescent.html
-rw-r--r--      9694 2016-12-08 06:19 function.gmp-gcdext.html
-rw-r--r--      6872 2016-12-08 06:19 function.curl-escape.html
-rw-r--r--      2933 2016-12-08 06:20 reflectionparameter.getposition.html
-rw-r--r--      6846 2016-12-08 06:19 function.is-dir.html
-rw-r--r--      3275 2016-12-08 06:20 solrquery.sethighlightsnippets.html
-rw-r--r--      9969 2016-12-08 06:18 function.db2-rollback.html
-rw-r--r--      5778 2016-12-08 06:19 directoryiterator.isdir.html
-rw-r--r--      2856 2016-12-08 06:19 book.lapack.html
-rw-r--r--      2477 2016-12-08 06:19 function.pdf-arc.html
-rw-r--r--      3968 2016-12-08 06:19 tokyotyranttable.putnr.html
-rw-r--r--      1981 2016-12-08 06:18 function.get-required-files.html
-rw-r--r--      2278 2016-12-08 06:20 ui-window.hasborders.html
-rw-r--r--      2374 2016-12-08 06:19 class.mongodb-driver-exception-exception.html
-rw-r--r--      1666 2016-12-08 06:19 v8js.installation.html
-rw-r--r--      3063 2016-12-08 06:19 yaf-request-abstract.setparam.html
-rw-r--r--      8996 2016-12-08 06:19 sqlite3.createcollation.html
-rw-r--r--      2608 2016-12-08 06:19 function.stats-skew.html
-rw-r--r--      3113 2016-12-08 06:19 function.pdf-shading.html
-rw-r--r--      2673 2016-12-08 06:19 imagick.setimagegamma.html
-rw-r--r--     15958 2016-12-08 06:18 langref.html
-rw-r--r--      9493 2016-12-08 06:18 ziparchive.locatename.html
-rw-r--r--      1696 2016-12-08 06:20 win32ps.installation.html
-rw-r--r--      1347 2016-12-08 06:18 ingres.examples.html
-rw-r--r--      2626 2016-12-08 06:19 mongoclient.tostring.html
-rw-r--r--      2068 2016-12-08 06:19 book.mail.html
-rw-r--r--      3870 2016-12-08 06:19 harudoc.setpagelayout.html
-rw-r--r--      7115 2016-12-08 06:19 ev.supportedbackends.html
-rw-r--r--      9823 2016-12-08 06:19 function.mysqlnd-ms-get-last-gtid.html
-rw-r--r--      2496 2016-12-08 06:19 yaf-view-simple.isset.html
-rw-r--r--      5780 2016-12-08 06:18 function.cubrid-num-fields.html
-rw-r--r--      1868 2016-12-08 06:20 intro.solr.html
-rw-r--r--     32290 2016-12-08 06:19 changelog.mongo.html
-rw-r--r--      5892 2016-12-08 06:19 intlcalendar.getlocale.html
-rw-r--r--      3166 2016-12-08 06:19 swfshape.drawarc.html
-rw-r--r--      4599 2016-12-08 06:18 pdo-4d.sqltypes.html
-rw-r--r--      2407 2016-12-08 06:18 audioproperties.getlength.html
-rw-r--r--     81884 2016-12-08 06:19 curl.constants.html
-rw-r--r--      4641 2016-12-08 06:18 function.inclued-get-data.html
-rw-r--r--      4802 2016-12-08 06:19 function.oci-fetch-object.html
-rw-r--r--     10821 2016-12-08 06:19 mongo.connecting.rs.html
-rw-r--r--      3628 2016-12-08 06:19 imagick.quantizeimages.html
-rw-r--r--      5891 2016-12-08 06:20 ref.sdodasrel.html
-rw-r--r--      6373 2016-12-08 06:18 function.radius-cvt-addr.html
-rw-r--r--      5045 2016-12-08 06:18 function.openssl-private-encrypt.html
-rw-r--r--      4355 2016-12-08 06:19 imagick.configuration.html
-rw-r--r--      3590 2016-12-08 06:18 book.errorfunc.html
-rw-r--r--      2845 2016-12-08 06:19 function.ldap-parse-result.html
-rw-r--r--      6099 2016-12-08 06:19 mongocollection.getindexinfo.html
-rw-r--r--      5710 2016-12-08 06:19 imagick.gammaimage.html
-rw-r--r--      3252 2016-12-08 06:19 mysqlnd-mux.constants.html
-rw-r--r--      2456 2016-12-08 06:20 ui-controls-editablecombo.settext.html
-rw-r--r--      3817 2016-12-08 06:19 lua.eval.html
-rw-r--r--      2989 2016-12-08 06:18 dbx.requirements.html
-rw-r--r--      3450 2016-12-08 06:18 function.ibase-free-event-handler.html
-rw-r--r--      6257 2016-12-08 06:19 mongodate.construct.html
-rw-r--r--      2368 2016-12-08 06:20 ui-draw-path.construct.html
-rw-r--r--      2568 2016-12-08 06:19 swfmovie.importfont.html
-rw-r--r--      2276 2016-12-08 06:19 function.pdf-lineto.html
-rw-r--r--      1360 2016-12-08 06:19 datetime.resources.html
-rw-r--r--      1361 2016-12-08 06:19 datetime.requirements.html
-rw-r--r--      2650 2016-12-08 06:19 yaf-controller-abstract.setviewpath.html
-rw-r--r--      5078 2016-12-08 06:19 imagick.queryfonts.html
-rw-r--r--      4090 2016-12-08 06:19 function.cairo-ps-get-levels.html
-rw-r--r--      6251 2016-12-08 06:18 function.set-include-path.html
-rw-r--r--      6879 2016-12-08 06:20 book.soap.html
-rw-r--r--      3806 2016-12-08 06:19 cairofontoptions.gethintmetrics.html
-rw-r--r--      3104 2016-12-08 06:20 internals2.opcodes.is-not-equal.html
-rw-r--r--      2421 2016-12-08 06:20 ui-controls-entry.gettext.html
-rw-r--r--      4645 2016-12-08 06:19 cairocontext.devicetouser.html
-rw-r--r--      8575 2016-12-08 06:19 intl.constants.html
-rw-r--r--      7463 2016-12-08 06:19 datetimezone.getoffset.html
-rw-r--r--      8070 2016-12-08 06:19 function.realpath.html
-rw-r--r--      9715 2016-12-08 06:19 function.imap-mailboxmsginfo.html
-rw-r--r--     11513 2016-12-08 06:20 function.in-array.html
-rw-r--r--      5639 2016-12-08 06:19 function.cairo-image-surface-create-for-data.html
-rw-r--r--      3903 2016-12-08 06:18 function.ibase-blob-create.html
-rw-r--r--      6062 2016-12-08 06:20 yar-server-exception.gettype.html
-rw-r--r--      4089 2016-12-08 06:20 win32service.constants.basepriorities.html
-rw-r--r--      2664 2016-12-08 06:19 yaf-config-abstract.set.html
-rw-r--r--      2593 2016-12-08 06:19 uconverter.geterrormessage.html
-rw-r--r--      1698 2016-12-08 06:19 xdiff.requirements.html
-rw-r--r--      5588 2016-12-08 06:18 function.get-extension-funcs.html
-rw-r--r--      7210 2016-12-08 06:20 function.get-object-vars.html
-rw-r--r--      2533 2016-12-08 06:18 function.ncurses-termattrs.html
-rw-r--r--      4498 2016-12-08 06:19 function.mysqlnd-ms-fabric-select-shard.html
-rw-r--r--      6297 2016-12-08 06:19 mysqlnd.overview.html
-rw-r--r--      3264 2016-12-08 06:18 function.newt-push-help-line.html
-rw-r--r--      9198 2016-12-08 06:18 outcontrol.configuration.html
-rw-r--r--      2164 2016-12-08 06:18 radius.constants.html
-rw-r--r--      8663 2016-12-08 06:18 pdo.sqlitecreatefunction.html
-rw-r--r--      6431 2016-12-08 06:18 function.cubrid-ping.html
-rw-r--r--      3006 2016-12-08 06:19 iteratoriterator.rewind.html
-rw-r--r--      3343 2016-12-08 06:19 oci-lob.write.html
-rw-r--r--     26110 2016-12-08 06:18 language.variables.scope.html
-rw-r--r--      4668 2016-12-08 06:20 quickhashinthash.getsize.html
-rw-r--r--      2509 2016-12-08 06:20 ui-controls-multilineentry.append.html
-rw-r--r--      3613 2016-12-08 06:19 function.fann-set-rprop-increase-factor.html
-rw-r--r--     10412 2016-12-08 06:20 function.array-slice.html
-rw-r--r--      5919 2016-12-08 06:20 soapserver.getfunctions.html
-rw-r--r--      3477 2016-12-08 06:19 uconverter.toucallback.html
-rw-r--r--      6152 2016-12-08 06:19 swftextfield.construct.html
-rw-r--r--      5352 2016-12-08 06:20 function.strtolower.html
-rw-r--r--      2915 2016-12-08 06:18 wincache.win32build.building.html
-rw-r--r--      3238 2016-12-08 06:19 mysqlnd-ms.loadbalancing.html
-rw-r--r--      1555 2016-12-08 06:18 openal.setup.html
-rw-r--r--      1983 2016-12-08 06:19 function.pdf-add-bookmark.html
-rw-r--r--      2417 2016-12-08 06:20 solrdocument.next.html
-rw-r--r--      8678 2016-12-08 06:18 function.radius-get-vendor-attr.html
-rw-r--r--      2287 2016-12-08 06:19 swfsoundinstance.nomultiple.html
-rw-r--r--      2897 2016-12-08 06:19 intlbreakiterator.preceding.html
-rw-r--r--      4214 2016-12-08 06:19 function.bindtextdomain.html
-rw-r--r--      1876 2016-12-08 06:19 function.imap-header.html
-rw-r--r--      3027 2016-12-08 06:20 internals2.opcodes.sr.html
-rw-r--r--      4211 2016-12-08 06:18 function.apd-set-pprof-trace.html
-rw-r--r--      1704 2016-12-08 06:19 taint.detail.html
-rw-r--r--      4948 2016-12-08 06:20 reflectionextension.getinientries.html
-rw-r--r--      3173 2016-12-08 06:18 function.dbplus-undoprepare.html
-rw-r--r--      1737 2016-12-08 06:20 internals2.streams.html
-rw-r--r--      3189 2016-12-08 06:19 mongocollection.construct.html
-rw-r--r--      4975 2016-12-08 06:19 cairosurface.copypage.html
-rw-r--r--      2489 2016-12-08 06:19 imagick.getimagerenderingintent.html
-rw-r--r--      2364 2016-12-08 06:20 transports.html
-rw-r--r--      2587 2016-12-08 06:19 function.pdf-arcn.html
-rw-r--r--      5258 2016-12-08 06:20 function.is-resource.html
-rw-r--r--      4830 2016-12-08 06:19 ref.sqlsrv.html
-rw-r--r--      9975 2016-12-08 06:20 migration52.parameters.html
-rw-r--r--      2842 2016-12-08 06:19 mysqlnd.persist.html
-rw-r--r--      1367 2016-12-08 06:19 proctitle.resources.html
-rw-r--r--      3283 2016-12-08 06:19 class.swfbitmap.html
-rw-r--r--    182847 2016-12-08 06:19 mysqlnd-ms.plugin-ini-json.html
-rw-r--r--      3865 2016-12-08 06:18 openssl.ciphers.html
-rw-r--r--      3063 2016-12-08 06:19 swftext.setspacing.html
-rw-r--r--      2685 2016-12-08 06:18 function.ifx-nullformat.html
-rw-r--r--      7234 2016-12-08 06:19 arrayobject.construct.html
-rw-r--r--      2437 2016-12-08 06:18 id3v2attachedpictureframe.settype.html
-rw-r--r--      2253 2016-12-08 06:19 function.pdf-moveto.html
-rw-r--r--      4570 2016-12-08 06:20 ds-stack.peek.html
-rw-r--r--      4591 2016-12-08 06:19 mongocollection.getname.html
-rw-r--r--      3378 2016-12-08 06:19 function.trader-cdlconcealbabyswall.html
-rw-r--r--      5396 2016-12-08 06:19 ftp.examples-basic.html
-rw-r--r--      3219 2016-12-08 06:19 function.posix-initgroups.html
-rw-r--r--      1364 2016-12-08 06:19 mysql.requirements.html
-rw-r--r--      3630 2016-12-08 06:19 cairosurface.finish.html
-rw-r--r--      4559 2016-12-08 06:19 harupage.settextmatrix.html
-rw-r--r--      3025 2016-12-08 06:19 function.stats-rand-gen-noncentral-t.html
-rw-r--r--     15565 2016-12-08 06:19 function.imagejpeg.html
-rw-r--r--      1587 2016-12-08 06:20 reflection.setup.html
-rw-r--r--     19031 2016-12-08 06:19 gearman.examples-reverse-task.html
-rw-r--r--      6045 2016-12-08 06:20 ds-map.sum.html
-rw-r--r--      3324 2016-12-08 06:19 function.trader-cdlgravestonedoji.html
-rw-r--r--      3062 2016-12-08 06:20 ui-size.of.html
-rw-r--r--      6712 2016-12-08 06:20 function.array-chunk.html
-rw-r--r--      1805 2016-12-08 06:19 function.msql-tablename.html
-rw-r--r--      5090 2016-12-08 06:19 eventbuffer.appendfrom.html
-rw-r--r--      2938 2016-12-08 06:19 imagick.setimageextent.html
-rw-r--r--      3928 2016-12-08 06:20 sdo-model-reflectiondataobject.export.html
-rw-r--r--     19949 2016-12-08 06:19 function.stream-filter-register.html
-rw-r--r--      4679 2016-12-08 06:18 function.uopz-restore.html
-rw-r--r--      2531 2016-12-08 06:19 swftext.getascent.html
-rw-r--r--      2361 2016-12-08 06:19 imagick.getversion.html
-rw-r--r--      4636 2016-12-08 06:19 intlcalendar.isset.html
-rw-r--r--      5513 2016-12-08 06:20 internals2.opcodes.fe-fetch.html
-rw-r--r--      2606 2016-12-08 06:19 imagick.getimageblob.html
-rw-r--r--      4095 2016-12-08 06:19 function.fann-scale-output-train-data.html
-rw-r--r--      2720 2016-12-08 06:19 swfbutton.setmenu.html
-rw-r--r--      1632 2016-12-08 06:18 intro.opcache.html
-rw-r--r--      3551 2016-12-08 06:18 serializable.serialize.html
-rw-r--r--      6142 2016-12-08 06:19 intlchar.iscntrl.html
-rw-r--r--      6043 2016-12-08 06:19 directoryiterator.getgroup.html
-rw-r--r--      2274 2016-12-08 06:19 function.maxdb-master-query.html
-rw-r--r--      2443 2016-12-08 06:19 enchant.constants.html
-rw-r--r--      1365 2016-12-08 06:20 snmp.configuration.html
-rw-r--r--      3421 2016-12-08 06:20 about.translations.html
-rw-r--r--      3917 2016-12-08 06:19 function.jddayofweek.html
-rw-r--r--      4949 2016-12-08 06:20 ds-vector.unshift.html
-rw-r--r--      5525 2016-12-08 06:20 book.xml.html
-rw-r--r--      5164 2016-12-08 06:19 cairosurface.createsimilar.html
-rw-r--r--      4613 2016-12-08 06:19 function.cairo-ps-surface-dsc-begin-page-setup.html
-rw-r--r--      1540 2016-12-08 06:20 varnish.setup.html
-rw-r--r--     13895 2016-12-08 06:19 class.evperiodic.html
-rw-r--r--      2247 2016-12-08 06:19 imagick.getcopyright.html
-rw-r--r--      1351 2016-12-08 06:20 win32ps.examples.html
-rw-r--r--      9403 2016-12-08 06:19 mysqli.error.html
-rw-r--r--      3244 2016-12-08 06:18 function.dbplus-chdir.html
-rw-r--r--      2661 2016-12-08 06:19 function.trader-medprice.html
-rw-r--r--      2574 2016-12-08 06:19 book.cyrus.html
-rw-r--r--      4220 2016-12-08 06:18 function.sys-get-temp-dir.html
-rw-r--r--      2699 2016-12-08 06:19 intro.xdiff.html
-rw-r--r--     12381 2016-12-08 06:19 function.imap-get-quota.html
-rw-r--r--     10432 2016-12-08 06:19 imagickdraw.setfontfamily.html
-rw-r--r--     16408 2016-12-08 06:19 ref.image.html
-rw-r--r--      3831 2016-12-08 06:19 imagick.identifyimage.html
-rw-r--r--      1275 2016-12-08 06:19 intro.xattr.html
-rw-r--r--      5594 2016-12-08 06:18 class.ktaglib-id3v2-tag.html
-rw-r--r--      9514 2016-12-08 06:19 function.mysql-field-name.html
-rw-r--r--      5018 2016-12-08 06:19 imagick.setimageresolution.html
-rw-r--r--      7891 2016-12-08 06:19 ev.periodic-modes.html
-rw-r--r--      5032 2016-12-08 06:19 collator.getstrength.html
-rw-r--r--      2400 2016-12-08 06:19 swfdisplayitem.getxskew.html
-rw-r--r--      4560 2016-12-08 06:20 ds-stack.copy.html
-rw-r--r--      1325 2016-12-08 06:19 sem.resources.html
-rw-r--r--      4155 2016-12-08 06:19 function.sybase-query.html
-rw-r--r--      1284 2016-12-08 06:20 reflection.constants.html
-rw-r--r--      3602 2016-12-08 06:19 limititerator.valid.html
-rw-r--r--      4234 2016-12-08 06:19 function.stream-is-local.html
-rw-r--r--      3601 2016-12-08 06:18 book.kadm5.html
-rw-r--r--      1339 2016-12-08 06:19 xattr.resources.html
-rw-r--r--      5504 2016-12-08 06:19 directoryiterator.isreadable.html
-rw-r--r--      2374 2016-12-08 06:20 function.wddx-deserialize.html
-rw-r--r--      5719 2016-12-08 06:19 function.pg-version.html
-rw-r--r--      5543 2016-12-08 06:20 function.ssh2-sftp-rmdir.html
-rw-r--r--      4477 2016-12-08 06:19 function.imagecreatefromjpeg.html
-rw-r--r--     19569 2016-12-08 06:19 swfdisplayitem.setratio.html
-rw-r--r--      2355 2016-12-08 06:19 pool.resize.html
-rw-r--r--      4934 2016-12-08 06:19 cairofontoptions.status.html
-rw-r--r--      5820 2016-12-08 06:18 phar.addemptydir.html
-rw-r--r--      2477 2016-12-08 06:20 ui-draw-text-font.construct.html
-rw-r--r--      2812 2016-12-08 06:19 gmagick.commentimage.html
-rw-r--r--      2447 2016-12-08 06:20 function.udm-errno.html
-rw-r--r--      5996 2016-12-08 06:19 function.base-convert.html
-rw-r--r--     18119 2016-12-08 06:19 trader.constants.html
-rw-r--r--     22487 2016-12-08 06:19 function.mktime.html
-rw-r--r--      3740 2016-12-08 06:19 streamwrapper.dir-rewinddir.html
-rw-r--r--      5678 2016-12-08 06:20 function.strnatcasecmp.html
-rw-r--r--      5524 2016-12-08 06:19 function.pg-num-fields.html
-rw-r--r--      2526 2016-12-08 06:19 yaf-loader.import.html
-rw-r--r--      8753 2016-12-08 06:20 ds-set.reduce.html
-rw-r--r--      2871 2016-12-08 06:19 mysqlnd-qc.quickstart.html
-rw-r--r--      1743 2016-12-08 06:18 intro.info.html
-rw-r--r--      6930 2016-12-08 06:20 function.session-cache-expire.html
-rw-r--r--      1935 2016-12-08 06:20 ctype.installation.html
-rw-r--r--      1320 2016-12-08 06:20 ds.requirements.html
-rw-r--r--      7714 2016-12-08 06:19 function.maxdb-get-proto-info.html
-rw-r--r--      5758 2016-12-08 06:18 language.references.return.html
-rw-r--r--      3142 2016-12-08 06:19 swfbutton.setdown.html
-rw-r--r--      1921 2016-12-08 06:19 ref.mysqlnd-uh.html
-rw-r--r--      1989 2016-12-08 06:18 install.pecl.html
-rw-r--r--      3664 2016-12-08 06:18 function.openssl-x509-parse.html
-rw-r--r--      6604 2016-12-08 06:18 function.dbase-get-header-info.html
-rw-r--r--      4996 2016-12-08 06:19 function.fann-set-activation-function-layer.html
-rw-r--r--      4581 2016-12-08 06:20 quickhashstringinthash.savetostring.html
-rw-r--r--      3980 2016-12-08 06:18 function.fbsql-commit.html
-rw-r--r--     13026 2016-12-08 06:18 language.namespaces.basics.html
-rw-r--r--      3706 2016-12-08 06:19 function.log.html
-rw-r--r--      2946 2016-12-08 06:20 function.ssdeep-fuzzy-hash-filename.html
-rw-r--r--      3978 2016-12-08 06:19 tidy.examples.basic.html
-rw-r--r--      2344 2016-12-08 06:19 function.pdf-circle.html
-rw-r--r--     26612 2016-12-08 06:20 book.reflection.html
-rw-r--r--      1316 2016-12-08 06:19 intro.v8js.html
-rw-r--r--      6056 2016-12-08 06:18 function.dbx-error.html
-rw-r--r--      2844 2016-12-08 06:19 function.rewinddir.html
-rw-r--r--      5670 2016-12-08 06:20 function.apache-setenv.html
-rw-r--r--      2473 2016-12-08 06:19 intl.installation.html
-rw-r--r--      3806 2016-12-08 06:19 cairofontoptions.gethintstyle.html
-rw-r--r--      9387 2016-12-08 06:19 datetime.settimezone.html
-rw-r--r--     12978 2016-12-08 06:19 imagick.setoption.html
-rw-r--r--      7804 2016-12-08 06:18 ref.pdo-mysql.connection.html
-rw-r--r--      3725 2016-12-08 06:18 function.ncurses-can-change-color.html
-rw-r--r--      8858 2016-12-08 06:20 function.simplexml-load-string.html
-rw-r--r--      4020 2016-12-08 06:19 yaf-route-simple.route.html
-rw-r--r--      3706 2016-12-08 06:19 swfdisplayitem.moveto.html
-rw-r--r--      2904 2016-12-08 06:19 gearmanworker.construct.html
-rw-r--r--      5389 2016-12-08 06:19 cairofontoptions.setantialias.html
-rw-r--r--      2702 2016-12-08 06:19 yaf-config-ini.offsetexists.html
-rw-r--r--      6248 2016-12-08 06:19 function.link.html
-rw-r--r--     11055 2016-12-08 06:19 messageformatter.setpattern.html
-rw-r--r--      4078 2016-12-08 06:20 class.ui-draw-brush.html
-rw-r--r--      6785 2016-12-08 06:20 class.ui-controls-editablecombo.html
-rw-r--r--      5379 2016-12-08 06:18 function.gzopen.html
-rw-r--r--      5692 2016-12-08 06:18 function.bzdecompress.html
-rw-r--r--      2029 2016-12-08 06:19 ps.installation.html
-rw-r--r--      3114 2016-12-08 06:19 class.cairofontweight.html
-rw-r--r--      8388 2016-12-08 06:19 imagickkernel.getmatrix.html
-rw-r--r--      9740 2016-12-08 06:19 function.iconv-mime-decode-headers.html
-rw-r--r--      5772 2016-12-08 06:20 function.is-array.html
-rw-r--r--      3523 2016-12-08 06:19 function.shm-remove-var.html
-rw-r--r--      9071 2016-12-08 06:20 function.strip-tags.html
-rw-r--r--      2341 2016-12-08 06:20 ui-draw-stroke.setmiterlimit.html
-rw-r--r--     18856 2016-12-08 06:19 class.yaf-controller-abstract.html
-rw-r--r--      9332 2016-12-08 06:18 pharfileinfo.decompress.html
-rw-r--r--      2541 2016-12-08 06:19 imagick.getregistry.html
-rw-r--r--      3736 2016-12-08 06:19 mysqli.dump-debug-info.html
-rw-r--r--      2764 2016-12-08 06:19 gearmantask.datasize.html
-rw-r--r--      2938 2016-12-08 06:19 haruencoder.getwritingmode.html
-rw-r--r--      4378 2016-12-08 06:19 class.mongodb-bson-decimal128.html
-rw-r--r--      2549 2016-12-08 06:20 solrresponse.getrawresponse.html
-rw-r--r--      2186 2016-12-08 06:20 xml.installation.html
-rw-r--r--      2245 2016-12-08 06:19 spl-types.installation.html
-rw-r--r--     22549 2016-12-08 06:20 function.usort.html
-rw-r--r--      3977 2016-12-08 06:20 book.swish.html
-rw-r--r--      8983 2016-12-08 06:19 mysqlnduhpreparedstatement.execute.html
-rw-r--r--      7741 2016-12-08 06:19 imagick.subimagematch.html
-rw-r--r--      4044 2016-12-08 06:18 function.apd-croak.html
-rw-r--r--      3915 2016-12-08 06:20 internals2.opcodes.post-dec-obj.html
-rw-r--r--      1406 2016-12-08 06:20 xmldiff.setup.html
-rw-r--r--      2742 2016-12-08 06:19 gmagickdraw.rotate.html
-rw-r--r--      3974 2016-12-08 06:18 function.ibase-blob-close.html
-rw-r--r--      2478 2016-12-08 06:19 intro.pdf.html
-rw-r--r--     19643 2016-12-08 06:19 eio.constants.html
-rw-r--r--      2423 2016-12-08 06:20 classkit.constants.html
-rw-r--r--      7562 2016-12-08 06:19 datetime.gettimezone.html
-rw-r--r--      8238 2016-12-08 06:19 cairocontext.appendpath.html
-rw-r--r--     10348 2016-12-08 06:19 evperiodic.construct.html
-rw-r--r--      2883 2016-12-08 06:19 hrtime-stopwatch.getelapsedtime.html
-rw-r--r--      5467 2016-12-08 06:20 reflectionparameter.getclass.html
-rw-r--r--      1339 2016-12-08 06:20 internals2.classes.html
-rw-r--r--      1611 2016-12-08 06:19 intro.imap.html
-rw-r--r--      2404 2016-12-08 06:20 ui-controls-group.construct.html
-rw-r--r--      3926 2016-12-08 06:19 tokyotyrant.construct.html
-rw-r--r--      5406 2016-12-08 06:20 swish.getpropertylist.html
-rw-r--r--      3810 2016-12-08 06:19 ref.calendar.html
-rw-r--r--      6442 2016-12-08 06:19 directoryiterator.current.html
-rw-r--r--      5875 2016-12-08 06:19 function.xdiff-file-bdiff.html
-rw-r--r--      5212 2016-12-08 06:19 cairocontext.showtext.html
-rw-r--r--      7576 2016-12-08 06:19 mysqlnduhconnection.getserverversion.html
-rw-r--r--      2380 2016-12-08 06:19 yaf-dispatcher.sleep.html
-rw-r--r--      4000 2016-12-08 06:20 ds-vector.last.html
-rw-r--r--      5466 2016-12-08 06:19 directoryiterator.seek.html
-rw-r--r--      3829 2016-12-08 06:20 reflectionfunction.export.html
-rw-r--r--      3852 2016-12-08 06:18 function.fbsql-clob-size.html
-rw-r--r--      3732 2016-12-08 06:19 function.proc-close.html
-rw-r--r--      2696 2016-12-08 06:19 yaf-request-abstract.getlanguage.html
-rw-r--r--      2652 2016-12-08 06:19 function.fann-destroy-train.html
-rw-r--r--      6027 2016-12-08 06:19 threaded.iswaiting.html
-rw-r--r--      2871 2016-12-08 06:19 function.pg-flush.html
-rw-r--r--      6643 2016-12-08 06:18 function.bzread.html
-rw-r--r--      3272 2016-12-08 06:19 eventhttpconnection.setmaxbodysize.html
-rw-r--r--      4225 2016-12-08 06:19 function.mysqlnd-ms-fabric-select-global.html
-rw-r--r--     11128 2016-12-08 06:19 mysqlnduhconnection.connect.html
-rw-r--r--      6842 2016-12-08 06:20 function.reset.html
-rw-r--r--      6708 2016-12-08 06:18 function.trigger-error.html
-rw-r--r--      2365 2016-12-08 06:20 migration53.sapi.html
-rw-r--r--      1310 2016-12-08 06:20 swish.examples.html
-rw-r--r--      7751 2016-12-08 06:19 function.grapheme-strpos.html
-rw-r--r--      4774 2016-12-08 06:19 imagick.opaquepaintimage.html
-rw-r--r--      6399 2016-12-08 06:18 function.ob-end-flush.html
-rw-r--r--      2400 2016-12-08 06:19 imagick.flattenimages.html
-rw-r--r--      4414 2016-12-08 06:19 evprepare.createstopped.html
-rw-r--r--     18471 2016-12-08 06:20 function.bbcode-set-arg-parser.html
-rw-r--r--      5720 2016-12-08 06:18 function.bcompiler-write-footer.html
-rw-r--r--      4802 2016-12-08 06:20 ds-map.haskey.html
-rw-r--r--      4875 2016-12-08 06:19 arrayiterator.rewind.html
-rw-r--r--      4069 2016-12-08 06:20 internals2.opcodes.post-inc-obj.html
-rw-r--r--      2479 2016-12-08 06:18 function.ibase-db-info.html
-rw-r--r--      9431 2016-12-08 06:19 function.pg-field-size.html
-rw-r--r--      3695 2016-12-08 06:20 xmlreader.setrelaxngschemasource.html
-rw-r--r--      3346 2016-12-08 06:18 function.newt-component-add-callback.html
-rw-r--r--      2206 2016-12-08 06:18 openal.installation.html
-rw-r--r--      2981 2016-12-08 06:18 function.ncurses-termname.html
-rw-r--r--      4255 2016-12-08 06:20 class.ui-draw-text-font-stretch.html
-rw-r--r--     13903 2016-12-08 06:19 imagickpixel.construct.html
-rw-r--r--      2698 2016-12-08 06:19 yaf-request-abstract.getmodulename.html
-rw-r--r--      4102 2016-12-08 06:20 internals2.opcodes.add-array-element.html
-rw-r--r--      7199 2016-12-08 06:19 tokyotyranttable.getquery.html
-rw-r--r--      7725 2016-12-08 06:20 xsltprocessor.registerphpfunctions.html
-rw-r--r--      5994 2016-12-08 06:19 directoryiterator.getctime.html
-rw-r--r--      2648 2016-12-08 06:19 lapack.identity.html
-rw-r--r--      2943 2016-12-08 06:19 judy.count.html
-rw-r--r--      2025 2016-12-08 06:20 migration53.class-constants.html
-rw-r--r--      3050 2016-12-08 06:18 function.ifxus-read-slob.html
-rw-r--r--      4334 2016-12-08 06:19 function.gnupg-geterror.html
-rw-r--r--      2709 2016-12-08 06:20 domnode.hasattributes.html
-rw-r--r--      4096 2016-12-08 06:18 function.xhprof-disable.html
-rw-r--r--      5221 2016-12-08 06:18 function.runkit-class-emancipate.html
-rw-r--r--      4939 2016-12-08 06:20 domentityreference.construct.html
-rw-r--r--      2864 2016-12-08 06:18 function.newt-form-set-timer.html
-rw-r--r--      8297 2016-12-08 06:20 function.ssh2-methods-negotiated.html
-rw-r--r--      7025 2016-12-08 06:18 function.cubrid-load-from-glo.html
-rw-r--r--      5799 2016-12-08 06:19 mongocollection.getwriteconcern.html
-rw-r--r--      5595 2016-12-08 06:20 reflectiongenerator.getexecutingfile.html
-rw-r--r--      2714 2016-12-08 06:19 function.eio-set-min-parallel.html
-rw-r--r--      5252 2016-12-08 06:19 function.mssql-min-error-severity.html
-rw-r--r--     11674 2016-12-08 06:20 class.solrupdateresponse.html
-rw-r--r--     13023 2016-12-08 06:20 changelog.strings.html
-rw-r--r--     13927 2016-12-08 06:19 mysqli.warning-count.html
-rw-r--r--      2732 2016-12-08 06:19 judy.firstempty.html
-rw-r--r--      1358 2016-12-08 06:18 lzf.configuration.html
-rw-r--r--      7863 2016-12-08 06:18 function.set-exception-handler.html
-rw-r--r--     18384 2016-12-08 06:18 language.types.integer.html
-rw-r--r--      1728 2016-12-08 06:19 function.fputs.html
-rw-r--r--     17455 2016-12-08 06:20 sammessage.header.html
-rw-r--r--      4844 2016-12-08 06:19 cairocontext.status.html
-rw-r--r--      4914 2016-12-08 06:20 ds-vector.push.html
-rw-r--r--      2941 2016-12-08 06:20 internals2.opcodes.assign-bw-or.html
-rw-r--r--      2556 2016-12-08 06:18 function.newt-button-bar.html
-rw-r--r--      4708 2016-12-08 06:19 gearmanclient.dolowbackground.html
-rw-r--r--      3567 2016-12-08 06:19 function.fann-set-cascade-weight-multiplier.html
-rw-r--r--      7716 2016-12-08 06:19 sqlite3stmt.bindvalue.html
-rw-r--r--      4212 2016-12-08 06:18 security.apache.html
-rw-r--r--      1474 2016-12-08 06:19 pspell.requirements.html
-rw-r--r--      2688 2016-12-08 06:19 mysqli-stmt.insert-id.html
-rw-r--r--      2851 2016-12-08 06:20 internals2.opcodes.assign-add.html
-rw-r--r--      2446 2016-12-08 06:19 gearmantask.construct.html
-rw-r--r--      3033 2016-12-08 06:19 recursiveiterator.getchildren.html
-rw-r--r--      1349 2016-12-08 06:19 intro.lua.html
-rw-r--r--      4876 2016-12-08 06:19 cairocontext.getdash.html
-rw-r--r--      2661 2016-12-08 06:20 migration5.databases.html
-rw-r--r--      6315 2016-12-08 06:20 reflectionfunctionabstract.hasreturntype.html
-rw-r--r--      4888 2016-12-08 06:19 worker.getstacked.html
-rw-r--r--      2475 2016-12-08 06:19 function.pdf-setgray.html
-rw-r--r--      4191 2016-12-08 06:19 function.imagesetclip.html
-rw-r--r--      2296 2016-12-08 06:19 function.stream-encoding.html
-rw-r--r--      5906 2016-12-08 06:18 ref.pdo-ibm.connection.html
-rw-r--r--      3037 2016-12-08 06:18 apc.installation.html
-rw-r--r--      3485 2016-12-08 06:19 tokyotyrant.restore.html
-rw-r--r--      6998 2016-12-08 06:20 samconnection.connect.html
-rw-r--r--      2898 2016-12-08 06:19 gmagick.removeimageprofile.html
-rw-r--r--      2600 2016-12-08 06:19 judy.bycount.html
-rw-r--r--      3002 2016-12-08 06:20 function.autoload.html
-rw-r--r--      1376 2016-12-08 06:18 openal.configuration.html
-rw-r--r--      1381 2016-12-08 06:20 mnogosearch.resources.html
-rw-r--r--      3461 2016-12-08 06:18 book.hash.html
-rw-r--r--      3849 2016-12-08 06:19 function.px-set-value.html
-rw-r--r--      2769 2016-12-08 06:19 mysqlnd-mux.architecture.html
-rw-r--r--      6696 2016-12-08 06:19 imagick.mergeimagelayers.html
-rw-r--r--      4608 2016-12-08 06:19 function.px-set-parameter.html
-rw-r--r--      5482 2016-12-08 06:20 function.socket-set-block.html
-rw-r--r--      6292 2016-12-08 06:19 cairocontext.setsourcergba.html
-rw-r--r--      3748 2016-12-08 06:19 imagick.getimageregion.html
-rw-r--r--      2563 2016-12-08 06:18 intro.memtrack.html
-rw-r--r--     11159 2016-12-08 06:19 mysqlnduhconnection.close.html
-rw-r--r--      4828 2016-12-08 06:18 function.openssl-pkey-export-to-file.html
-rw-r--r--     11829 2016-12-08 06:18 phardata.decompressfiles.html
-rw-r--r--      2671 2016-12-08 06:19 mysqli.get-warnings.html
-rw-r--r--      5142 2016-12-08 06:19 function.gmp-mul.html
-rw-r--r--      3008 2016-12-08 06:19 class.yaf-exception-loadfailed-module.html
-rw-r--r--      2246 2016-12-08 06:19 yaf-router.construct.html
-rw-r--r--      1535 2016-12-08 06:19 xattr.setup.html
-rw-r--r--     14967 2016-12-08 06:19 function.fread.html
-rw-r--r--      8475 2016-12-08 06:19 locale.getdisplayname.html
-rw-r--r--      4100 2016-12-08 06:19 class.cairocontent.html
-rw-r--r--      3165 2016-12-08 06:18 function.filepro.html
-rw-r--r--      3345 2016-12-08 06:19 function.trader-cdlcounterattack.html
-rw-r--r--      2929 2016-12-08 06:19 imagick.setregistry.html
-rw-r--r--      2239 2016-12-08 06:19 splfileobject.tostring.html
-rw-r--r--      3264 2016-12-08 06:18 function.newt-listbox-select-item.html
-rw-r--r--     15624 2016-12-08 06:18 ingres.configuration.html
-rw-r--r--      3615 2016-12-08 06:19 gmagick.chopimage.html
-rw-r--r--      4413 2016-12-08 06:18 function.cubrid-lob2-size.html
-rw-r--r--      8986 2016-12-08 06:20 function.array-intersect-assoc.html
-rw-r--r--      3311 2016-12-08 06:18 function.ncurses-erase.html
-rw-r--r--      6156 2016-12-08 06:18 class.generator.html
-rw-r--r--      1354 2016-12-08 06:18 hash.requirements.html
-rw-r--r--      3111 2016-12-08 06:20 sdo-model-type.isabstracttype.html
-rw-r--r--      2541 2016-12-08 06:18 function.ibase-errmsg.html
-rw-r--r--      2116 2016-12-08 06:19 swffont.getshape.html
-rw-r--r--      4044 2016-12-08 06:19 syncreaderwriter.writeunlock.html
-rw-r--r--      1778 2016-12-08 06:20 internals2.variables.html
-rw-r--r--      9767 2016-12-08 06:18 function.cubrid-lob2-bind.html
-rw-r--r--      3796 2016-12-08 06:19 function.ldap-rename.html
-rw-r--r--      3693 2016-12-08 06:20 internals2.counter.function.counter-bump-value.html
-rw-r--r--     10582 2016-12-08 06:19 function.maxdb-thread-id.html
-rw-r--r--      3974 2016-12-08 06:20 ds-set.clear.html
-rw-r--r--      4565 2016-12-08 06:18 function.cubrid-list-dbs.html
-rw-r--r--      4383 2016-12-08 06:19 function.ezmlm-hash.html
-rw-r--r--      5932 2016-12-08 06:20 function.get-defined-functions.html
-rw-r--r--      3267 2016-12-08 06:20 reflectionfunctionabstract.getfilename.html
-rw-r--r--      2183 2016-12-08 06:19 imagick.setlastiterator.html
-rw-r--r--      1379 2016-12-08 06:18 csprng.configuration.html
-rw-r--r--      6953 2016-12-08 06:19 function.xdiff-file-diff.html
-rw-r--r--      4897 2016-12-08 06:19 function.cairo-font-options-set-subpixel-order.html
-rw-r--r--      8074 2016-12-08 06:19 function.pg-fetch-row.html
-rw-r--r--      5669 2016-12-08 06:19 book.mssql.html
-rw-r--r--      3178 2016-12-08 06:20 internals2.opcodes.is-smaller-or-equal.html
-rw-r--r--      1582 2016-12-08 06:20 xmlwriter.setup.html
-rw-r--r--      3985 2016-12-08 06:19 swfdisplayitem.skewxto.html
-rw-r--r--      4631 2016-12-08 06:19 ref.libevent.html
-rw-r--r--      4674 2016-12-08 06:19 function.imap-fetchheader.html
-rw-r--r--      4972 2016-12-08 06:19 function.cairo-svg-surface-create.html
-rw-r--r--     13209 2016-12-08 06:19 function.sqlite-array-query.html
-rw-r--r--      2835 2016-12-08 06:19 imagick.setimagecompression.html
-rw-r--r--      6842 2016-12-08 06:20 function.compact.html
-rw-r--r--      2628 2016-12-08 06:20 solrquery.getmltmaxwordlength.html
-rw-r--r--      6810 2016-12-08 06:19 function.rename.html
-rw-r--r--      6039 2016-12-08 06:19 msql.examples-basic.html
-rw-r--r--      2056 2016-12-08 06:20 solrquery.getexpand.html
-rw-r--r--      1353 2016-12-08 06:19 gettext.resources.html
-rw-r--r--      2879 2016-12-08 06:19 evstat.set.html
-rw-r--r--      2843 2016-12-08 06:19 event.persistence.html
-rw-r--r--      4022 2016-12-08 06:19 splfileinfo.getpathname.html
-rw-r--r--      4558 2016-12-08 06:19 memcache.getstats.html
-rw-r--r--      1671 2016-12-08 06:20 extensions.html
-rw-r--r--      2998 2016-12-08 06:19 function.imagefilltoborder.html
-rw-r--r--      2024 2016-12-08 06:19 function.date-create-from-format.html
-rw-r--r--      6772 2016-12-08 06:18 odbc.installation.html
-rw-r--r--      4780 2016-12-08 06:20 ds-deque.allocate.html
-rw-r--r--      1605 2016-12-08 06:19 filesystem.setup.html
-rw-r--r--     19384 2016-12-08 06:19 mysqli-stmt.bind-param.html
-rw-r--r--      3584 2016-12-08 06:19 appenditerator.next.html
-rw-r--r--      8372 2016-12-08 06:18 ziparchive.getexternalattributesindex.html
-rw-r--r--      2150 2016-12-08 06:20 ui-area.redraw.html
-rw-r--r--      2637 2016-12-08 06:19 oci-collection.free.html
-rw-r--r--     11448 2016-12-08 06:20 filters.encryption.html
-rw-r--r--      2568 2016-12-08 06:19 judy.offsetexists.html
-rw-r--r--     15180 2016-12-08 06:18 ncurses.keyconsts.html
-rw-r--r--      4633 2016-12-08 06:19 function.fdf-get-value.html
-rw-r--r--      2467 2016-12-08 06:20 zmqsocket.ispersistent.html
-rw-r--r--      2793 2016-12-08 06:19 uconverter.setdestinationencoding.html
-rw-r--r--      4700 2016-12-08 06:19 mongodate.todatetime.html
-rw-r--r--     11325 2016-12-08 06:19 function.sqlsrv-fetch.html
-rw-r--r--      2687 2016-12-08 06:20 ref.win32service.html
-rw-r--r--      4141 2016-12-08 06:19 tokyotyrant.num.html
-rw-r--r--      4529 2016-12-08 06:19 lapack.pseudoinverse.html
-rw-r--r--      8238 2016-12-08 06:20 quickhashintset.exists.html
-rw-r--r--      4735 2016-12-08 06:19 function.cairo-ps-surface-set-eps.html
-rw-r--r--      2084 2016-12-08 06:18 intro.fbsql.html
-rw-r--r--     13531 2016-12-08 06:20 function.svn-diff.html
-rw-r--r--      1231 2016-12-08 06:20 wddx.constants.html
-rw-r--r--      2828 2016-12-08 06:18 apd.installation.html
-rw-r--r--      5896 2016-12-08 06:19 function.msg-stat-queue.html
-rw-r--r--      3709 2016-12-08 06:20 sdodasrel.limitations.html
-rw-r--r--     12900 2016-12-08 06:20 function.levenshtein.html
-rw-r--r--      1372 2016-12-08 06:19 cairo.configuration.html
-rw-r--r--      6299 2016-12-08 06:19 intlchar.istitle.html
-rw-r--r--     10240 2016-12-08 06:19 set.mongodb.html
-rw-r--r--      2767 2016-12-08 06:19 swffontchar.addutf8chars.html
-rw-r--r--      2835 2016-12-08 06:20 internals2.counter.counter-class.resetvalue.html
-rw-r--r--      2635 2016-12-08 06:19 gearmanclient.removeoptions.html
-rw-r--r--      6025 2016-12-08 06:19 function.stream-set-write-buffer.html
-rw-r--r--      2850 2016-12-08 06:19 eventdnsbase.addnameserverip.html
-rw-r--r--      2952 2016-12-08 06:19 imagick.setimageattribute.html
-rw-r--r--      6302 2016-12-08 06:20 class.ui-exception-runtimeexception.html
-rw-r--r--      1913 2016-12-08 06:19 intro.spl.html
-rw-r--r--      3219 2016-12-08 06:20 internals2.opcodes.nop.html
-rw-r--r--      6973 2016-12-08 06:19 function.chgrp.html
-rw-r--r--      6779 2016-12-08 06:19 mongo.getpoolsize.html
-rw-r--r--      5960 2016-12-08 06:19 book.fdf.html
-rw-r--r--     10086 2016-12-08 06:18 context.socket.html
-rw-r--r--      3443 2016-12-08 06:18 function.apd-dump-persistent-resources.html
-rw-r--r--      7067 2016-12-08 06:19 memcache.increment.html
-rw-r--r--      1867 2016-12-08 06:19 gmp.requirements.html
-rw-r--r--      1510 2016-12-08 06:19 ftp.setup.html
-rw-r--r--      5679 2016-12-08 06:19 messageformatter.getlocale.html
-rw-r--r--      9837 2016-12-08 06:18 rararchive.getentry.html
-rw-r--r--      4941 2016-12-08 06:19 function.ps-add-bookmark.html
-rw-r--r--      4722 2016-12-08 06:20 function.setrawcookie.html
-rw-r--r--      5560 2016-12-08 06:19 imagick.sharpenimage.html
-rw-r--r--      1760 2016-12-08 06:18 xhprof.requirements.html
-rw-r--r--      2086 2016-12-08 06:20 ref.wddx.html
-rw-r--r--      4537 2016-12-08 06:20 ds-queue.construct.html
-rw-r--r--      1469 2016-12-08 06:20 intro.fpm.html
-rw-r--r--      2176 2016-12-08 06:19 book.proctitle.html
-rw-r--r--      2765 2016-12-08 06:20 solrquery.settermsmaxcount.html
-rw-r--r--      5067 2016-12-08 06:20 ds.examples.html
-rw-r--r--      5557 2016-12-08 06:18 language.constants.html
-rw-r--r--      3057 2016-12-08 06:18 function.ncurses-whline.html
-rw-r--r--      2929 2016-12-08 06:20 solrquery.sethighlight.html
-rw-r--r--      2571 2016-12-08 06:20 xml.error-codes.html
-rw-r--r--      4532 2016-12-08 06:19 splobjectstorage.serialize.html
-rw-r--r--      1495 2016-12-08 06:19 intro.fann.html
-rw-r--r--      7933 2016-12-08 06:18 function.xhprof-enable.html
-rw-r--r--      8695 2016-12-08 06:19 mongodb-driver-writeresult.getinsertedcount.html
-rw-r--r--      3284 2016-12-08 06:18 function.m-setssl-files.html
-rw-r--r--     11141 2016-12-08 06:19 function.maxdb-stmt-num-rows.html
-rw-r--r--     20843 2016-12-08 06:20 sdo.sample.getset.html
-rw-r--r--      1313 2016-12-08 06:20 funchand.constants.html
-rw-r--r--      8032 2016-12-08 06:20 function.print.html
-rw-r--r--      2504 2016-12-08 06:19 splfixedarray.valid.html
-rw-r--r--      2702 2016-12-08 06:19 yaf-request-abstract.getrequesturi.html
-rw-r--r--      6944 2016-12-08 06:18 function.random-bytes.html
-rw-r--r--      5404 2016-12-08 06:19 memcached.addbykey.html
-rw-r--r--      4286 2016-12-08 06:18 function.uopz-backup.html
-rw-r--r--      5983 2016-12-08 06:19 function.gmp-clrbit.html
-rw-r--r--     16116 2016-12-08 06:20 function.socket-recv.html
-rw-r--r--      2938 2016-12-08 06:20 internals2.opcodes.assign-bw-xor.html
-rw-r--r--      1827 2016-12-08 06:20 function.doubleval.html
-rw-r--r--      3934 2016-12-08 06:19 evidle.construct.html
-rw-r--r--      4938 2016-12-08 06:20 internals2.opcodes.fetch-dim-rw.html
-rw-r--r--      1771 2016-12-08 06:19 function.msql.html
-rw-r--r--      3042 2016-12-08 06:20 function.libxml-get-last-error.html
-rw-r--r--      2608 2016-12-08 06:20 ui-draw-pen.write.html
-rw-r--r--      8659 2016-12-08 06:18 install.pecl.windows.html
-rw-r--r--      6163 2016-12-08 06:19 yaf-response-abstract.setbody.html
-rw-r--r--      2842 2016-12-08 06:18 function.ncurses-wrefresh.html
-rw-r--r--      9497 2016-12-08 06:20 function.substr-count.html
-rw-r--r--      5324 2016-12-08 06:20 function.xmlwriter-start-document.html
-rw-r--r--      2475 2016-12-08 06:19 function.trader-log10.html
-rw-r--r--      5071 2016-12-08 06:19 function.ldap-get-attributes.html
-rw-r--r--      9915 2016-12-08 06:18 book.openssl.html
-rw-r--r--      5740 2016-12-08 06:19 function.jdtojewish.html
-rw-r--r--      7321 2016-12-08 06:18 apciterator.construct.html
-rw-r--r--      2689 2016-12-08 06:19 function.vpopmail-alias-del.html
-rw-r--r--      4900 2016-12-08 06:18 function.newt-button.html
-rw-r--r--      3992 2016-12-08 06:19 imagick.getimagechanneldistortion.html
-rw-r--r--      1999 2016-12-08 06:20 book.tcpwrap.html
-rw-r--r--      4553 2016-12-08 06:20 function.variant-pow.html
-rw-r--r--      4100 2016-12-08 06:19 evloop.construct.html
-rw-r--r--      2554 2016-12-08 06:19 imagick.getimagegreenprimary.html
-rw-r--r--      8218 2016-12-08 06:19 mysqli.get-proto-info.html
-rw-r--r--      6304 2016-12-08 06:20 function.socket-connect.html
-rw-r--r--      6492 2016-12-08 06:19 function.pg-affected-rows.html
-rw-r--r--      3907 2016-12-08 06:20 ds-vector.reverse.html
-rw-r--r--      1665 2016-12-08 06:20 svm.installation.html
-rw-r--r--      5268 2016-12-08 06:19 function.gmp-invert.html
-rw-r--r--      5704 2016-12-08 06:20 function.preg-grep.html
-rw-r--r--      8523 2016-12-08 06:19 function.px-timestamp2string.html
-rw-r--r--      3581 2016-12-08 06:18 ref.pdo-sqlite.html
-rw-r--r--      2248 2016-12-08 06:19 mongocursor.reset.html
-rw-r--r--      3604 2016-12-08 06:18 function.openal-context-suspend.html
-rw-r--r--      3118 2016-12-08 06:18 function.m-responsekeys.html
-rw-r--r--      5644 2016-12-08 06:19 function.fdf-save-string.html
-rw-r--r--      1533 2016-12-08 06:18 blenc.setup.html
-rw-r--r--     19799 2016-12-08 06:19 class.datetime.html
-rw-r--r--      5304 2016-12-08 06:20 quickhashintset.savetofile.html
-rw-r--r--      1400 2016-12-08 06:19 spl-types.configuration.html
-rw-r--r--      4501 2016-12-08 06:19 function.fann-init-weights.html
-rw-r--r--     10998 2016-12-08 06:19 intlcalendar.equals.html
-rw-r--r--      7949 2016-12-08 06:19 intlchar.digit.html
-rw-r--r--      3977 2016-12-08 06:19 function.msql-db-query.html
-rw-r--r--      3414 2016-12-08 06:19 function.fann-get-sarprop-step-error-shift.html
-rw-r--r--      7265 2016-12-08 06:19 ref.oci8.html
-rw-r--r--      2384 2016-12-08 06:19 function.ldap-first-reference.html
-rw-r--r--     15658 2016-12-08 06:19 function.oci-new-connect.html
-rw-r--r--      5008 2016-12-08 06:19 memcached.deletemultibykey.html
-rw-r--r--      3196 2016-12-08 06:19 yaf-controller-abstract.construct.html
-rw-r--r--      3607 2016-12-08 06:19 mongodb-driver-server.ishidden.html
-rw-r--r--      1853 2016-12-08 06:18 control-structures.intro.html
-rw-r--r--      7445 2016-12-08 06:20 function.xml-set-unparsed-entity-decl-handler.html
-rw-r--r--      4181 2016-12-08 06:20 zookeeper.connect.html
-rw-r--r--      1358 2016-12-08 06:19 gmp.configuration.html
-rw-r--r--      1386 2016-12-08 06:18 filepro.configuration.html
-rw-r--r--      4994 2016-12-08 06:19 cairofontoptions.getantialias.html
-rw-r--r--      5804 2016-12-08 06:19 function.gmp-testbit.html
-rw-r--r--      1392 2016-12-08 06:18 bzip2.resources.html
-rw-r--r--      2368 2016-12-08 06:19 function.ldap-next-reference.html
-rw-r--r--      5919 2016-12-08 06:19 mongodb.repair.html
-rw-r--r--      4569 2016-12-08 06:20 quickhashintset.getsize.html
-rw-r--r--      9656 2016-12-08 06:20 domimplementation.hasfeature.html
-rw-r--r--      3273 2016-12-08 06:18 function.bzflush.html
-rw-r--r--      3259 2016-12-08 06:19 harupage.circle.html
-rw-r--r--      9707 2016-12-08 06:19 mysqli.ping.html
-rw-r--r--      2875 2016-12-08 06:19 hrtime-stopwatch.getlastelapsedtime.html
-rw-r--r--      3815 2016-12-08 06:19 sqlite3.exec.html
-rw-r--r--      5300 2016-12-08 06:20 function.session-id.html
-rw-r--r--      3557 2016-12-08 06:19 function.oci-lob-copy.html
-rw-r--r--      1662 2016-12-08 06:19 mysqlnd-ms.setup.html
-rw-r--r--      4803 2016-12-08 06:18 function.bzopen.html
-rw-r--r--      1513 2016-12-08 06:19 ref.proctitle.html
-rw-r--r--     21996 2016-12-08 06:18 function.include.html
-rw-r--r--      3216 2016-12-08 06:20 function.xml-error-string.html
-rw-r--r--      2701 2016-12-08 06:20 solrobject.offsetget.html
-rw-r--r--     11615 2016-12-08 06:20 function.count.html
-rw-r--r--      2328 2016-12-08 06:20 function.fastcgi-finish-request.html
-rw-r--r--      8604 2016-12-08 06:19 function.define.html
-rw-r--r--      3282 2016-12-08 06:20 migration70.removed-exts-sapis.html
-rw-r--r--     16384 2016-12-08 06:19 book.oci8.html
-rw-r--r--      2344 2016-12-08 06:20 ui-controls-radio.append.html
-rw-r--r--      4612 2016-12-08 06:19 function.cairo-scaled-font-get-font-face.html
-rw-r--r--     17378 2016-12-08 06:19 ref.sqlite.html
-rw-r--r--      2821 2016-12-08 06:19 function.pcntl-wifexited.html
-rw-r--r--      5337 2016-12-08 06:19 function.posix-setegid.html
-rw-r--r--      3314 2016-12-08 06:18 function.dbplus-unselect.html
-rw-r--r--      4180 2016-12-08 06:20 function.xml-parser-create-ns.html
-rw-r--r--      6710 2016-12-08 06:20 ds-map.map.html
-rw-r--r--      6321 2016-12-08 06:19 function.fann-train-on-data.html
-rw-r--r--      2838 2016-12-08 06:20 function.svn-fs-is-dir.html
-rw-r--r--      2991 2016-12-08 06:19 gmagick.readimagefile.html
-rw-r--r--      5983 2016-12-08 06:19 book.math.html
-rw-r--r--      4236 2016-12-08 06:18 function.newt-open-window.html
-rw-r--r--     12813 2016-12-08 06:19 function.mysql-fetch-assoc.html
-rw-r--r--      3261 2016-12-08 06:18 function.ncurses-clear.html
-rw-r--r--      2607 2016-12-08 06:20 ui-menu.appendquit.html
-rw-r--r--      2745 2016-12-08 06:19 function.trader-rocr100.html
-rw-r--r--     10969 2016-12-08 06:19 function.pg-fetch-object.html
-rw-r--r--      3479 2016-12-08 06:20 sdo-model-type.isinstance.html
-rw-r--r--      3350 2016-12-08 06:19 function.trader-cdlxsidegap3methods.html
-rw-r--r--      1340 2016-12-08 06:20 internals2.apiref.html
-rw-r--r--      3830 2016-12-08 06:19 function.acosh.html
-rw-r--r--      5374 2016-12-08 06:19 eventbufferevent.getinput.html
-rw-r--r--      5312 2016-12-08 06:18 function.crack-check.html
-rw-r--r--      1799 2016-12-08 06:19 ev.installation.html
-rw-r--r--      7565 2016-12-08 06:19 function.pg-lo-export.html
-rw-r--r--      6750 2016-12-08 06:19 imagick.getpixeliterator.html
-rw-r--r--      3709 2016-12-08 06:19 mysqli-stmt.attr-get.html
-rw-r--r--      2773 2016-12-08 06:20 solrdocument.getinputdocument.html
-rw-r--r--      5612 2016-12-08 06:18 function.fbsql-field-name.html
-rw-r--r--      2782 2016-12-08 06:18 function.mcrypt-enc-self-test.html
-rw-r--r--      3722 2016-12-08 06:20 internals2.opcodes.send-ref.html
-rw-r--r--      9518 2016-12-08 06:20 function.number-format.html
-rw-r--r--      8332 2016-12-08 06:19 imagick.setimagetickspersecond.html
-rw-r--r--      3525 2016-12-08 06:19 hwapi.insertcollection.html
-rw-r--r--      3242 2016-12-08 06:20 reflectionproperty.getdeclaringclass.html
-rw-r--r--      3455 2016-12-08 06:19 ref.mailparse.html
-rw-r--r--      2548 2016-12-08 06:19 emptyiterator.rewind.html
-rw-r--r--      3183 2016-12-08 06:20 about.generate.html
-rw-r--r--      2768 2016-12-08 06:20 solrquery.settermsmincount.html
-rw-r--r--      1339 2016-12-08 06:19 shmop.resources.html
-rw-r--r--      2938 2016-12-08 06:19 eventbufferevent.sslgetciphername.html
-rw-r--r--      2592 2016-12-08 06:19 spldoublylinkedlist.valid.html
-rw-r--r--      5901 2016-12-08 06:19 directoryiterator.getmtime.html
-rw-r--r--      2501 2016-12-08 06:19 yaf-dispatcher.getinstance.html
-rw-r--r--      3233 2016-12-08 06:19 gmagick.setimageredprimary.html
-rw-r--r--      7745 2016-12-08 06:19 streamwrapper.stream-metadata.html
-rw-r--r--      3409 2016-12-08 06:19 recursiveiteratoriterator.getmaxdepth.html
-rw-r--r--     14947 2016-12-08 06:18 book.newt.html
-rw-r--r--      2901 2016-12-08 06:19 function.vpopmail-auth-user.html
-rw-r--r--      5334 2016-12-08 06:19 function.mb-strrchr.html
-rw-r--r--      2578 2016-12-08 06:19 yaf-session.get.html
-rw-r--r--      8160 2016-12-08 06:19 book.tokyo-tyrant.html
-rw-r--r--      4134 2016-12-08 06:19 function.dio-close.html
-rw-r--r--      4976 2016-12-08 06:19 ref.curl.html
-rw-r--r--      3972 2016-12-08 06:20 reflectionobject.export.html
-rw-r--r--      3206 2016-12-08 06:18 function.m-getheader.html
-rw-r--r--      5608 2016-12-08 06:19 yaf-application.execute.html
-rw-r--r--      4897 2016-12-08 06:19 evchild.createstopped.html
-rw-r--r--      3947 2016-12-08 06:18 ref.pdo-firebird.connection.html
-rw-r--r--      2843 2016-12-08 06:18 function.radius-request-authenticator.html
-rw-r--r--      2771 2016-12-08 06:19 imagick.setimagefilename.html
-rw-r--r--      2982 2016-12-08 06:19 eventbase.priorityinit.html
-rw-r--r--      1851 2016-12-08 06:19 exif.installation.html
-rw-r--r--      7939 2016-12-08 06:19 recursivearrayiterator.getchildren.html
-rw-r--r--      2613 2016-12-08 06:19 gender-gender.construct.html
-rw-r--r--     12371 2016-12-08 06:20 yar.examples.html
-rw-r--r--      3296 2016-12-08 06:19 function.stats-cdf-logistic.html
-rw-r--r--      3608 2016-12-08 06:20 internals2.opcodes.is-equal.html
-rw-r--r--      3867 2016-12-08 06:20 sdo-das-xml.addtypes.html
-rw-r--r--      4369 2016-12-08 06:19 function.imap-gc.html
-rw-r--r--      3986 2016-12-08 06:20 oauth.setnonce.html
-rw-r--r--      4929 2016-12-08 06:19 mysqlnd-ms.transaction.html
-rw-r--r--      2577 2016-12-08 06:19 imagick.getimagepage.html
-rw-r--r--      3167 2016-12-08 06:20 soapclient.setcookie.html
-rw-r--r--      6701 2016-12-08 06:18 function.php-ini-scanned-files.html
-rw-r--r--      9141 2016-12-08 06:19 function.sqlsrv-send-stream-data.html
-rw-r--r--      2497 2016-12-08 06:19 function.pdf-setgray-stroke.html
-rw-r--r--      3132 2016-12-08 06:18 function.kadm5-destroy.html
-rw-r--r--      5318 2016-12-08 06:18 book.rar.html
-rw-r--r--      5403 2016-12-08 06:20 apache.configuration.html
-rw-r--r--      4072 2016-12-08 06:19 gmagick.raiseimage.html
-rw-r--r--      2322 2016-12-08 06:20 ui-controls-colorbutton.onchange.html
-rw-r--r--      2147 2016-12-08 06:18 function.lzf-optimized-for.html
-rw-r--r--      3135 2016-12-08 06:19 imagick.getimagepixelcolor.html
-rw-r--r--      3234 2016-12-08 06:19 evchild.set.html
-rw-r--r--      5442 2016-12-08 06:19 cairocontext.setfontoptions.html
-rw-r--r--      3259 2016-12-08 06:19 function.trader-cdlhikkake.html
-rw-r--r--      6759 2016-12-08 06:19 memcached.fetch.html
-rw-r--r--      2776 2016-12-08 06:20 ui-window.construct.html
-rw-r--r--      8955 2016-12-08 06:18 pdo.pgsqllobcreate.html
-rw-r--r--      2446 2016-12-08 06:19 judy.free.html
-rw-r--r--      1195 2016-12-08 06:19 intro.sybase.html
-rw-r--r--      5603 2016-12-08 06:20 ref.sockets.html
-rw-r--r--      1803 2016-12-08 06:20 migration54.removed-extensions.html
-rw-r--r--      5493 2016-12-08 06:19 function.ingres-pconnect.html
-rw-r--r--      3931 2016-12-08 06:19 function.xdiff-string-bpatch.html
-rw-r--r--      5735 2016-12-08 06:19 splfileinfo.getfilename.html
-rw-r--r--      5258 2016-12-08 06:19 oci8.datatypes.html
-rw-r--r--      9074 2016-12-08 06:19 function.curl-multi-add-handle.html
-rw-r--r--      5956 2016-12-08 06:19 intlchar.isidignorable.html
-rw-r--r--      3282 2016-12-08 06:19 function.pdf-add-weblink.html
-rw-r--r--      2692 2016-12-08 06:19 intlbreakiterator.gettext.html
-rw-r--r--      5835 2016-12-08 06:19 function.mb-encoding-aliases.html
-rw-r--r--      2567 2016-12-08 06:19 evsignal.set.html
-rw-r--r--      3627 2016-12-08 06:20 regexp.reference.delimiters.html
-rw-r--r--      3893 2016-12-08 06:20 function.session-decode.html
-rw-r--r--      3284 2016-12-08 06:19 net-gopher.constants.html
-rw-r--r--      5852 2016-12-08 06:19 function.mongodb.bson-fromphp.html
-rw-r--r--      9237 2016-12-08 06:19 function.imap-delete.html
-rw-r--r--      3040 2016-12-08 06:19 imagick.setimageredprimary.html
-rw-r--r--      2864 2016-12-08 06:19 gmagickpixel.setcolor.html
-rw-r--r--      2699 2016-12-08 06:18 function.ifx-num-fields.html
-rw-r--r--      8865 2016-12-08 06:20 function.preg-replace-callback-array.html
-rw-r--r--      1388 2016-12-08 06:19 tokyo-tyrant.resources.html
-rw-r--r--      2652 2016-12-08 06:20 solrdocument.unserialize.html
-rw-r--r--      3369 2016-12-08 06:18 function.newt-entry.html
-rw-r--r--      4479 2016-12-08 06:19 function.fdf-set-submit-form-action.html
-rw-r--r--      7841 2016-12-08 06:19 function.mysql-list-processes.html
-rw-r--r--      3055 2016-12-08 06:19 intltimezone.fromdatetimezone.html
-rw-r--r--      2573 2016-12-08 06:18 oop5.intro.html
-rw-r--r--     20870 2016-12-08 06:20 com.constants.html
-rw-r--r--      2589 2016-12-08 06:18 function.odbc-close-all.html
-rw-r--r--      8155 2016-12-08 06:18 features.dtrace.systemtap.html
-rw-r--r--      2951 2016-12-08 06:19 intlbreakiterator.createcodepointinstance.html
-rw-r--r--      3376 2016-12-08 06:18 mpegfile.construct.html
-rw-r--r--      7716 2016-12-08 06:20 zookeeper.addauth.html
-rw-r--r--      4493 2016-12-08 06:19 function.cairo-pattern-get-surface.html
-rw-r--r--      6781 2016-12-08 06:20 function.classkit-import.html
-rw-r--r--     10453 2016-12-08 06:19 class.multipleiterator.html
-rw-r--r--      1361 2016-12-08 06:19 vpopmail.requirements.html
-rw-r--r--      6250 2016-12-08 06:19 function.fann-train-on-file.html
-rw-r--r--      8752 2016-12-08 06:18 function.assert-options.html
-rw-r--r--      3402 2016-12-08 06:19 function.posix-getuid.html
-rw-r--r--      6605 2016-12-08 06:20 swishresult.stem.html
-rw-r--r--      4339 2016-12-08 06:20 ds-sequence.reversed.html
-rw-r--r--      5654 2016-12-08 06:19 class.mongodb-driver-cursor.html
-rw-r--r--      6506 2016-12-08 06:20 solrdocument.toarray.html
-rw-r--r--      2432 2016-12-08 06:19 event.flags.html
-rw-r--r--      3161 2016-12-08 06:19 function.ps-save.html
-rw-r--r--      3468 2016-12-08 06:19 function.asin.html
-rw-r--r--      7960 2016-12-08 06:20 function.nl2br.html
-rw-r--r--     33998 2016-12-08 06:19 mysqlnd-ms.quickstart.gtid.html
-rw-r--r--      3702 2016-12-08 06:20 function.win32-start-service.html
-rw-r--r--      3745 2016-12-08 06:19 function.maxdb-init.html
-rw-r--r--      6275 2016-12-08 06:18 function.wincache-ucache-cas.html
-rw-r--r--     14038 2016-12-08 06:20 internals2.funcs.html
-rw-r--r--      4209 2016-12-08 06:19 imagick.liquidrescaleimage.html
-rw-r--r--      5105 2016-12-08 06:20 solrclient.optimize.html
-rw-r--r--      2269 2016-12-08 06:19 function.pdf-setlinejoin.html
-rw-r--r--      4170 2016-12-08 06:19 mysqli-stmt.reset.html
-rw-r--r--      8636 2016-12-08 06:19 yaf-plugin-abstract.routershutdown.html
-rw-r--r--      1368 2016-12-08 06:19 mailparse.requirements.html
-rw-r--r--     10840 2016-12-08 06:19 function.sqlsrv-get-field.html
-rw-r--r--      1840 2016-12-08 06:19 function.set-file-buffer.html
-rw-r--r--     20545 2016-12-08 06:20 sockets.examples.html
-rw-r--r--      3053 2016-12-08 06:19 haruannotation.setopened.html
-rw-r--r--      3136 2016-12-08 06:18 function.openal-buffer-destroy.html
-rw-r--r--      3315 2016-12-08 06:19 function.fann-get-mse.html
-rw-r--r--      2025 2016-12-08 06:19 function.date-get-last-errors.html
-rw-r--r--      6894 2016-12-08 06:18 language.operators.comparison.html
-rw-r--r--      2894 2016-12-08 06:19 uconverter.convert.html
-rw-r--r--      6444 2016-12-08 06:19 intlcalendar.gettime.html
-rw-r--r--      2858 2016-12-08 06:19 swffill.rotateto.html
-rw-r--r--      4577 2016-12-08 06:18 function.cubrid-lob2-size64.html
-rw-r--r--      3907 2016-12-08 06:18 function.dbplus-rchperm.html
-rw-r--r--     10310 2016-12-08 06:19 function.imap-fetch-overview.html
-rw-r--r--      3890 2016-12-08 06:19 function.fann-get-cascade-num-candidate-groups.html
-rw-r--r--      7284 2016-12-08 06:19 intldateformatter.getcalendarobject.html
-rw-r--r--      6034 2016-12-08 06:19 function.mb-eregi-replace.html
-rw-r--r--      2877 2016-12-08 06:18 function.ncurses-delay-output.html
-rw-r--r--      2464 2016-12-08 06:20 solrquery.getterms.html
-rw-r--r--    102095 2016-12-08 06:20 class.solrquery.html
-rw-r--r--      7511 2016-12-08 06:19 function.pg-result-status.html
-rw-r--r--     18201 2016-12-08 06:20 filter.constants.html
-rw-r--r--      2713 2016-12-08 06:19 function.pdf-get-pdi-value.html
-rw-r--r--      1550 2016-12-08 06:19 sqlite.setup.html
-rw-r--r--     11081 2016-12-08 06:20 sam.installation.html
-rw-r--r--      2515 2016-12-08 06:19 function.trader-ht-trendline.html
-rw-r--r--      4045 2016-12-08 06:19 function.sybase-close.html
-rw-r--r--     15409 2016-12-08 06:20 class.sessionhandlerinterface.html
-rw-r--r--      4786 2016-12-08 06:19 function.cairo-font-options-equal.html
-rw-r--r--      2652 2016-12-08 06:20 solrquery.getfacetprefix.html
-rw-r--r--      1817 2016-12-08 06:19 timezones.australia.html
-rw-r--r--      4532 2016-12-08 06:19 function.cairo-scaled-font-get-ctm.html
-rw-r--r--      7628 2016-12-08 06:19 mongocommandcursor.timeout.html
-rw-r--r--      1429 2016-12-08 06:20 intro.stomp.html
-rw-r--r--      6389 2016-12-08 06:19 function.imagecrop.html
-rw-r--r--     20880 2016-12-08 06:19 mysqli.construct.html
-rw-r--r--      2820 2016-12-08 06:20 solrquery.getfacetdatehardend.html
-rw-r--r--      3978 2016-12-08 06:20 ds-deque.first.html
-rw-r--r--      4679 2016-12-08 06:19 worker.stack.html
-rw-r--r--      2353 2016-12-08 06:20 ui-controls-button.settext.html
-rw-r--r--      1360 2016-12-08 06:19 mbstring.resources.html
-rw-r--r--      7467 2016-12-08 06:20 book.session.html
-rw-r--r--      2849 2016-12-08 06:20 solrinputdocument.getfieldboost.html
-rw-r--r--      2487 2016-12-08 06:18 function.odbc-field-num.html
-rw-r--r--      7794 2016-12-08 06:19 function.fseek.html
-rw-r--r--     27226 2016-12-08 06:19 eventbufferevent.connect.html
-rw-r--r--      7260 2016-12-08 06:20 stomp.getsessionid.html
-rw-r--r--      1365 2016-12-08 06:19 eio.resources.html
-rw-r--r--     11197 2016-12-08 06:18 function.phpinfo.html
-rw-r--r--      5443 2016-12-08 06:19 function.curl-close.html
-rw-r--r--      7089 2016-12-08 06:20 function.is-float.html
-rw-r--r--     14581 2016-12-08 06:19 function.ldap-control-paged-result.html
-rw-r--r--      5298 2016-12-08 06:19 cairocontext.setlinewidth.html
-rw-r--r--      4252 2016-12-08 06:19 cairosurface.setdeviceoffset.html
-rw-r--r--      3074 2016-12-08 06:19 intltimezone.getequivalentid.html
-rw-r--r--      6877 2016-12-08 06:20 domdocument.loadhtmlfile.html
-rw-r--r--      4646 2016-12-08 06:19 function.is-nan.html
-rw-r--r--     25571 2016-12-08 06:20 extensions.alphabetical.html
-rw-r--r--     16651 2016-12-08 06:18 pdo-4d.examples.html
-rw-r--r--      4677 2016-12-08 06:20 internals2.opcodes.jmpznz.html
-rw-r--r--      3345 2016-12-08 06:19 imagick.getimagelength.html
-rw-r--r--      8009 2016-12-08 06:19 mongodb-driver-command.construct.html
-rw-r--r--      6049 2016-12-08 06:19 class.gearmanexception.html
-rw-r--r--      1919 2016-12-08 06:20 intro.svn.html
-rw-r--r--      3036 2016-12-08 06:19 haru.builtin.fonts.html
-rw-r--r--      8688 2016-12-08 06:19 transliterator.transliterate.html
-rw-r--r--      1510 2016-12-08 06:19 yaf.setup.html
-rw-r--r--      2803 2016-12-08 06:18 ibase.installation.html
-rw-r--r--      2576 2016-12-08 06:19 sqlite3.lasterrorcode.html
-rw-r--r--     12645 2016-12-08 06:20 function.snmp3-set.html
-rw-r--r--      6498 2016-12-08 06:18 function.openssl-pkcs7-verify.html
-rw-r--r--     32561 2016-12-08 06:19 function.oci-get-implicit-resultset.html
-rw-r--r--      3809 2016-12-08 06:19 function.fann-get-bit-fail-limit.html
-rw-r--r--      1399 2016-12-08 06:20 com.requirements.html
-rw-r--r--      8454 2016-12-08 06:19 locale.getdisplayscript.html
-rw-r--r--      1527 2016-12-08 06:18 csprng.setup.html
-rw-r--r--     12139 2016-12-08 06:18 function.cubrid-connect.html
-rw-r--r--      3084 2016-12-08 06:19 hwapi.unlock.html
-rw-r--r--      2450 2016-12-08 06:19 splfileinfo.iswritable.html
-rw-r--r--      2715 2016-12-08 06:19 imagick.getpointsize.html
-rw-r--r--      3780 2016-12-08 06:20 ui-draw-brush-gradient.setstop.html
-rw-r--r--      2758 2016-12-08 06:19 gmagick.getimagemattecolor.html
-rw-r--r--      4778 2016-12-08 06:19 mysqli.debug.html
-rw-r--r--      2161 2016-12-08 06:19 mysqlnd-mux.changes-one-o.html
-rw-r--r--      7695 2016-12-08 06:19 function.sqlite-busy-timeout.html
-rw-r--r--      1564 2016-12-08 06:19 parsekit.setup.html
-rw-r--r--      2057 2016-12-08 06:19 sqlite3.installation.html
-rw-r--r--      1332 2016-12-08 06:20 pcre.resources.html
-rw-r--r--      5737 2016-12-08 06:20 function.socket-send.html
-rw-r--r--      5413 2016-12-08 06:19 function.mb-strripos.html
-rw-r--r--      5393 2016-12-08 06:20 ds-set.remove.html
-rw-r--r--      2191 2016-12-08 06:19 lua.installation.html
-rw-r--r--      2481 2016-12-08 06:19 spldoublylinkedlist.next.html
-rw-r--r--      2693 2016-12-08 06:19 ref.intl.grapheme.html
-rw-r--r--      2850 2016-12-08 06:20 solrparams.set.html
-rw-r--r--     13400 2016-12-08 06:19 class.sqlite3.html
-rw-r--r--      4513 2016-12-08 06:19 syncsemaphore.unlock.html
-rw-r--r--      3328 2016-12-08 06:19 oci-lob.erase.html
-rw-r--r--      2691 2016-12-08 06:20 solrquery.getmltmintermfrequency.html
-rw-r--r--      3911 2016-12-08 06:20 sessionhandlerinterface.open.html
-rw-r--r--      2252 2016-12-08 06:20 zmqpoll.clear.html
-rw-r--r--      1377 2016-12-08 06:19 stream.configuration.html
-rw-r--r--      2287 2016-12-08 06:20 varnishlog.getline.html
-rw-r--r--     30795 2016-12-08 06:19 function.json-encode.html
-rw-r--r--     15144 2016-12-08 06:19 function.oci-rollback.html
-rw-r--r--      5315 2016-12-08 06:18 function.cubrid-client-encoding.html
-rw-r--r--     14147 2016-12-08 06:20 ref.strings.html
-rw-r--r--      3211 2016-12-08 06:20 function.snmpset.html
-rw-r--r--      4034 2016-12-08 06:18 function.odbc-primarykeys.html
-rw-r--r--      4038 2016-12-08 06:19 gmagick.annotateimage.html
-rw-r--r--      2961 2016-12-08 06:20 sdo-dataobject.gettypenamespaceuri.html
-rw-r--r--      1789 2016-12-08 06:19 mysqlnd-memcache.changes.html
-rw-r--r--      2739 2016-12-08 06:19 recursivetreeiterator.valid.html
-rw-r--r--      1360 2016-12-08 06:20 msession.resources.html
-rw-r--r--      6414 2016-12-08 06:20 function.function-exists.html
-rw-r--r--      5402 2016-12-08 06:19 locale.getscript.html
-rw-r--r--      1367 2016-12-08 06:20 simplexml.resources.html
-rw-r--r--      1551 2016-12-08 06:18 fbsql.setup.html
-rw-r--r--      4204 2016-12-08 06:18 function.fbsql-insert-id.html
-rw-r--r--      3181 2016-12-08 06:19 gearmantask.unique.html
-rw-r--r--      3697 2016-12-08 06:19 function.posix-ttyname.html
-rw-r--r--      4577 2016-12-08 06:19 function.fann-test.html
-rw-r--r--      1955 2016-12-08 06:19 function.pdf-set-info-keywords.html
-rw-r--r--      2482 2016-12-08 06:20 solrdocument.reset.html
-rw-r--r--      3134 2016-12-08 06:18 function.newt-grid-get-size.html
-rw-r--r--      2418 2016-12-08 06:19 mysqlnd-memcache.requirements.html
-rw-r--r--      8351 2016-12-08 06:19 class.imagickpixeliterator.html
-rw-r--r--      2729 2016-12-08 06:19 xattr.constants.html
-rw-r--r--      3547 2016-12-08 06:18 function.id3-get-genre-name.html
-rw-r--r--      3040 2016-12-08 06:18 function.m-validateidentifier.html
-rw-r--r--      6406 2016-12-08 06:18 ingres.examples-basic.html
-rw-r--r--      6583 2016-12-08 06:18 phar.createdefaultstub.html
-rw-r--r--      7130 2016-12-08 06:19 class.recursivefilteriterator.html
-rw-r--r--      3132 2016-12-08 06:19 imagick.setimagecolormapcolor.html
-rw-r--r--      4863 2016-12-08 06:19 function.ps-arc.html
-rw-r--r--      8168 2016-12-08 06:19 function.mb-send-mail.html
-rw-r--r--      2796 2016-12-08 06:19 imagick.writeimagesfile.html
-rw-r--r--      2797 2016-12-08 06:19 function.fann-get-connection-rate.html
-rw-r--r--     11810 2016-12-08 06:19 class.yaf-action-abstract.html
-rw-r--r--      5316 2016-12-08 06:20 domnode.getnodepath.html
-rw-r--r--      5114 2016-12-08 06:19 memcached.getstats.html
-rw-r--r--     22229 2016-12-08 06:19 class.eventutil.html
-rw-r--r--      4303 2016-12-08 06:19 function.eio-busy.html
-rw-r--r--      3870 2016-12-08 06:19 fdf.installation.html
-rw-r--r--      1524 2016-12-08 06:19 oci8.setup.html
-rw-r--r--      3710 2016-12-08 06:20 internals2.opcodes.init-fcall-by-name.html
-rw-r--r--      2686 2016-12-08 06:19 splpriorityqueue.rewind.html
-rw-r--r--      5690 2016-12-08 06:20 quickhashintset.delete.html
-rw-r--r--     12755 2016-12-08 06:19 class.yaf-session.html
-rw-r--r--      5940 2016-12-08 06:19 class.mongoprotocolexception.html
-rw-r--r--      2498 2016-12-08 06:19 yaf-config-ini.current.html
-rw-r--r--      7548 2016-12-08 06:19 class.cairogradientpattern.html
-rw-r--r--      5390 2016-12-08 06:19 function.gmp-perfect-square.html
-rw-r--r--     13469 2016-12-08 06:19 book.ev.html
-rw-r--r--      2724 2016-12-08 06:19 uconverter.setsubstchars.html
-rw-r--r--      5666 2016-12-08 06:19 intlchar.isprint.html
-rw-r--r--      7302 2016-12-08 06:19 cairocontext.copypage.html
-rw-r--r--      1972 2016-12-08 06:19 ref.ming.html
-rw-r--r--     21443 2016-12-08 06:18 function.cubrid-bind.html
-rw-r--r--      2897 2016-12-08 06:19 gmagick.edgeimage.html
-rw-r--r--      9747 2016-12-08 06:20 reflectionfunction.invokeargs.html
-rw-r--r--      3060 2016-12-08 06:20 function.variant-set.html
-rw-r--r--      6758 2016-12-08 06:19 function.stream-filter-remove.html
-rw-r--r--      3381 2016-12-08 06:19 function.fann-set-quickprop-mu.html
-rw-r--r--      3732 2016-12-08 06:20 xmlreader.movetonextattribute.html
-rw-r--r--      4964 2016-12-08 06:19 spoofchecker.areconfusable.html
-rw-r--r--      2402 2016-12-08 06:18 audioproperties.getlayer.html
-rw-r--r--      1365 2016-12-08 06:20 wddx.configuration.html
-rw-r--r--      2226 2016-12-08 06:19 function.ocicollassignelem.html
-rw-r--r--      1400 2016-12-08 06:20 simplexml.configuration.html
-rw-r--r--     10630 2016-12-08 06:19 mongocursor.batchsize.html
-rw-r--r--      3608 2016-12-08 06:19 function.ldap-next-entry.html
-rw-r--r--      6717 2016-12-08 06:20 function.session-regenerate-id.html
-rw-r--r--      2843 2016-12-08 06:19 swftextfield.setlinespacing.html
-rw-r--r--      1772 2016-12-08 06:19 intro.memcache.html
-rw-r--r--      4528 2016-12-08 06:19 intro.maxdb.html
-rw-r--r--      5799 2016-12-08 06:19 function.eio-futime.html
-rw-r--r--      2402 2016-12-08 06:19 imagick.haspreviousimage.html
-rw-r--r--      7680 2016-12-08 06:19 mysqli.store-result.html
-rw-r--r--      2844 2016-12-08 06:20 solrinputdocument.setboost.html
-rw-r--r--      4710 2016-12-08 06:20 ds-map.skip.html
-rw-r--r--      1317 2016-12-08 06:19 intro.gnupg.html
-rw-r--r--      4377 2016-12-08 06:19 haruimage.setcolormask.html
-rw-r--r--     13150 2016-12-08 06:19 mongocollection.save.html
-rw-r--r--      7038 2016-12-08 06:20 soapheader.construct.html
-rw-r--r--      2522 2016-12-08 06:18 function.ncurses-panel-window.html
-rw-r--r--     12874 2016-12-08 06:19 datetime.add.html
-rw-r--r--      2505 2016-12-08 06:20 ui-draw-text-font-descriptor.getweight.html
-rw-r--r--     14213 2016-12-08 06:19 class.swfdisplayitem.html
-rw-r--r--      4586 2016-12-08 06:19 function.imap-body.html
-rw-r--r--      3492 2016-12-08 06:18 function.openal-source-play.html
-rw-r--r--      1814 2016-12-08 06:19 yaml.installation.html
-rw-r--r--      2926 2016-12-08 06:19 function.imagesetpixel.html
-rw-r--r--      1500 2016-12-08 06:20 quickhash.setup.html
-rw-r--r--      2378 2016-12-08 06:19 evloop.invokepending.html
-rw-r--r--      2613 2016-12-08 06:18 security.cgi-bin.shell.html
-rw-r--r--      1527 2016-12-08 06:19 msql.setup.html
-rw-r--r--      7515 2016-12-08 06:19 mysqli.connect-error.html
-rw-r--r--     14498 2016-12-08 06:18 function.mcrypt-module-open.html
-rw-r--r--      3514 2016-12-08 06:19 function.fann-set-quickprop-decay.html
-rw-r--r--      1521 2016-12-08 06:20 ctype.setup.html
-rw-r--r--      7017 2016-12-08 06:19 function.date-default-timezone-set.html
-rw-r--r--      2567 2016-12-08 06:19 function.pdf-fit-pdi-page.html
-rw-r--r--      6840 2016-12-08 06:19 function.ldap-get-values.html
-rw-r--r--     11587 2016-12-08 06:19 mongo.installation.html
-rw-r--r--      2288 2016-12-08 06:19 mssql.resources.html
-rw-r--r--      1699 2016-12-08 06:18 pharexception.intro.unused.html
-rw-r--r--      3170 2016-12-08 06:20 reflectionclass.getparentclass.html
-rw-r--r--      3701 2016-12-08 06:18 ref.apd.html
-rw-r--r--      8056 2016-12-08 06:19 function.mysql-fetch-row.html
-rw-r--r--      3309 2016-12-08 06:20 function.session-write-close.html
-rw-r--r--     10428 2016-12-08 06:19 intlcalendar.getrepeatedwalltimeoption.html
-rw-r--r--      1353 2016-12-08 06:20 win32ps.resources.html
-rw-r--r--     13710 2016-12-08 06:19 mysqlnd-ms.pooling.html
-rw-r--r--      2831 2016-12-08 06:19 gearmantask.jobhandle.html
-rw-r--r--      3708 2016-12-08 06:20 function.quoted-printable-decode.html
-rw-r--r--      3305 2016-12-08 06:19 harupage.getgmode.html
-rw-r--r--      8334 2016-12-08 06:20 quickhashinthash.exists.html
-rw-r--r--      3690 2016-12-08 06:18 reserved.variables.html
-rw-r--r--      1661 2016-12-08 06:18 intro.openssl.html
-rw-r--r--      4920 2016-12-08 06:19 cairocontext.resetclip.html
-rw-r--r--      3046 2016-12-08 06:19 imagickdraw.pathlinetohorizontalrelative.html
-rw-r--r--      2854 2016-12-08 06:20 function.get-declared-traits.html
-rw-r--r--      2384 2016-12-08 06:18 dba.configuration.html
-rw-r--r--      2758 2016-12-08 06:19 event.getsupportedmethods.html
-rw-r--r--      5205 2016-12-08 06:19 function.cairo-pattern-create-linear.html
-rw-r--r--     12292 2016-12-08 06:19 function.eio-read.html
-rw-r--r--      2687 2016-12-08 06:20 function.rrdc-disconnect.html
-rw-r--r--      1419 2016-12-08 06:20 intro.oauth.html
-rw-r--r--      3517 2016-12-08 06:18 function.mcrypt-module-is-block-algorithm.html
-rw-r--r--      2883 2016-12-08 06:18 security.cgi-bin.force-redirect.html
-rw-r--r--      8554 2016-12-08 06:20 simplexmlelement.addAttribute.html
-rw-r--r--      5280 2016-12-08 06:19 arrayobject.offsetget.html
-rw-r--r--      7567 2016-12-08 06:18 function.openssl-spki-export-challenge.html
-rw-r--r--      1497 2016-12-08 06:19 ps.setup.html
-rw-r--r--      3905 2016-12-08 06:19 function.inotify-queue-len.html
-rw-r--r--      2170 2016-12-08 06:18 function.ncurses-reset-shell-mode.html
-rw-r--r--      4575 2016-12-08 06:19 gearmanclient.addservers.html
-rw-r--r--      3919 2016-12-08 06:19 intro.fdf.html
-rw-r--r--      2575 2016-12-08 06:19 harufont.getencodingname.html
-rw-r--r--      4274 2016-12-08 06:19 multipleiterator.attachiterator.html
-rw-r--r--      2681 2016-12-08 06:19 gmagickdraw.polygon.html
-rw-r--r--      8717 2016-12-08 06:19 arrayobject.uksort.html
-rw-r--r--      7225 2016-12-08 06:19 function.grapheme-strstr.html
-rw-r--r--      5459 2016-12-08 06:18 function.runkit-function-copy.html
-rw-r--r--      7373 2016-12-08 06:20 migration71.constants.html
-rw-r--r--      4658 2016-12-08 06:19 function.gupnp-service-proxy-callback-set.html
-rw-r--r--      2302 2016-12-08 06:20 varnishadmin.start.html
-rw-r--r--      7093 2016-12-08 06:18 function.radius-put-int.html
-rw-r--r--     18576 2016-12-08 06:18 security.database.sql-injection.html
-rw-r--r--      3197 2016-12-08 06:20 function.session-pgsql-set-field.html
-rw-r--r--      2034 2016-12-08 06:19 function.pdf-resume-page.html
-rw-r--r--      2338 2016-12-08 06:18 function.readline-on-new-line.html
-rw-r--r--      3804 2016-12-08 06:19 cairoscaledfont.getscalematrix.html
-rw-r--r--      3573 2016-12-08 06:19 function.sem-release.html
-rw-r--r--      3745 2016-12-08 06:19 function.fann-get-training-algorithm.html
-rw-r--r--      4596 2016-12-08 06:19 hwapi.checkin.html
-rw-r--r--      6415 2016-12-08 06:20 solrdismaxquery.removeboostquery.html
-rw-r--r--      5997 2016-12-08 06:18 function.restore-error-handler.html
-rw-r--r--      2329 2016-12-08 06:19 function.pdf-load-font.html
-rw-r--r--      7216 2016-12-08 06:19 refs.international.html
-rw-r--r--      4715 2016-12-08 06:19 memcached.appendbykey.html
-rw-r--r--      2856 2016-12-08 06:20 function.svn-fs-delete.html
-rw-r--r--      4229 2016-12-08 06:19 imagick.flopimage.html
-rw-r--r--      1530 2016-12-08 06:19 intro.gupnp.html
-rw-r--r--      1482 2016-12-08 06:19 mongo.gridfs.html
-rw-r--r--      2327 2016-12-08 06:19 function.pdf-info-font.html
-rw-r--r--      1518 2016-12-08 06:19 cairo.setup.html
-rw-r--r--      7578 2016-12-08 06:19 resourcebundle.create.html
-rw-r--r--      6217 2016-12-08 06:19 mongoid.tostring.html
-rw-r--r--      1610 2016-12-08 06:20 migration54.deprecated.html
-rw-r--r--      3261 2016-12-08 06:19 function.dgettext.html
-rw-r--r--      3804 2016-12-08 06:19 eventhttprequest.addheader.html
-rw-r--r--      9600 2016-12-08 06:20 function.get-class.html
-rw-r--r--      4651 2016-12-08 06:19 function.fdf-open.html
-rw-r--r--      7791 2016-12-08 06:20 class.ui-controls-form.html
-rw-r--r--      4565 2016-12-08 06:20 ds-deque.shift.html
-rw-r--r--      2580 2016-12-08 06:19 yaf-session.unset.html
-rw-r--r--      3041 2016-12-08 06:20 reflectionfunctionabstract.getclosurescopeclass.html
-rw-r--r--     21504 2016-12-08 06:20 sdodasrel.metadata.html
-rw-r--r--     27029 2016-12-08 06:19 class.harudoc.html
-rw-r--r--      2800 2016-12-08 06:19 imagickdraw.setresolution.html
-rw-r--r--      2729 2016-12-08 06:19 function.pdf-get-pdi-parameter.html
-rw-r--r--      5864 2016-12-08 06:19 imagick.evaluateimage.html
-rw-r--r--      8885 2016-12-08 06:19 imagickdraw.setstrokealpha.html
-rw-r--r--      5335 2016-12-08 06:19 function.imagecreatefromgd.html
-rw-r--r--      3581 2016-12-08 06:19 v8js.configuration.html
-rw-r--r--      6685 2016-12-08 06:20 class.ui-controls-colorbutton.html
-rw-r--r--      2936 2016-12-08 06:19 mongodb.dropcollection.html
-rw-r--r--      2964 2016-12-08 06:18 function.m-returnstatus.html
-rw-r--r--      2859 2016-12-08 06:19 oci-lob.eof.html
-rw-r--r--      6122 2016-12-08 06:20 function.is-null.html
-rw-r--r--      2919 2016-12-08 06:18 function.newt-checkbox-set-value.html
-rw-r--r--      2687 2016-12-08 06:19 class.mongodb-bson-minkey.html
-rw-r--r--      1439 2016-12-08 06:19 posix.installation.html
-rw-r--r--      3684 2016-12-08 06:20 sphinxclient.setgroupdistinct.html
-rw-r--r--     11467 2016-12-08 06:19 function.pg-connect.html
-rw-r--r--      2889 2016-12-08 06:20 solrquery.gethighlightsimplepre.html
-rw-r--r--      2215 2016-12-08 06:20 sdodasrel.installation.html
-rw-r--r--      2890 2016-12-08 06:18 book.dbx.html
-rw-r--r--      8477 2016-12-08 06:19 intldateformatter.gettimezone.html
-rw-r--r--      9664 2016-12-08 06:19 memcache.set.html
-rw-r--r--      2728 2016-12-08 06:20 function.iis-add-server.html
-rw-r--r--      3336 2016-12-08 06:18 function.ifx-errormsg.html
-rw-r--r--      4048 2016-12-08 06:20 internals2.opcodes.assign.html
-rw-r--r--     15438 2016-12-08 06:19 function.parse-url.html
-rw-r--r--      4616 2016-12-08 06:18 function.dbase-get-record.html
-rw-r--r--      1825 2016-12-08 06:19 function.dns-get-mx.html
-rw-r--r--      6603 2016-12-08 06:19 arrayobject.asort.html
-rw-r--r--      3038 2016-12-08 06:18 function.ncurses-savetty.html
-rw-r--r--      6831 2016-12-08 06:19 mongodb.getreadpreference.html
-rw-r--r--      8604 2016-12-08 06:20 stomp.error.html
-rw-r--r--      4088 2016-12-08 06:20 function.socket-close.html
-rw-r--r--     13496 2016-12-08 06:19 book.pgsql.html
-rw-r--r--      6425 2016-12-08 06:18 function.openssl-pkcs7-decrypt.html
-rw-r--r--      9502 2016-12-08 06:19 libevent.examples.html
-rw-r--r--      2899 2016-12-08 06:19 swfmorph.getshape2.html
-rw-r--r--      2944 2016-12-08 06:20 svmmodel.load.html
-rw-r--r--      8280 2016-12-08 06:20 quickhashinthash.loadfromfile.html
-rw-r--r--      5741 2016-12-08 06:19 class.mongomaxkey.html
-rw-r--r--      2511 2016-12-08 06:19 intliterator.valid.html
-rw-r--r--      4681 2016-12-08 06:20 rrd.examples-procedural.html
-rw-r--r--     13124 2016-12-08 06:18 dbplus.errorcodes.html
-rw-r--r--      4100 2016-12-08 06:20 simplexmlelement.tostring.html
-rw-r--r--      3845 2016-12-08 06:20 domelement.getelementsbytagnamens.html
-rw-r--r--     12958 2016-12-08 06:20 function.array-diff-ukey.html
-rw-r--r--      7659 2016-12-08 06:19 function.mqseries-open.html
-rw-r--r--      5156 2016-12-08 06:19 function.mysql-get-client-info.html
-rw-r--r--      8985 2016-12-08 06:19 function.ldap-bind.html
-rw-r--r--      7618 2016-12-08 06:19 class.mongodb-driver-readconcern.html
-rw-r--r--      2955 2016-12-08 06:19 function.sybase-get-last-message.html
-rw-r--r--      1358 2016-12-08 06:20 sca.configuration.html
-rw-r--r--      2247 2016-12-08 06:20 function.msession-inc.html
-rw-r--r--      8913 2016-12-08 06:19 function.imageflip.html
-rw-r--r--      1844 2016-12-08 06:19 function.diskfreespace.html
-rw-r--r--      4260 2016-12-08 06:19 cairosurface.setfallbackresolution.html
-rw-r--r--     10171 2016-12-08 06:19 mongodb-driver-bulkwrite.delete.html
-rw-r--r--      2967 2016-12-08 06:19 function.imagerectangle.html
-rw-r--r--      3725 2016-12-08 06:19 swftext.setcolor.html
-rw-r--r--      8187 2016-12-08 06:20 function.libxml-set-external-entity-loader.html
-rw-r--r--      6533 2016-12-08 06:18 class.iteratoraggregate.html
-rw-r--r--      5046 2016-12-08 06:19 function.tidy-warning-count.html
-rw-r--r--      4780 2016-12-08 06:19 mysqli.get-client-version.html
-rw-r--r--      3605 2016-12-08 06:19 function.fann-get-train-error-function.html
-rw-r--r--      6033 2016-12-08 06:19 function.yaml-parse-url.html
-rw-r--r--      2643 2016-12-08 06:19 oci-lob.tell.html
-rw-r--r--      3932 2016-12-08 06:19 class.swfsoundinstance.html
-rw-r--r--      1537 2016-12-08 06:19 pcntl.setup.html
-rw-r--r--      4369 2016-12-08 06:19 function.cairo-surface-flush.html
-rw-r--r--      1990 2016-12-08 06:20 regexp.reference.alternation.html
-rw-r--r--      2823 2016-12-08 06:19 swftext.getwidth.html
-rw-r--r--     13121 2016-12-08 06:19 function.mysql-affected-rows.html
-rw-r--r--     11825 2016-12-08 06:19 function.sqlite-fetch-array.html
-rw-r--r--      3212 2016-12-08 06:19 function.cosh.html
-rw-r--r--      3435 2016-12-08 06:18 function.zip-entry-close.html
-rw-r--r--      1929 2016-12-08 06:18 intro.dbx.html
-rw-r--r--      3762 2016-12-08 06:19 function.px-set-tablename.html
-rw-r--r--      8562 2016-12-08 06:19 yaf-dispatcher.catchexception.html
-rw-r--r--      2988 2016-12-08 06:18 function.m-iscommadelimited.html
-rw-r--r--      2828 2016-12-08 06:19 mongoint64.tostring.html
-rw-r--r--      2826 2016-12-08 06:18 function.ncurses-addchstr.html
-rw-r--r--      2743 2016-12-08 06:20 migration51.errorcheck.html
-rw-r--r--      2354 2016-12-08 06:20 varnishadmin.clearpanic.html
-rw-r--r--      2571 2016-12-08 06:19 harupage.fill.html
-rw-r--r--      2765 2016-12-08 06:18 function.newt-resume.html
-rw-r--r--      6411 2016-12-08 06:20 function.xmlwriter-write-element-ns.html
-rw-r--r--      7680 2016-12-08 06:20 ds-deque.contains.html
-rw-r--r--      5905 2016-12-08 06:20 function.ksort.html
-rw-r--r--      8348 2016-12-08 06:19 function.sqlsrv-rows-affected.html
-rw-r--r--      3151 2016-12-08 06:19 function.imagefilledrectangle.html
-rw-r--r--      7230 2016-12-08 06:20 internals2.opcodes.throw.html
-rw-r--r--      9398 2016-12-08 06:20 oauth.getaccesstoken.html
-rw-r--r--      5737 2016-12-08 06:19 function.ps-set-info.html
-rw-r--r--      1340 2016-12-08 06:18 dbase.requirements.html
-rw-r--r--     11123 2016-12-08 06:18 function.db2-procedure-columns.html
-rw-r--r--      6144 2016-12-08 06:19 splfileinfo.getrealpath.html
-rw-r--r--      1324 2016-12-08 06:18 kadm5.examples.html
-rw-r--r--      2451 2016-12-08 06:19 imagick.current.html
-rw-r--r--     10687 2016-12-08 06:19 class.OCI-Lob.html
-rw-r--r--      2932 2016-12-08 06:19 yaf-config-ini.offsetset.html
-rw-r--r--      3789 2016-12-08 06:19 function.ps-setlinecap.html
-rw-r--r--      3122 2016-12-08 06:19 intlbreakiterator.createlineinstance.html
-rw-r--r--      2819 2016-12-08 06:19 function.cyrus-query.html
-rw-r--r--      7083 2016-12-08 06:20 function.yaz-itemorder.html
-rw-r--r--     14253 2016-12-08 06:20 solrclient.adddocument.html
-rw-r--r--     11822 2016-12-08 06:19 class.recursivearrayiterator.html
-rw-r--r--      4502 2016-12-08 06:19 imagickdraw.pathcurvetoabsolute.html
-rw-r--r--      2611 2016-12-08 06:19 yaf-request-simple.getfiles.html
-rw-r--r--      3146 2016-12-08 06:19 swfmovie.setrate.html
-rw-r--r--      6540 2016-12-08 06:19 function.is-readable.html
-rw-r--r--      5349 2016-12-08 06:20 ds-vector.apply.html
-rw-r--r--      2173 2016-12-08 06:19 function.pdf-delete-pvf.html
-rw-r--r--      2481 2016-12-08 06:19 imagick.getimageextrema.html
-rw-r--r--      9806 2016-12-08 06:20 class.domentityreference.html
-rw-r--r--     11507 2016-12-08 06:18 language.constants.syntax.html
-rw-r--r--     25164 2016-12-08 06:19 pcntl.constants.html
-rw-r--r--      5424 2016-12-08 06:19 function.mssql-close.html
-rw-r--r--      3406 2016-12-08 06:19 function.fdf-get-encoding.html
-rw-r--r--      3257 2016-12-08 06:19 libevent.constants.html
-rw-r--r--      3060 2016-12-08 06:20 sdo-model-type.isdatatype.html
-rw-r--r--     79344 2016-12-08 06:19 function.curl-setopt.html
-rw-r--r--      4330 2016-12-08 06:19 function.pspell-check.html
-rw-r--r--      2579 2016-12-08 06:20 ui-draw-color.getchannel.html
-rw-r--r--      4629 2016-12-08 06:19 function.trader-stoch.html
-rw-r--r--      3057 2016-12-08 06:19 yaf-dispatcher.getapplication.html
-rw-r--r--      2779 2016-12-08 06:19 gmagick.getimagechanneldepth.html
-rw-r--r--      2608 2016-12-08 06:20 ui-controls-multilineentry.construct.html
-rw-r--r--      3819 2016-12-08 06:19 function.ps-setlinejoin.html
-rw-r--r--      6191 2016-12-08 06:19 function.xattr-remove.html
-rw-r--r--      3877 2016-12-08 06:19 function.fdf-get-ap.html
-rw-r--r--      2894 2016-12-08 06:20 internals2.opcodes.assign-sl.html
-rw-r--r--     11270 2016-12-08 06:19 mysqli.thread-id.html
-rw-r--r--     10489 2016-12-08 06:19 numberformatter.create.html
-rw-r--r--      3066 2016-12-08 06:19 gearmanworker.echo.html
-rw-r--r--     18103 2016-12-08 06:19 class.mongolog.html
-rw-r--r--     24533 2016-12-08 06:19 class.intlrulebasedbreakiterator.html
-rw-r--r--      4910 2016-12-08 06:19 recursivecallbackfilteriterator.construct.html
-rw-r--r--      1710 2016-12-08 06:20 iisfunc.installation.html
-rw-r--r--      3028 2016-12-08 06:20 reflectionproperty.getname.html
-rw-r--r--      3925 2016-12-08 06:19 cairopssurface.dsccomment.html
-rw-r--r--      4176 2016-12-08 06:18 function.fbsql-hostname.html
-rw-r--r--      3681 2016-12-08 06:18 language.references.arent.html
-rw-r--r--      7300 2016-12-08 06:19 function.eio-cancel.html
-rw-r--r--      1958 2016-12-08 06:19 function.pdf-get-image-width.html
-rw-r--r--      2532 2016-12-08 06:19 swftext.getdescent.html
-rw-r--r--      4993 2016-12-08 06:19 tidynode.getparent.html
-rw-r--r--      9349 2016-12-08 06:18 function.cubrid-fetch-assoc.html
-rw-r--r--      1372 2016-12-08 06:18 bzip2.configuration.html
-rw-r--r--      8780 2016-12-08 06:20 function.strnatcmp.html
-rw-r--r--      3260 2016-12-08 06:19 yaf-plugin-abstract.predispatch.html
-rw-r--r--      6660 2016-12-08 06:18 apcu.constants.html
-rw-r--r--      5376 2016-12-08 06:20 internals2.opcodes.switch-free.html
-rw-r--r--     15711 2016-12-08 06:20 function.setlocale.html
-rw-r--r--      6642 2016-12-08 06:20 function.array-merge-recursive.html
-rw-r--r--     11549 2016-12-08 06:19 intldateformatter.localtime.html
-rw-r--r--      3035 2016-12-08 06:18 arrayaccess.offsetunset.html
-rw-r--r--      3654 2016-12-08 06:18 features.cookies.html
-rw-r--r--      2736 2016-12-08 06:19 function.eio-set-max-idle.html
-rw-r--r--      3140 2016-12-08 06:20 xml.encoding.html
-rw-r--r--      1390 2016-12-08 06:18 scream.examples.html
-rw-r--r--      3118 2016-12-08 06:18 pdo-4d.constants.html
-rw-r--r--      3478 2016-12-08 06:20 zookeeper.isrecoverable.html
-rw-r--r--      2670 2016-12-08 06:19 function.stats-rand-gen-t.html
-rw-r--r--      2879 2016-12-08 06:19 function.mailparse-msg-get-part.html
-rw-r--r--     19811 2016-12-08 06:19 mysqli.rollback.html
-rw-r--r--      3100 2016-12-08 06:19 gmagickdraw.setstrokecolor.html
-rw-r--r--      1342 2016-12-08 06:18 memtrack.examples.html
-rw-r--r--      5398 2016-12-08 06:19 function.imap-savebody.html
-rw-r--r--      2723 2016-12-08 06:19 function.trader-linearreg.html
-rw-r--r--      5664 2016-12-08 06:19 function.filesize.html
-rw-r--r--      4658 2016-12-08 06:19 imagick.oilpaintimage.html
-rw-r--r--      3985 2016-12-08 06:20 reflectionproperty.export.html
-rw-r--r--      7372 2016-12-08 06:20 function.classkit-method-copy.html
-rw-r--r--      4265 2016-12-08 06:20 function.xmlrpc-decode.html
-rw-r--r--      2864 2016-12-08 06:20 function.svn-fs-file-length.html
-rw-r--r--      2438 2016-12-08 06:19 imagick.getinterlacescheme.html
-rw-r--r--      2993 2016-12-08 06:18 function.ncurses-wvline.html
-rw-r--r--      2266 2016-12-08 06:20 ui-point.setx.html
-rw-r--r--      8913 2016-12-08 06:18 pdo.pgsqllobopen.html
-rw-r--r--      7198 2016-12-08 06:19 imagick.setsamplingfactors.html
-rw-r--r--      9294 2016-12-08 06:19 function.mysql-list-fields.html
-rw-r--r--      4470 2016-12-08 06:20 reflectionclass.newinstancewithoutconstructor.html
-rw-r--r--      3432 2016-12-08 06:19 function.fann-get-rprop-increase-factor.html
-rw-r--r--      3922 2016-12-08 06:19 mysqli-stmt.close.html
-rw-r--r--      1835 2016-12-08 06:19 intro.mqseries.html
-rw-r--r--      4504 2016-12-08 06:19 function.cairo-pattern-get-linear-points.html
-rw-r--r--      3270 2016-12-08 06:20 migration53.html
-rw-r--r--      6419 2016-12-08 06:18 function.fbsql-fetch-object.html
-rw-r--r--      4417 2016-12-08 06:19 fam.constants.html
-rw-r--r--      3439 2016-12-08 06:19 eventbase.gotexit.html
-rw-r--r--      2495 2016-12-08 06:19 yaf-loader.clone.html
-rw-r--r--      4740 2016-12-08 06:19 function.sin.html
-rw-r--r--      9453 2016-12-08 06:19 mysqlnd-ms.quickstart.configuration.html
-rw-r--r--      3024 2016-12-08 06:19 function.ldap-mod-replace.html
-rw-r--r--      2519 2016-12-08 06:18 pdo.intransaction.html
-rw-r--r--      2445 2016-12-08 06:19 imagickdraw.getgravity.html
-rw-r--r--      2745 2016-12-08 06:18 function.mcrypt-enc-get-key-size.html
-rw-r--r--      6883 2016-12-08 06:18 language.constants.predefined.html
-rw-r--r--      4527 2016-12-08 06:19 yaf-application.environ.html
-rw-r--r--      3601 2016-12-08 06:18 function.runkit-constant-remove.html
-rw-r--r--      7752 2016-12-08 06:19 mongodb.overview.html
-rw-r--r--      2702 2016-12-08 06:20 about.notes.html
-rw-r--r--      6549 2016-12-08 06:19 globiterator.construct.html
-rw-r--r--      1231 2016-12-08 06:19 chdb.constants.html
-rw-r--r--      2284 2016-12-08 06:19 function.event-free.html
-rw-r--r--      2316 2016-12-08 06:19 splfixedarray.key.html
-rw-r--r--      4700 2016-12-08 06:19 mongoregex.tostring.html
-rw-r--r--      8674 2016-12-08 06:19 intlchar.hasbinaryproperty.html
-rw-r--r--      3198 2016-12-08 06:19 function.trader-willr.html
-rw-r--r--      3906 2016-12-08 06:20 samconnection.commit.html
-rw-r--r--      1347 2016-12-08 06:20 apache.requirements.html
-rw-r--r--      6218 2016-12-08 06:19 class.yaf-bootstrap-abstract.html
-rw-r--r--      3529 2016-12-08 06:19 evloop.prepare.html
-rw-r--r--      1910 2016-12-08 06:20 userlandnaming.tips.html
-rw-r--r--      4719 2016-12-08 06:19 class.mutex.html
-rw-r--r--      5983 2016-12-08 06:19 imagick.roundcorners.html
-rw-r--r--      8454 2016-12-08 06:18 function.ibase-blob-import.html
-rw-r--r--      2989 2016-12-08 06:19 yaf-config-simple.offsetset.html
-rw-r--r--      1536 2016-12-08 06:20 ref.stomp.html
-rw-r--r--      4326 2016-12-08 06:19 function.tan.html
-rw-r--r--      2798 2016-12-08 06:19 recursivetreeiterator.rewind.html
-rw-r--r--     13199 2016-12-08 06:19 mysqli-result.fetch-row.html
-rw-r--r--      6641 2016-12-08 06:18 phar.setdefaultstub.html
-rw-r--r--      3303 2016-12-08 06:19 function.eio-init.html
-rw-r--r--      2234 2016-12-08 06:20 ui-controls-box.ispadded.html
-rw-r--r--      5762 2016-12-08 06:20 regexp.reference.internal-options.html
-rw-r--r--      7950 2016-12-08 06:19 mysqlnduhconnection.getsqlstate.html
-rw-r--r--      6579 2016-12-08 06:19 function.ps-add-note.html
-rw-r--r--      8349 2016-12-08 06:20 function.next.html
-rw-r--r--      7534 2016-12-08 06:18 book.ibase.html
-rw-r--r--      2113 2016-12-08 06:19 function.ocisavelob.html
-rw-r--r--      2590 2016-12-08 06:19 function.pdf-fill-imageblock.html
-rw-r--r--      2256 2016-12-08 06:19 function.pdf-scale.html
-rw-r--r--      8830 2016-12-08 06:19 mongodb-driver-writeresult.getupsertedcount.html
-rw-r--r--      3319 2016-12-08 06:19 gmagick.mapimage.html
-rw-r--r--      9933 2016-12-08 06:20 migration52.methods.html
-rw-r--r--      4703 2016-12-08 06:18 ziparchive.addemptydir.html
-rw-r--r--      3155 2016-12-08 06:18 function.ncurses-wmouse-trafo.html
-rw-r--r--      8527 2016-12-08 06:20 function.array-keys.html
-rw-r--r--      1397 2016-12-08 06:18 errorfunc.installation.html
-rw-r--r--      3558 2016-12-08 06:19 tokyotyrantiterator.current.html
-rw-r--r--      2979 2016-12-08 06:19 gmagick.setimageunits.html
-rw-r--r--     14191 2016-12-08 06:18 function.cubrid-execute.html
-rw-r--r--      2944 2016-12-08 06:20 function.svn-fs-dir-entries.html
-rw-r--r--      1787 2016-12-08 06:19 intro.oci8.html
-rw-r--r--      1552 2016-12-08 06:20 filter.filters.html
-rw-r--r--      3383 2016-12-08 06:19 eventbase.gotstop.html
-rw-r--r--      2306 2016-12-08 06:19 function.judy-version.html
-rw-r--r--      2629 2016-12-08 06:19 function.taint.html
-rw-r--r--      4803 2016-12-08 06:19 imagick.rollimage.html
-rw-r--r--      5100 2016-12-08 06:19 imagick.setimageproperty.html
-rw-r--r--      2899 2016-12-08 06:19 intltimezone.createtimezone.html
-rw-r--r--      4417 2016-12-08 06:18 function.odbc-gettypeinfo.html
-rw-r--r--      5952 2016-12-08 06:20 function.lcfirst.html
-rw-r--r--      2864 2016-12-08 06:19 spldoublylinkedlist.offsetexists.html
-rw-r--r--      2205 2016-12-08 06:19 function.pdf-get-majorversion.html
-rw-r--r--      3757 2016-12-08 06:19 harupage.arc.html
-rw-r--r--      2743 2016-12-08 06:19 gmagick.getimagerenderingintent.html
-rw-r--r--      2813 2016-12-08 06:19 function.fann-get-layer-array.html
-rw-r--r--     19576 2016-12-08 06:20 configure.about.html
-rw-r--r--      2298 2016-12-08 06:20 ui-controls-label.settext.html
-rw-r--r--      7885 2016-12-08 06:19 function.gupnp-context-timeout-add.html
-rw-r--r--      5974 2016-12-08 06:18 wincache.reroutes.html
-rw-r--r--      6736 2016-12-08 06:19 function.iconv-strpos.html
-rw-r--r--      2572 2016-12-08 06:19 function.eio-set-max-poll-reqs.html
-rw-r--r--     12246 2016-12-08 06:18 functions.variable-functions.html
-rw-r--r--      8364 2016-12-08 06:18 closure.bind.html
-rw-r--r--      2321 2016-12-08 06:19 function.pdf-pcos-get-number.html
-rw-r--r--      7372 2016-12-08 06:19 memcached.getserverbykey.html
-rw-r--r--     42633 2016-12-08 06:19 class.numberformatter.html
-rw-r--r--      5540 2016-12-08 06:20 simplexmliterator.haschildren.html
-rw-r--r--      1350 2016-12-08 06:19 expect.examples.html
-rw-r--r--      2191 2016-12-08 06:19 imagick.previousimage.html
-rw-r--r--      8939 2016-12-08 06:20 ds-sequence.reduce.html
-rw-r--r--      6079 2016-12-08 06:18 function.newt-form-add-component.html
-rw-r--r--      6419 2016-12-08 06:19 book.curl.html
-rw-r--r--     10580 2016-12-08 06:19 mongocommandcursor.createfromdocument.html
-rw-r--r--     11113 2016-12-08 06:19 mysqli.field-count.html
-rw-r--r--      2326 2016-12-08 06:19 event.delsignal.html
-rw-r--r--      8713 2016-12-08 06:20 function.strripos.html
-rw-r--r--      5250 2016-12-08 06:20 ds-set.intersect.html
-rw-r--r--      2422 2016-12-08 06:19 function.pdf-set-info.html
-rw-r--r--      5459 2016-12-08 06:20 yar-server.construct.html
-rw-r--r--      2799 2016-12-08 06:19 judy.offsetset.html
-rw-r--r--      3876 2016-12-08 06:19 mongodb.reseterror.html
-rw-r--r--      4406 2016-12-08 06:19 function.bcmod.html
-rw-r--r--      5815 2016-12-08 06:20 solrquery.addgroupquery.html
-rw-r--r--      4863 2016-12-08 06:20 domcharacterdata.deletedata.html
-rw-r--r--      4792 2016-12-08 06:19 splfileobject.setflags.html
-rw-r--r--      3290 2016-12-08 06:18 configuration.file.per-user.html
-rw-r--r--      1384 2016-12-08 06:20 stomp.resources.html
-rw-r--r--      5498 2016-12-08 06:20 function.ssh2-fingerprint.html
-rw-r--r--     14070 2016-12-08 06:20 function.filter-var.html
-rw-r--r--     12301 2016-12-08 06:18 function.cubrid-fetch-object.html
-rw-r--r--      2638 2016-12-08 06:18 function.m-transnew.html
-rw-r--r--      1572 2016-12-08 06:19 mysqlnd-mux.setup.html
-rw-r--r--      2544 2016-12-08 06:19 function.trader-ht-dcperiod.html
-rw-r--r--     17068 2016-12-08 06:19 mysqli-result.fetch-field.html
-rw-r--r--      2760 2016-12-08 06:20 ref.rrd.html
-rw-r--r--     15821 2016-12-08 06:19 yaf.appconfig.html
-rw-r--r--      4169 2016-12-08 06:19 function.rpm-close.html
-rw-r--r--      1981 2016-12-08 06:18 constants.newt.fd-flags.html
-rw-r--r--      4224 2016-12-08 06:18 function.fbsql-list-tables.html
-rw-r--r--      5435 2016-12-08 06:19 function.posix-geteuid.html
-rw-r--r--      3815 2016-12-08 06:19 mongo.setslaveokay.html
-rw-r--r--      8668 2016-12-08 06:19 gearmanworker.wait.html
-rw-r--r--     11522 2016-12-08 06:18 function.cubrid-put.html
-rw-r--r--      2902 2016-12-08 06:19 hwapi.hwstat.html
-rw-r--r--      4588 2016-12-08 06:19 yaf-application.getmodules.html
-rw-r--r--      2888 2016-12-08 06:19 mongocursor.current.html
-rw-r--r--      8306 2016-12-08 06:19 function.get-meta-tags.html
-rw-r--r--      3223 2016-12-08 06:19 function.sybase-free-result.html
-rw-r--r--      5680 2016-12-08 06:19 directoryiterator.iswritable.html
-rw-r--r--      2895 2016-12-08 06:18 function.ncurses-wmove.html
-rw-r--r--      8334 2016-12-08 06:19 function.maxdb-get-server-version.html
-rw-r--r--      4472 2016-12-08 06:20 sphinxclient.setgeoanchor.html
-rw-r--r--      4590 2016-12-08 06:18 function.ob-get-length.html
-rw-r--r--      3910 2016-12-08 06:19 function.fann-randomize-weights.html
-rw-r--r--      2712 2016-12-08 06:19 uconverter.getaliases.html
-rw-r--r--      2458 2016-12-08 06:20 svm.setoptions.html
-rw-r--r--      2399 2016-12-08 06:19 imagick.getimagesignature.html
-rw-r--r--      6118 2016-12-08 06:19 limititerator.getposition.html
-rw-r--r--      4520 2016-12-08 06:20 ui-controls-grid.append.html
-rw-r--r--      2675 2016-12-08 06:19 function.mysqli-get-metadata.html
-rw-r--r--      7152 2016-12-08 06:19 mongodb-driver-bulkwrite.count.html
-rw-r--r--      1627 2016-12-08 06:18 install.cloud.html
-rw-r--r--      9469 2016-12-08 06:19 function.time-nanosleep.html
-rw-r--r--     16038 2016-12-08 06:19 imagickkernel.addunitykernel.html
-rw-r--r--      3501 2016-12-08 06:19 function.gupnp-root-device-get-available.html
-rw-r--r--      5632 2016-12-08 06:19 imagick.compareimagelayers.html
-rw-r--r--      2892 2016-12-08 06:18 function.ncurses-slk-attroff.html
-rw-r--r--      5143 2016-12-08 06:19 datetimezone.getlocation.html
-rw-r--r--     12147 2016-12-08 06:18 runkit.sandbox-parent.html
-rw-r--r--      2890 2016-12-08 06:20 solrquery.gethighlightfragmenter.html
-rw-r--r--      5848 2016-12-08 06:18 weakref.construct.html
-rw-r--r--      1449 2016-12-08 06:19 curl.requirements.html
-rw-r--r--      2898 2016-12-08 06:19 function.mailparse-msg-create.html
-rw-r--r--     13193 2016-12-08 06:18 function.openssl-verify.html
-rw-r--r--      3495 2016-12-08 06:18 function.newt-vertical-scrollbar.html
-rw-r--r--      7065 2016-12-08 06:19 splobjectstorage.key.html
-rw-r--r--      2449 2016-12-08 06:19 gmagickdraw.getfontsize.html
-rw-r--r--      2952 2016-12-08 06:19 swfmovie.remove.html
-rw-r--r--      2622 2016-12-08 06:19 evembed.set.html
-rw-r--r--      3794 2016-12-08 06:20 samconnection.rollback.html
-rw-r--r--      6479 2016-12-08 06:19 yaf-application.getlasterrorno.html
-rw-r--r--      2716 2016-12-08 06:18 function.ncurses-panel-below.html
-rw-r--r--      1255 2016-12-08 06:19 sybase.constants.html
-rw-r--r--      3542 2016-12-08 06:18 function.ncurses-mvaddchnstr.html
-rw-r--r--      3015 2016-12-08 06:18 function.ob-get-level.html
-rw-r--r--      7337 2016-12-08 06:19 class.norewinditerator.html
-rw-r--r--      1660 2016-12-08 06:19 intl.requirements.html
-rw-r--r--      3616 2016-12-08 06:18 function.openal-context-process.html
-rw-r--r--      4023 2016-12-08 06:18 function.radius-config.html
-rw-r--r--      2064 2016-12-08 06:20 simplexmlelement.savexml.html
-rw-r--r--     13539 2016-12-08 06:19 class.evstat.html
-rw-r--r--      1372 2016-12-08 06:18 dbase.configuration.html
-rw-r--r--     17499 2016-12-08 06:19 swfbitmap.construct.html
-rw-r--r--      5966 2016-12-08 06:19 function.ftp-mkdir.html
-rw-r--r--      9314 2016-12-08 06:19 imagickdraw.roundrectangle.html
-rw-r--r--     10623 2016-12-08 06:19 ref.paradox.html
-rw-r--r--     16950 2016-12-08 06:20 dom.constants.html
-rw-r--r--      2529 2016-12-08 06:18 function.ncurses-bottom-panel.html
-rw-r--r--      3916 2016-12-08 06:18 crack.examples.html
-rw-r--r--      7212 2016-12-08 06:18 ziparchive.addfile.html
-rw-r--r--      6259 2016-12-08 06:19 function.gupnp-device-action-callback-set.html
-rw-r--r--      1286 2016-12-08 06:19 fann.resources.html
-rw-r--r--      3132 2016-12-08 06:20 ds-priorityqueue.construct.html
-rw-r--r--      8584 2016-12-08 06:20 internals2.variables.arrays.html
-rw-r--r--      5458 2016-12-08 06:19 function.enchant-dict-describe.html
-rw-r--r--      8627 2016-12-08 06:20 function.classkit-method-add.html
-rw-r--r--      4610 2016-12-08 06:19 intlcalendar.getweekendtransition.html
-rw-r--r--      1509 2016-12-08 06:19 yaml.setup.html
-rw-r--r--      2781 2016-12-08 06:19 yaf-request-abstract.setrouted.html
-rw-r--r--      7343 2016-12-08 06:19 memcached.addserver.html
-rw-r--r--      1386 2016-12-08 06:19 gearman.configuration.html
-rw-r--r--     17959 2016-12-08 06:19 class.event.html
-rw-r--r--      8943 2016-12-08 06:19 intlcalendar.indaylighttime.html
-rw-r--r--      1400 2016-12-08 06:20 xmlwriter.configuration.html
-rw-r--r--      2539 2016-12-08 06:18 ref.uopz.html
-rw-r--r--      4513 2016-12-08 06:20 ref.xml.html
-rw-r--r--      3672 2016-12-08 06:19 harupage.curveto3.html
-rw-r--r--      8805 2016-12-08 06:20 swishsearch.setphrasedelimiter.html
-rw-r--r--      4253 2016-12-08 06:19 function.oci-new-collection.html
-rw-r--r--      6791 2016-12-08 06:19 function.geoip-db-get-all-info.html
-rw-r--r--      6514 2016-12-08 06:19 function.pg-copy-to.html
-rw-r--r--      2850 2016-12-08 06:18 function.newt-form-set-width.html
-rw-r--r--      3706 2016-12-08 06:19 mongogridfscursor.construct.html
-rw-r--r--      3156 2016-12-08 06:19 refs.remote.mail.html
-rw-r--r--      3081 2016-12-08 06:20 function.svn-fs-change-node-prop.html
-rw-r--r--      2948 2016-12-08 06:20 solrquery.settimeallowed.html
-rw-r--r--      4888 2016-12-08 06:19 function.stream-get-wrappers.html
-rw-r--r--      9069 2016-12-08 06:19 function.mysqlnd-qc-set-cache-condition.html
-rw-r--r--      8623 2016-12-08 06:20 soapvar.soapvar.html
-rw-r--r--      7186 2016-12-08 06:18 function.apcu-store.html
-rw-r--r--      2512 2016-12-08 06:18 function.ncurses-slk-noutrefresh.html
-rw-r--r--      6990 2016-12-08 06:20 function.soundex.html
-rw-r--r--     13563 2016-12-08 06:20 class.reflectionparameter.html
-rw-r--r--     12902 2016-12-08 06:19 function.maxdb-real-escape-string.html
-rw-r--r--      1494 2016-12-08 06:20 xmldiff.requirements.html
-rw-r--r--      4295 2016-12-08 06:19 ref.enchant.html
-rw-r--r--      2869 2016-12-08 06:19 function.fann-shuffle-train-data.html
-rw-r--r--      2908 2016-12-08 06:19 function.hwapi-content-new.html
-rw-r--r--      6643 2016-12-08 06:18 pdo.errorinfo.html
-rw-r--r--      3288 2016-12-08 06:19 function.trader-cdlinvertedhammer.html
-rw-r--r--      2742 2016-12-08 06:18 function.openssl-free-key.html
-rw-r--r--      6723 2016-12-08 06:19 tidynode.isjste.html
-rw-r--r--      3418 2016-12-08 06:19 eventbuffer.addbuffer.html
-rw-r--r--     10987 2016-12-08 06:19 function.curl-multi-exec.html
-rw-r--r--     10398 2016-12-08 06:19 function.imap-mail-compose.html
-rw-r--r--      4317 2016-12-08 06:18 function.gzclose.html
-rw-r--r--      1996 2016-12-08 06:20 snmp.requirements.html
-rw-r--r--      4514 2016-12-08 06:19 splfileinfo.gettype.html
-rw-r--r--      3682 2016-12-08 06:19 ev.suspend.html
-rw-r--r--      4611 2016-12-08 06:19 function.cairo-pattern-set-extend.html
-rw-r--r--      3005 2016-12-08 06:18 function.fbsql-field-len.html
-rw-r--r--     10031 2016-12-08 06:19 class.threaded.html
-rw-r--r--      1853 2016-12-08 06:20 internals2.opcodes.zend-jmp-set.html
-rw-r--r--      2168 2016-12-08 06:19 hwapi.reason-description.html
-rw-r--r--      2925 2016-12-08 06:20 varnishadmin.setparam.html
-rw-r--r--      2550 2016-12-08 06:20 solrquery.gettermsprefix.html
-rw-r--r--      4783 2016-12-08 06:19 function.cal-days-in-month.html
-rw-r--r--     10537 2016-12-08 06:18 phardata.converttoexecutable.html
-rw-r--r--      5789 2016-12-08 06:20 refs.ui.html
-rw-r--r--     19966 2016-12-08 06:19 class.tokyotyranttable.html
-rw-r--r--      2744 2016-12-08 06:20 migration55.html
-rw-r--r--      2266 2016-12-08 06:18 phar.fileformat.flags.html
-rw-r--r--     15491 2016-12-08 06:20 function.unserialize.html
-rw-r--r--      2927 2016-12-08 06:19 swfsprite.remove.html
-rw-r--r--      9428 2016-12-08 06:19 function.msg-receive.html
-rw-r--r--      4465 2016-12-08 06:19 function.cairo-surface-copy-page.html
-rw-r--r--      6811 2016-12-08 06:19 function.ps-begin-page.html
-rw-r--r--      2935 2016-12-08 06:19 harupage.getflatness.html
-rw-r--r--      5868 2016-12-08 06:20 function.strcmp.html
-rw-r--r--      3025 2016-12-08 06:20 reflectionfunctionabstract.getclosurethis.html
-rw-r--r--      3376 2016-12-08 06:19 gearmantask.sendworkload.html
-rw-r--r--      3066 2016-12-08 06:19 gmagickdraw.annotate.html
-rw-r--r--     11689 2016-12-08 06:18 phardata.buildfromiterator.html
-rw-r--r--      4944 2016-12-08 06:19 evloop.run.html
-rw-r--r--      3564 2016-12-08 06:19 function.fam-next-event.html
-rw-r--r--      2557 2016-12-08 06:19 imagick.deconstructimages.html
-rw-r--r--      3893 2016-12-08 06:20 book.pcre.html
-rw-r--r--      3393 2016-12-08 06:19 yaf-router.getroute.html
-rw-r--r--      1395 2016-12-08 06:20 libxml.requirements.html
-rw-r--r--      4162 2016-12-08 06:20 solrclient.deletebyid.html
-rw-r--r--      3079 2016-12-08 06:19 gmagick.writeimage.html
-rw-r--r--     10135 2016-12-08 06:19 function.maxdb-warning-count.html
-rw-r--r--      3604 2016-12-08 06:20 function.libxml-disable-entity-loader.html
-rw-r--r--      2487 2016-12-08 06:19 fannconnection.getfromneuron.html
-rw-r--r--      5212 2016-12-08 06:19 cairocontext.rotate.html
-rw-r--r--      2722 2016-12-08 06:18 function.ncurses-panel-above.html
-rw-r--r--      7568 2016-12-08 06:18 function.ingres-fetch-proc-return.html
-rw-r--r--      6494 2016-12-08 06:19 threaded.synchronized.html
-rw-r--r--      3540 2016-12-08 06:19 yaf-request-http.getpost.html
-rw-r--r--      7110 2016-12-08 06:19 function.imap-setflag-full.html
-rw-r--r--      8871 2016-12-08 06:18 phar.startbuffering.html
-rw-r--r--      2454 2016-12-08 06:19 yaf-loader.wakeup.html
-rw-r--r--      2871 2016-12-08 06:19 emptyiterator.current.html
-rw-r--r--      2372 2016-12-08 06:19 function.is-tainted.html
-rw-r--r--      7712 2016-12-08 06:19 tidy.root.html
-rw-r--r--      3667 2016-12-08 06:19 function.dngettext.html
-rw-r--r--     16038 2016-12-08 06:18 rarentry.getattr.html
-rw-r--r--      5789 2016-12-08 06:18 phar.loadphar.html
-rw-r--r--      2476 2016-12-08 06:20 internals2.pdo.building.html
-rw-r--r--      7954 2016-12-08 06:18 book.pdo.html
-rw-r--r--     11311 2016-12-08 06:19 ref.stats.html
-rw-r--r--      3422 2016-12-08 06:20 reflectionparameter.getdeclaringfunction.html
-rw-r--r--      3775 2016-12-08 06:20 reflectionfunctionabstract.getnumberofparameters.html
-rw-r--r--     20919 2016-12-08 06:19 swfdisplayitem.rotateto.html
-rw-r--r--      4922 2016-12-08 06:20 class.xmldiff-file.html
-rw-r--r--      6072 2016-12-08 06:20 domdocument.createentityreference.html
-rw-r--r--     10916 2016-12-08 06:18 pharfileinfo.iscompressedgz.html
-rw-r--r--      5420 2016-12-08 06:20 domdocument.createcomment.html
-rw-r--r--     13715 2016-12-08 06:19 function.file-put-contents.html
-rw-r--r--      3144 2016-12-08 06:19 harupage.setflatness.html
-rw-r--r--      2987 2016-12-08 06:19 book.url.html
-rw-r--r--      1610 2016-12-08 06:19 mysqlinfo.concepts.html
-rw-r--r--      9333 2016-12-08 06:19 imagickdraw.setclipunits.html
-rw-r--r--      2802 2016-12-08 06:19 imagick.morphimages.html
-rw-r--r--      4177 2016-12-08 06:19 function.ps-stringwidth.html
-rw-r--r--     17694 2016-12-08 06:19 function.maxdb-fetch-array.html
-rw-r--r--      4423 2016-12-08 06:19 function.ps-set-border-style.html
-rw-r--r--      2373 2016-12-08 06:19 ref.bc.html
-rw-r--r--      2534 2016-12-08 06:20 ui-controls-tab.hasmargin.html
-rw-r--r--      4509 2016-12-08 06:19 function.cairo-scaled-font-get-type.html
-rw-r--r--      2401 2016-12-08 06:19 imagickdraw.pathfinish.html
-rw-r--r--      4211 2016-12-08 06:18 function.odbc-fetch-object.html
-rw-r--r--      5421 2016-12-08 06:19 ref.ftp.html
-rw-r--r--      9007 2016-12-08 06:19 intlcalendar.geterrorcode.html
-rw-r--r--      2778 2016-12-08 06:20 solrquery.getgroupcachepercent.html
-rw-r--r--      5746 2016-12-08 06:19 intlcalendar.gettype.html
-rw-r--r--      2070 2016-12-08 06:18 ktaglib.installation.html
-rw-r--r--      3002 2016-12-08 06:19 dir.constants.html
-rw-r--r--      3030 2016-12-08 06:19 yaf-route-interface.assemble.html
-rw-r--r--      9885 2016-12-08 06:19 mongo.constants.html
-rw-r--r--      5783 2016-12-08 06:20 regex.examples.html
-rw-r--r--      2673 2016-12-08 06:18 function.ncurses-wcolor-set.html
-rw-r--r--      7789 2016-12-08 06:19 book.sqlite.html
-rw-r--r--      4465 2016-12-08 06:19 function.ldap-get-option.html
-rw-r--r--     13507 2016-12-08 06:19 class.eventbase.html
-rw-r--r--      2419 2016-12-08 06:20 ui-draw-stroke.getcap.html
-rw-r--r--      3130 2016-12-08 06:18 function.bcompiler-write-included-filename.html
-rw-r--r--      2590 2016-12-08 06:19 gmagick.getimagescene.html
-rw-r--r--      4494 2016-12-08 06:19 memcache.flush.html
-rw-r--r--      3910 2016-12-08 06:20 function.yp-match.html
-rw-r--r--      5825 2016-12-08 06:19 function.gupnp-root-device-new.html
-rw-r--r--      2671 2016-12-08 06:18 function.ncurses-wattroff.html
-rw-r--r--      5442 2016-12-08 06:18 function.fbsql-close.html
-rw-r--r--      4850 2016-12-08 06:19 class.mongoresultexception.html
-rw-r--r--      3010 2016-12-08 06:20 internals2.opcodes.sub.html
-rw-r--r--      4499 2016-12-08 06:19 function.cairo-font-options-status.html
-rw-r--r--      4982 2016-12-08 06:20 ds-queue.allocate.html
-rw-r--r--      3931 2016-12-08 06:19 function.posix-isatty.html
-rw-r--r--     13162 2016-12-08 06:19 function.max.html
-rw-r--r--      8075 2016-12-08 06:19 mysqli.quickstart.transactions.html
-rw-r--r--      3095 2016-12-08 06:19 function.fam-pending.html
-rw-r--r--      3053 2016-12-08 06:19 imagick.setimagechanneldepth.html
-rw-r--r--      3889 2016-12-08 06:19 mongodb-bson-minkey.construct.html
-rw-r--r--      7797 2016-12-08 06:19 mysqlnduhconnection.gethostinformation.html
-rw-r--r--      2971 2016-12-08 06:19 gmagick.setsamplingfactors.html
-rw-r--r--      1375 2016-12-08 06:19 filesystem.requirements.html
-rw-r--r--      3293 2016-12-08 06:20 function.yp-errno.html
-rw-r--r--      5350 2016-12-08 06:19 yaf-view-simple.clear.html
-rw-r--r--     19183 2016-12-08 06:20 migration51.references.html
-rw-r--r--      1301 2016-12-08 06:19 lua.resources.html
-rw-r--r--      4498 2016-12-08 06:18 function.ingres-commit.html
-rw-r--r--      5233 2016-12-08 06:20 function.array-sum.html
-rw-r--r--      7064 2016-12-08 06:19 swfshape.construct.html
-rw-r--r--      6906 2016-12-08 06:20 reflectionclass.getname.html
-rw-r--r--     21371 2016-12-08 06:18 zip.constants.html
-rw-r--r--     20021 2016-12-08 06:19 eventhttp.construct.html
-rw-r--r--      5323 2016-12-08 06:19 cairocontext.settolerance.html
-rw-r--r--      2546 2016-12-08 06:19 function.eio-nready.html
-rw-r--r--      5554 2016-12-08 06:19 splobjectstorage.count.html
-rw-r--r--      4891 2016-12-08 06:19 cairoscaledfont.construct.html
-rw-r--r--      2715 2016-12-08 06:18 oggvorbis.constants.html
-rw-r--r--      3445 2016-12-08 06:20 function.yaz-addinfo.html
-rw-r--r--      5630 2016-12-08 06:20 solrquery.setgroupoffset.html
-rw-r--r--      3961 2016-12-08 06:19 mongo.tutorial.indexes.html
-rw-r--r--      3075 2016-12-08 06:19 function.imagedashedline.html
-rw-r--r--      2991 2016-12-08 06:19 posix.constants.access.html
-rw-r--r--      5295 2016-12-08 06:19 cairopattern.setmatrix.html
-rw-r--r--     23144 2016-12-08 06:18 phar.using.intro.html
-rw-r--r--      3063 2016-12-08 06:19 function.stats-rand-gen-iuniform.html
-rw-r--r--      9733 2016-12-08 06:19 tokyotyrantquery.count.html
-rw-r--r--      3346 2016-12-08 06:19 oci-lob.export.html
-rw-r--r--     57615 2016-12-08 06:18 language.types.string.html
-rw-r--r--      4899 2016-12-08 06:18 ziparchive.renameindex.html
-rw-r--r--      1354 2016-12-08 06:20 strings.requirements.html
-rw-r--r--      2973 2016-12-08 06:19 imagick.readimagefile.html
-rw-r--r--      6561 2016-12-08 06:18 function.uopz-compose.html
-rw-r--r--      3650 2016-12-08 06:19 function.fann-set-sarprop-step-error-shift.html
-rw-r--r--      3110 2016-12-08 06:20 internals2.opcodes.div.html
-rw-r--r--      2968 2016-12-08 06:19 function.hypot.html
-rw-r--r--      5113 2016-12-08 06:19 mongo.pooldebug.html
-rw-r--r--      6530 2016-12-08 06:18 pdo.pgsqllobunlink.html
-rw-r--r--      6753 2016-12-08 06:18 function.fbsql-database-password.html
-rw-r--r--     10423 2016-12-08 06:18 function.runkit-method-add.html
-rw-r--r--     17297 2016-12-08 06:20 class.ds-sequence.html
-rw-r--r--      3292 2016-12-08 06:19 function.ps-end-page.html
-rw-r--r--      2561 2016-12-08 06:19 function.mysqli-fetch.html
-rw-r--r--      3345 2016-12-08 06:19 function.stats-cdf-f.html
-rw-r--r--      3893 2016-12-08 06:19 cairofontoptions.merge.html
-rw-r--r--      2157 2016-12-08 06:19 book.fribidi.html
-rw-r--r--      4689 2016-12-08 06:19 function.event-buffer-set-callback.html
-rw-r--r--     21459 2016-12-08 06:18 pdostatement.fetchall.html
-rw-r--r--      3466 2016-12-08 06:18 function.readline-info.html
-rw-r--r--      3032 2016-12-08 06:19 intltimezone.geterrorcode.html
-rw-r--r--      6121 2016-12-08 06:18 ziparchive.statname.html
-rw-r--r--      2855 2016-12-08 06:20 function.svn-fs-apply-text.html
-rw-r--r--      3171 2016-12-08 06:19 gmagick.cropthumbnailimage.html
-rw-r--r--     10590 2016-12-08 06:18 install.macosx.bundled.html
-rw-r--r--      8359 2016-12-08 06:19 function.imap-rfc822-parse-adrlist.html
-rw-r--r--      6062 2016-12-08 06:20 migration51.databases.html
-rw-r--r--      7413 2016-12-08 06:19 function.tempnam.html
-rw-r--r--      7069 2016-12-08 06:20 function.ctype-graph.html
-rw-r--r--      3210 2016-12-08 06:18 function.newt-listbox-append-entry.html
-rw-r--r--      3656 2016-12-08 06:19 function.msql-num-fields.html
-rw-r--r--      4336 2016-12-08 06:19 recursivecallbackfilteriterator.getchildren.html
-rw-r--r--      3397 2016-12-08 06:19 hwapi.content.html
-rw-r--r--      1905 2016-12-08 06:20 internals2.opcodes.declare-inherited-class-delayed.html
-rw-r--r--      7863 2016-12-08 06:20 function.is-a.html
-rw-r--r--      1831 2016-12-08 06:19 function.imap-fetchtext.html
-rw-r--r--      3540 2016-12-08 06:19 function.shm-has-var.html
-rw-r--r--      4717 2016-12-08 06:19 splfileobject.fgetc.html
-rw-r--r--     62855 2016-12-08 06:19 book.imagick.html
-rw-r--r--      2991 2016-12-08 06:19 mongocursorinterface.dead.html
-rw-r--r--      4665 2016-12-08 06:19 cairosolidpattern.construct.html
-rw-r--r--      3296 2016-12-08 06:19 function.trader-cdlinneck.html
-rw-r--r--      3259 2016-12-08 06:19 intro.ming.html
-rw-r--r--      2435 2016-12-08 06:20 solrquery.getfacetqueries.html
-rw-r--r--      1330 2016-12-08 06:20 session-pgsql.constants.html
-rw-r--r--      4472 2016-12-08 06:19 mongo.getslave.html
-rw-r--r--      7031 2016-12-08 06:20 reflectiongenerator.gettrace.html
-rw-r--r--      1387 2016-12-08 06:20 ref.tcpwrap.html
-rw-r--r--      2067 2016-12-08 06:19 function.pdf-end-template.html
-rw-r--r--     12843 2016-12-08 06:19 intlcalendar.getskippedwalltimeoption.html
-rw-r--r--      6664 2016-12-08 06:18 phar.unlinkarchive.html
-rw-r--r--      1365 2016-12-08 06:19 sync.configuration.html
-rw-r--r--      5246 2016-12-08 06:19 norewinditerator.rewind.html
-rw-r--r--      2726 2016-12-08 06:18 function.odbc-longreadlen.html
-rw-r--r--      7828 2016-12-08 06:20 migration53.new-features.html
-rw-r--r--      4030 2016-12-08 06:18 function.openssl-x509-export-to-file.html
-rw-r--r--     11730 2016-12-08 06:19 book.stream.html
-rw-r--r--      1838 2016-12-08 06:19 sybase.installation.html
-rw-r--r--      4869 2016-12-08 06:19 dateperiod.getdateinterval.html
-rw-r--r--      8255 2016-12-08 06:19 function.mysql-free-result.html
-rw-r--r--      2586 2016-12-08 06:20 solrquery.gethighlight.html
-rw-r--r--      3285 2016-12-08 06:19 function.ps-setgray.html
-rw-r--r--      2450 2016-12-08 06:20 ui-control.setparent.html
-rw-r--r--      6390 2016-12-08 06:19 intlchar.charmirror.html
-rw-r--r--      2410 2016-12-08 06:19 imagick.getimagetickspersecond.html
-rw-r--r--      2998 2016-12-08 06:18 readline.configuration.html
-rw-r--r--      6315 2016-12-08 06:20 solrclient.request.html
-rw-r--r--      2275 2016-12-08 06:19 swfsprite.construct.html
-rw-r--r--      4680 2016-12-08 06:19 function.cairo-format-stride-for-width.html
-rw-r--r--      7483 2016-12-08 06:19 tokyotyranttable.putcat.html
-rw-r--r--      5216 2016-12-08 06:19 function.xattr-supported.html
-rw-r--r--      3545 2016-12-08 06:18 function.newt-win-message.html
-rw-r--r--      6254 2016-12-08 06:19 function.iterator-apply.html
-rw-r--r--     12419 2016-12-08 06:19 intro.mysqlnd-ms.html
-rw-r--r--      4386 2016-12-08 06:19 tokyotyrantquery.construct.html
-rw-r--r--      4579 2016-12-08 06:19 eventbufferevent.setcallbacks.html
-rw-r--r--     13981 2016-12-08 06:19 datetime.settime.html
-rw-r--r--      1325 2016-12-08 06:20 xsl.resources.html
-rw-r--r--      3209 2016-12-08 06:19 mongocursor.skip.html
-rw-r--r--      2390 2016-12-08 06:19 ref.gettext.html
-rw-r--r--      1488 2016-12-08 06:20 intro.zmq.html
-rw-r--r--      2879 2016-12-08 06:18 function.newt-form-set-height.html
-rw-r--r--      1465 2016-12-08 06:18 weakref.setup.html
-rw-r--r--     35836 2016-12-08 06:19 class.mysqlnduhconnection.html
-rw-r--r--      5860 2016-12-08 06:19 function.tidy-setopt.html
-rw-r--r--      5192 2016-12-08 06:19 splfileobject.fpassthru.html
-rw-r--r--      2764 2016-12-08 06:20 solrquery.removemltfield.html
-rw-r--r--      2316 2016-12-08 06:20 ui-executor.kill.html
-rw-r--r--     11966 2016-12-08 06:19 function.eio-grp-add.html
-rw-r--r--      7009 2016-12-08 06:19 intlchar.fordigit.html
-rw-r--r--      4599 2016-12-08 06:19 function.mysqlnd-ms-xa-rollback.html
-rw-r--r--      6266 2016-12-08 06:18 function.bcompiler-write-constant.html
-rw-r--r--      3077 2016-12-08 06:19 gmagick.setimageindex.html
-rw-r--r--      1360 2016-12-08 06:18 password.resources.html
-rw-r--r--      2747 2016-12-08 06:19 gmagick.previousimage.html
-rw-r--r--      5232 2016-12-08 06:19 function.mssql-free-result.html
-rw-r--r--      6581 2016-12-08 06:19 tokyotyrant.add.html
-rw-r--r--      3743 2016-12-08 06:19 eventbuffer.prependbuffer.html
-rw-r--r--      1826 2016-12-08 06:19 event.installation.html
-rw-r--r--      3015 2016-12-08 06:19 mongotimestamp.tostring.html
-rw-r--r--      3403 2016-12-08 06:18 function.zip-open.html
-rw-r--r--      5530 2016-12-08 06:19 function.eio-ftruncate.html
-rw-r--r--      2625 2016-12-08 06:18 function.newt-form-set-size.html
-rw-r--r--      7274 2016-12-08 06:20 ds-sequence.insert.html
-rw-r--r--      6104 2016-12-08 06:19 mysqlnd-ms.changes-one-two.html
-rw-r--r--      3265 2016-12-08 06:19 function.imagecopy.html
-rw-r--r--      4967 2016-12-08 06:20 class.ui-executor.html
-rw-r--r--      4471 2016-12-08 06:20 ds-deque.pop.html
-rw-r--r--      8521 2016-12-08 06:19 imagick.colormatriximage.html
-rw-r--r--      7158 2016-12-08 06:18 function.ibase-field-info.html
-rw-r--r--      3390 2016-12-08 06:19 function.msg-queue-exists.html
-rw-r--r--      5488 2016-12-08 06:18 rarentry.getpackedsize.html
-rw-r--r--      7140 2016-12-08 06:19 function.ftp-chdir.html
-rw-r--r--      2477 2016-12-08 06:19 yaf-loader.autoload.html
-rw-r--r--      4872 2016-12-08 06:18 function.odbc-procedures.html
-rw-r--r--      4148 2016-12-08 06:20 function.xmlwriter-start-cdata.html
-rw-r--r--      5634 2016-12-08 06:18 zlib.configuration.html
-rw-r--r--      2481 2016-12-08